BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034N23

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             103   1e-22   Prunus persica
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                102   5e-22   Prunus mume [ume]
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like           102   6e-22   Solanum tuberosum [potatoes]
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                100   2e-21   Sesamum indicum [beniseed]
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease              99.8    4e-21   
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease              97.8    2e-20   Fragaria vesca subsp. vesca
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg              95.1    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_007012625.1|  Subtilase family protein                         93.6    6e-19   
ref|XP_010090170.1|  Subtilisin-like protease                         92.0    2e-18   Morus notabilis
emb|CBI27801.3|  unnamed protein product                              92.0    2e-18   Vitis vinifera
gb|KDP33922.1|  hypothetical protein JCGZ_07493                       92.0    2e-18   Jatropha curcas
emb|CAN71376.1|  hypothetical protein VITISV_001491                   90.9    5e-18   Vitis vinifera
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease              89.7    1e-17   Vitis vinifera
ref|XP_006381615.1|  subtilase family protein                         89.7    1e-17   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g           89.7    1e-17   Phaseolus vulgaris [French bean]
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease              89.0    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease              88.6    3e-17   Populus euphratica
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like         87.8    6e-17   Glycine max [soybeans]
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg              86.7    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease              85.9    2e-16   Camelina sativa [gold-of-pleasure]
gb|EPS65938.1|  hypothetical protein M569_08836                       85.5    3e-16   Genlisea aurea
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease              84.7    7e-16   Nicotiana sylvestris
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg           84.3    8e-16   Capsella rubella
gb|KJB82990.1|  hypothetical protein B456_013G223900                  83.2    2e-15   Gossypium raimondii
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease              82.8    3e-15   Sesamum indicum [beniseed]
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease              82.8    3e-15   Camelina sativa [gold-of-pleasure]
emb|CDY33400.1|  BnaA07g04390D                                        82.8    3e-15   Brassica napus [oilseed rape]
gb|AHA84190.1|  subtilisin-like protease                              82.8    3e-15   Phaseolus vulgaris [French bean]
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1   82.4    4e-15   Tarenaya hassleriana [spider flower]
gb|KJB27211.1|  hypothetical protein B456_004G284900                  81.6    6e-15   Gossypium raimondii
gb|KJB27210.1|  hypothetical protein B456_004G284900                  81.6    6e-15   Gossypium raimondii
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease              81.6    8e-15   Nicotiana sylvestris
gb|KHG16003.1|  Subtilisin-like protease                              79.3    5e-14   Gossypium arboreum [tree cotton]
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like         79.0    7e-14   Solanum tuberosum [potatoes]
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease              78.6    9e-14   Solanum lycopersicum
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease              78.6    9e-14   Brassica rapa
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease              78.2    1e-13   Nicotiana tomentosiformis
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like         78.2    1e-13   Cicer arietinum [garbanzo]
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease              78.2    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease              77.4    2e-13   
emb|CDY18042.1|  BnaC07g04280D                                        76.6    4e-13   Brassica napus [oilseed rape]
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                 76.3    5e-13   Citrus sinensis [apfelsine]
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...  76.3    5e-13   Citrus sinensis [apfelsine]
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like         76.3    6e-13   Glycine max [soybeans]
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease              75.9    8e-13   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease              75.5    8e-13   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease              75.5    9e-13   Malus domestica [apple tree]
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg           75.1    1e-12   
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease              74.7    2e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like         74.7    2e-12   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease              74.7    2e-12   Nicotiana tomentosiformis
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg           74.3    2e-12   Eutrema salsugineum [saltwater cress]
emb|CDP03080.1|  unnamed protein product                              73.9    2e-12   Coffea canephora [robusta coffee]
ref|NP_565330.1|  Subtilase-like protein                              74.3    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease              73.6    4e-12   Eucalyptus grandis [rose gum]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease              73.6    4e-12   Cucumis melo [Oriental melon]
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative    73.6    4e-12   Ricinus communis
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease              73.6    5e-12   Eucalyptus grandis [rose gum]
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g           73.2    6e-12   Phaseolus vulgaris [French bean]
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease              72.8    7e-12   Eucalyptus grandis [rose gum]
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease              72.8    8e-12   Tarenaya hassleriana [spider flower]
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease              72.8    8e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease              71.6    2e-11   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                   71.6    2e-11   Eucalyptus grandis [rose gum]
gb|EMT29812.1|  hypothetical protein F775_42283                       69.7    8e-11   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease              69.3    1e-10   Fragaria vesca subsp. vesca
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                   69.3    1e-10   Eucalyptus grandis [rose gum]
gb|AGT16155.1|  subtilisin-like protease                              68.9    1e-10   Saccharum hybrid cultivar R570
ref|XP_004976550.1|  PREDICTED: subtilisin-like protease-like         68.9    2e-10   Setaria italica
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like         68.6    2e-10   Cicer arietinum [garbanzo]
gb|EMT07781.1|  Subtilisin-like protease                              68.6    2e-10   
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease              68.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002448366.1|  hypothetical protein SORBIDRAFT_06g025980        68.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_002519361.1|  conserved hypothetical protein                   64.7    4e-10   
gb|EMS67510.1|  Subtilisin-like protease                              67.0    5e-10   Triticum urartu
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease              67.4    5e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007017192.1|  Subtilisin-like serine protease 2, putative      66.6    9e-10   
gb|EPS61652.1|  hypothetical protein M569_13143                       66.2    1e-09   Genlisea aurea
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              65.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885806.1|  predicted protein                                65.1    2e-09   Arabidopsis lyrata subsp. lyrata
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like         65.1    2e-09   Glycine max [soybeans]
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           65.1    3e-09   Musa acuminata [banana]
gb|EYU21279.1|  hypothetical protein MIMGU_mgv1a023973mg              64.7    3e-09   Erythranthe guttata [common monkey flower]
gb|ACN28204.1|  unknown                                               65.1    3e-09   Zea mays [maize]
ref|NP_001152427.1|  LOC100286067 precursor                           65.1    3e-09   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              64.7    3e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease              64.7    4e-09   Brassica rapa
ref|XP_004961962.1|  PREDICTED: subtilisin-like protease-like         64.7    4e-09   Setaria italica
emb|CDY29697.1|  BnaA04g17300D                                        64.7    4e-09   Brassica napus [oilseed rape]
ref|XP_003595292.1|  Subtilisin-like protease                         64.7    4e-09   Medicago truncatula
dbj|BAJ87780.1|  predicted protein                                    64.3    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative    63.9    6e-09   Ricinus communis
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              63.9    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like         63.9    7e-09   Glycine max [soybeans]
emb|CDY63219.1|  BnaAnng18730D                                        63.5    8e-09   Brassica napus [oilseed rape]
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease              63.5    9e-09   Pyrus x bretschneideri [bai li]
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease              63.5    9e-09   Malus domestica [apple tree]
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like         63.5    9e-09   Glycine max [soybeans]
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease              63.5    1e-08   Populus euphratica
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease              63.5    1e-08   Pyrus x bretschneideri [bai li]
gb|EYU36336.1|  hypothetical protein MIMGU_mgv1a019012mg              63.2    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_004496012.1|  PREDICTED: subtilisin-like protease-like         63.2    1e-08   Cicer arietinum [garbanzo]
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g           63.2    1e-08   Phaseolus vulgaris [French bean]
ref|XP_003608462.1|  Subtilisin-like protease                         63.2    1e-08   Medicago truncatula
emb|CDY22001.1|  BnaC09g01070D                                        63.2    1e-08   Brassica napus [oilseed rape]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease              62.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease              62.8    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease              62.8    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              62.8    2e-08   Nelumbo nucifera [Indian lotus]
gb|ACN39811.1|  unknown                                               62.4    2e-08   Picea sitchensis
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              62.4    2e-08   Solanum lycopersicum
gb|KDP32432.1|  hypothetical protein JCGZ_13357                       62.8    2e-08   Jatropha curcas
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g           62.4    2e-08   Phaseolus vulgaris [French bean]
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like         62.4    2e-08   Glycine max [soybeans]
gb|KCW79385.1|  hypothetical protein EUGRSUZ_C00797                   62.0    2e-08   Eucalyptus grandis [rose gum]
gb|EYU36337.1|  hypothetical protein MIMGU_mgv1a020902mg              62.0    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like         62.0    3e-08   Glycine max [soybeans]
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g           62.0    3e-08   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like         62.0    3e-08   Cucumis sativus [cucumbers]
ref|XP_011468374.1|  PREDICTED: uncharacterized protein LOC101302380  62.4    3e-08   Fragaria vesca subsp. vesca
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease              62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like         62.0    3e-08   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              62.0    3e-08   Nicotiana sylvestris
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease              62.0    3e-08   Brassica rapa
emb|CDX82491.1|  BnaA03g33300D                                        61.6    4e-08   
ref|XP_007207210.1|  hypothetical protein PRUPE_ppa001938mg           61.6    4e-08   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                  61.6    4e-08   Arabis alpina [alpine rockcress]
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              61.6    4e-08   Cucumis melo [Oriental melon]
emb|CDX98438.1|  BnaC05g39370D                                        61.6    4e-08   
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g           61.6    4e-08   Phaseolus vulgaris [French bean]
gb|AAM10321.1|  AT5g67360/K8K14_8                                     61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569048.1|  subtilisin-like protease                            61.6    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KCW63975.1|  hypothetical protein EUGRSUZ_G01657                   61.2    5e-08   Eucalyptus grandis [rose gum]
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              61.2    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  61.2    5e-08   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1   61.2    5e-08   Brassica rapa
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease              61.2    5e-08   Eucalyptus grandis [rose gum]
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        61.2    5e-08   Sorghum bicolor [broomcorn]
emb|CDP02570.1|  unnamed protein product                              61.2    5e-08   Coffea canephora [robusta coffee]
ref|XP_010109072.1|  Subtilisin-like protease                         61.2    6e-08   Morus notabilis
gb|KJB08038.1|  hypothetical protein B456_001G060600                  60.8    6e-08   Gossypium raimondii
gb|EYU36340.1|  hypothetical protein MIMGU_mgv1a001790mg              60.8    6e-08   Erythranthe guttata [common monkey flower]
ref|XP_010068558.1|  PREDICTED: subtilisin-like protease              60.8    7e-08   Eucalyptus grandis [rose gum]
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like         60.8    7e-08   Cicer arietinum [garbanzo]
emb|CDY09336.1|  BnaA02g26740D                                        60.8    7e-08   Brassica napus [oilseed rape]
emb|CDX97560.1|  BnaA05g25190D                                        60.8    7e-08   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease              60.8    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease              60.8    7e-08   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              60.8    8e-08   Sesamum indicum [beniseed]
emb|CDY18653.1|  BnaA09g07420D                                        60.5    8e-08   Brassica napus [oilseed rape]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like         60.8    8e-08   Glycine max [soybeans]
gb|EYU36342.1|  hypothetical protein MIMGU_mgv1a001789mg              60.5    8e-08   Erythranthe guttata [common monkey flower]
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease              60.5    8e-08   Tarenaya hassleriana [spider flower]
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              60.5    9e-08   Nicotiana tomentosiformis
ref|NP_001051353.1|  Os03g0761500                                     60.5    9e-08   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2   60.5    1e-07   
emb|CDX75758.1|  BnaC03g38410D                                        59.3    1e-07   
ref|XP_008218400.1|  PREDICTED: subtilisin-like protease              60.5    1e-07   Prunus mume [ume]
gb|EMS48839.1|  Subtilisin-like protease                              60.5    1e-07   Triticum urartu
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease              60.5    1e-07   Pyrus x bretschneideri [bai li]
tpg|DAA51518.1|  TPA: putative subtilase family protein               60.1    1e-07   
ref|NP_001151463.1|  LOC100285096 precursor                           60.1    1e-07   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease              60.1    1e-07   Brassica rapa
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease              60.1    1e-07   Brachypodium distachyon [annual false brome]
emb|CDY18654.1|  BnaA09g07410D                                        60.1    1e-07   Brassica napus [oilseed rape]
ref|XP_007017191.1|  Subtilisin-like serine protease 2, putative      60.1    1e-07   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease              60.1    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010105482.1|  Subtilisin-like protease                         59.7    1e-07   Morus notabilis
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg           59.7    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         59.7    2e-07   Solanum tuberosum [potatoes]
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease              59.7    2e-07   Nicotiana sylvestris
emb|CDY63300.1|  BnaCnng41800D                                        59.7    2e-07   Brassica napus [oilseed rape]
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                  59.7    2e-07   Arabis alpina [alpine rockcress]
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease              59.7    2e-07   Vitis vinifera
gb|AES62637.2|  subtilisin-like serine protease                       59.7    2e-07   Medicago truncatula
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   
ref|XP_003592386.1|  Subtilisin-like protease                         59.7    2e-07   
emb|CDY57437.1|  BnaAnng14520D                                        59.3    2e-07   Brassica napus [oilseed rape]
ref|XP_002441162.1|  hypothetical protein SORBIDRAFT_09g021490        59.3    2e-07   
emb|CDY12840.1|  BnaC07g15930D                                        59.3    2e-07   Brassica napus [oilseed rape]
ref|XP_009129098.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   Brassica rapa
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   Phoenix dactylifera
gb|KJB58524.1|  hypothetical protein B456_009G213600                  59.3    2e-07   Gossypium raimondii
gb|EYU36339.1|  hypothetical protein MIMGU_mgv1a001782mg              59.3    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   Sesamum indicum [beniseed]
emb|CAA59963.1|  subtilisin-like protease                             59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AFW84453.1|  putative subtilase family protein                     59.3    2e-07   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg           59.3    2e-07   Citrus clementina [clementine]
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease              59.3    2e-07   Eucalyptus grandis [rose gum]
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  58.9    3e-07   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864           58.9    3e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  58.9    3e-07   Cucumis sativus [cucumbers]
dbj|BAJ88973.1|  predicted protein                                    58.9    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease              58.9    3e-07   Solanum lycopersicum
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              58.9    3e-07   Solanum lycopersicum
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease              58.9    3e-07   Brassica rapa
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              58.9    3e-07   Nelumbo nucifera [Indian lotus]
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease              58.9    3e-07   Nicotiana tomentosiformis
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              58.5    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-07   Setaria italica
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.5    4e-07   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-07   Citrus sinensis [apfelsine]
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease              58.5    4e-07   Sesamum indicum [beniseed]
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-07   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.5    4e-07   Elaeis guineensis
ref|XP_010105478.1|  Subtilisin-like protease                         58.5    4e-07   Morus notabilis
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                 58.5    4e-07   Citrus sinensis [apfelsine]
emb|CDY18651.1|  BnaA09g07440D                                        58.5    4e-07   Brassica napus [oilseed rape]
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like         58.5    4e-07   Cucumis sativus [cucumbers]
ref|XP_007047459.1|  Subtilase family protein                         58.5    4e-07   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease              58.2    5e-07   Brassica rapa
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like         58.2    5e-07   Citrus sinensis [apfelsine]
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg           58.2    5e-07   Citrus clementina [clementine]
ref|XP_010263511.1|  PREDICTED: subtilisin-like protease              58.2    5e-07   Nelumbo nucifera [Indian lotus]
gb|KDP41644.1|  hypothetical protein JCGZ_16051                       58.2    5e-07   Jatropha curcas
ref|XP_011069659.1|  PREDICTED: subtilisin-like protease              58.2    5e-07   Sesamum indicum [beniseed]
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g           58.2    5e-07   Phaseolus vulgaris [French bean]
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease              58.2    5e-07   
gb|KJB58523.1|  hypothetical protein B456_009G213500                  58.2    5e-07   Gossypium raimondii
gb|KHN06066.1|  Subtilisin-like protease                              58.2    5e-07   Glycine soja [wild soybean]
gb|EYU25440.1|  hypothetical protein MIMGU_mgv1a0017511mg             58.2    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_003627424.1|  Subtilisin-like serine protease                  58.2    6e-07   Medicago truncatula
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          58.2    6e-07   Prunus persica
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like         58.2    6e-07   Cicer arietinum [garbanzo]
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg           57.8    6e-07   Capsella rubella
dbj|BAJ87233.1|  predicted protein                                    57.8    6e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN60787.1|  hypothetical protein VITISV_034533                   57.8    6e-07   Vitis vinifera
dbj|BAJ88882.1|  predicted protein                                    57.8    6e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB43875.1|  hypothetical protein B456_007G221100                  57.8    7e-07   Gossypium raimondii
ref|XP_009338017.1|  PREDICTED: subtilisin-like protease              57.8    7e-07   Pyrus x bretschneideri [bai li]
emb|CDY55359.1|  BnaCnng28690D                                        57.8    7e-07   Brassica napus [oilseed rape]
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease              57.8    7e-07   Prunus mume [ume]
emb|CDY40653.1|  BnaA03g53100D                                        57.8    7e-07   Brassica napus [oilseed rape]
ref|XP_002284864.1|  PREDICTED: subtilisin-like protease              57.8    7e-07   Vitis vinifera
emb|CAA59964.1|  subtilisin-like protease                             57.8    7e-07   Alnus glutinosa
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like         57.8    7e-07   Cicer arietinum [garbanzo]
ref|XP_009337959.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  57.8    8e-07   
ref|XP_002284869.3|  PREDICTED: subtilisin-like protease              57.8    8e-07   Vitis vinifera
emb|CDY67452.1|  BnaCnng55020D                                        57.4    8e-07   Brassica napus [oilseed rape]
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like         57.4    9e-07   Glycine max [soybeans]
ref|XP_009342993.1|  PREDICTED: subtilisin-like protease              57.4    9e-07   Pyrus x bretschneideri [bai li]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              57.4    9e-07   Populus euphratica
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              57.4    9e-07   Cucumis melo [Oriental melon]
emb|CDY63302.1|  BnaCnng41810D                                        57.4    9e-07   Brassica napus [oilseed rape]
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg           57.4    9e-07   Prunus persica
dbj|BAJ90426.1|  predicted protein                                    57.4    9e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP32042.1|  hypothetical protein JCGZ_12503                       57.4    9e-07   Jatropha curcas
gb|AAO62352.1|  subtilase                                             57.4    1e-06   Casuarina glauca
emb|CDP20511.1|  unnamed protein product                              57.4    1e-06   Coffea canephora [robusta coffee]
emb|CDY43570.1|  BnaC02g16670D                                        55.1    1e-06   Brassica napus [oilseed rape]
emb|CDY00497.1|  BnaA10g07760D                                        57.4    1e-06   
ref|XP_006342632.1|  PREDICTED: subtilisin-like protease-like         57.4    1e-06   Solanum tuberosum [potatoes]
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              57.4    1e-06   Brassica rapa
ref|XP_002865029.1|  subtilase family protein                         57.0    1e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease              57.0    1e-06   Prunus mume [ume]
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like         57.0    1e-06   Solanum tuberosum [potatoes]
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease              57.0    1e-06   Fragaria vesca subsp. vesca
gb|KJB29423.1|  hypothetical protein B456_005G099900                  57.0    1e-06   Gossypium raimondii
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease              57.0    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg           57.0    1e-06   Prunus persica
ref|XP_009771086.1|  PREDICTED: subtilisin-like protease              57.0    1e-06   Nicotiana sylvestris
ref|XP_006393907.1|  hypothetical protein EUTSA_v10005646mg           57.0    1e-06   Eutrema salsugineum [saltwater cress]
gb|AES92191.2|  subtilisin-like serine protease                       56.6    1e-06   Medicago truncatula
emb|CBI33725.3|  unnamed protein product                              56.6    2e-06   Vitis vinifera
ref|XP_008355893.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   
ref|XP_008370912.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   
ref|XP_003609994.1|  Subtilisin-like protease                         56.6    2e-06   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   Nicotiana tomentosiformis
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease              56.6    2e-06   Vitis vinifera
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg           56.6    2e-06   Capsella rubella
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520        56.6    2e-06   Amborella trichopoda
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   Vitis vinifera
ref|XP_002510884.1|  Cucumisin precursor, putative                    56.6    2e-06   Ricinus communis
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  56.6    2e-06   
ref|XP_011069662.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   Sesamum indicum [beniseed]
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   Malus domestica [apple tree]
ref|XP_008370910.1|  PREDICTED: subtilisin-like protease              56.2    2e-06   
ref|XP_010087293.1|  Subtilisin-like protease                         56.6    2e-06   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              56.6    2e-06   
ref|XP_008241490.1|  PREDICTED: subtilisin-like protease              56.2    2e-06   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  56.2    2e-06   
ref|XP_010547521.1|  PREDICTED: subtilisin-like protease SDD1         56.2    2e-06   
ref|XP_008657904.1|  PREDICTED: subtilisin-like protease              56.2    2e-06   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like         56.2    2e-06   
ref|XP_010320328.1|  PREDICTED: subtilisin-like protease              56.2    3e-06   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g           56.2    3e-06   
gb|KJB34441.1|  hypothetical protein B456_006G065800                  55.8    3e-06   
gb|KJB34440.1|  hypothetical protein B456_006G065800                  55.8    3e-06   
ref|XP_006653695.1|  PREDICTED: subtilisin-like protease-like         55.8    3e-06   
ref|XP_006655358.1|  PREDICTED: subtilisin-like protease-like         55.8    3e-06   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              55.8    3e-06   
ref|XP_009343011.1|  PREDICTED: subtilisin-like protease              55.8    3e-06   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...  55.8    3e-06   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease              55.8    3e-06   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like         55.8    3e-06   
ref|XP_002282856.2|  PREDICTED: subtilisin-like protease              55.8    3e-06   
emb|CAN60788.1|  hypothetical protein VITISV_034534                   55.8    3e-06   
ref|XP_006280074.1|  hypothetical protein CARUB_v10025957mg           55.8    3e-06   
gb|KJB34438.1|  hypothetical protein B456_006G065800                  55.5    3e-06   
ref|XP_008785865.1|  PREDICTED: subtilisin-like protease              55.5    3e-06   
ref|NP_001234282.1|  SBT1 protein precursor                           55.5    3e-06   
ref|XP_004972264.1|  PREDICTED: subtilisin-like protease-like         55.5    3e-06   
ref|XP_002523606.1|  Cucumisin precursor, putative                    55.5    4e-06   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           55.5    4e-06   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    55.5    4e-06   
gb|KDP22364.1|  hypothetical protein JCGZ_26195                       55.5    4e-06   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841           55.5    4e-06   
ref|XP_010487225.1|  PREDICTED: subtilisin-like protease              52.4    4e-06   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like         55.5    4e-06   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg           55.5    4e-06   
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
gb|KCW54937.1|  hypothetical protein EUGRSUZ_I00910                   55.5    4e-06   
ref|XP_010028239.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_010105479.1|  Subtilisin-like protease                         55.5    4e-06   
ref|XP_011074394.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_004252763.1|  PREDICTED: subtilisin-like protease              55.5    4e-06   
ref|XP_008357007.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  55.1    4e-06   
ref|XP_006847107.1|  hypothetical protein AMTR_s00017p00219220        55.1    5e-06   
ref|NP_567972.1|  subtilisin-like serine protease 2                   55.1    5e-06   
ref|XP_007017194.1|  Subtilisin-like serine endopeptidase family ...  55.1    5e-06   
dbj|BAJ99493.1|  predicted protein                                    55.1    5e-06   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg           55.1    5e-06   
ref|XP_002510194.1|  Xylem serine proteinase 1 precursor, putative    55.1    6e-06   
ref|XP_003535388.1|  PREDICTED: subtilisin-like protease-like         55.1    6e-06   
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease              55.1    6e-06   
ref|NP_001234288.1|  SBT2 protein precursor                           54.7    6e-06   
ref|XP_010484555.1|  PREDICTED: subtilisin-like protease              54.7    6e-06   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg           54.7    6e-06   
emb|CDP17236.1|  unnamed protein product                              54.7    6e-06   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like         54.7    6e-06   
ref|XP_008382901.1|  PREDICTED: subtilisin-like protease              54.7    6e-06   
ref|XP_011069661.1|  PREDICTED: subtilisin-like protease              54.7    6e-06   
ref|XP_008220348.1|  PREDICTED: subtilisin-like protease              54.7    6e-06   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050        54.7    6e-06   
emb|CAH66960.1|  OSIGBa0147H17.8                                      54.7    7e-06   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like         54.7    7e-06   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           54.7    7e-06   
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease              54.7    7e-06   
ref|NP_001053614.1|  Os04g0573300                                     54.7    7e-06   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease              54.7    7e-06   
ref|XP_006342631.1|  PREDICTED: subtilisin-like protease-like         54.7    8e-06   
ref|XP_004512212.1|  PREDICTED: subtilisin-like protease-like         54.7    8e-06   
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg           54.7    8e-06   
gb|EYU19442.1|  hypothetical protein MIMGU_mgv1a001731mg              54.7    8e-06   
ref|XP_009790288.1|  PREDICTED: subtilisin-like protease              54.7    8e-06   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like         54.3    8e-06   
ref|XP_007147252.1|  hypothetical protein PHAVU_006G108700g           54.3    9e-06   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              54.3    9e-06   
dbj|BAJ89456.1|  predicted protein                                    54.3    9e-06   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           54.3    9e-06   
ref|XP_010446286.1|  PREDICTED: subtilisin-like protease              53.9    9e-06   
gb|EPS61757.1|  hypothetical protein M569_13035                       54.3    9e-06   
ref|XP_008352138.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  54.3    1e-05   
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease              54.3    1e-05   
ref|XP_004512211.1|  PREDICTED: subtilisin-like protease-like         54.3    1e-05   
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like         54.3    1e-05   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease              54.3    1e-05   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg           53.9    1e-05   
emb|CBI35855.3|  unnamed protein product                              54.3    1e-05   
ref|XP_009604890.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g           53.9    1e-05   
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2    53.9    1e-05   
ref|XP_010320327.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
ref|XP_009800439.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159           53.9    1e-05   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1    53.9    1e-05   
ref|XP_002321861.2|  subtilase family protein                         53.9    1e-05   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease              53.9    1e-05   
gb|EAY98174.1|  hypothetical protein OsI_20091                        53.5    1e-05   
ref|NP_001055646.1|  Os05g0435800                                     53.5    1e-05   
ref|XP_007024651.1|  Subtilase family protein                         53.5    1e-05   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease              53.5    1e-05   
ref|XP_007224572.1|  hypothetical protein PRUPE_ppa1027224mg          53.5    1e-05   
ref|XP_003590866.1|  Subtilisin-like protease                         53.5    2e-05   
ref|XP_011069660.1|  PREDICTED: subtilisin-like protease              53.5    2e-05   
ref|XP_004229664.2|  PREDICTED: subtilisin-like protease              53.5    2e-05   
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease              53.5    2e-05   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like         53.5    2e-05   
gb|AES61117.2|  subtilisin-like serine protease                       53.5    2e-05   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease              53.5    2e-05   
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g           53.5    2e-05   
gb|EYU36350.1|  hypothetical protein MIMGU_mgv1a001799mg              53.5    2e-05   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1   53.5    2e-05   
ref|XP_006369092.1|  subtilase family protein                         53.5    2e-05   
ref|XP_003553772.1|  PREDICTED: subtilisin-like protease-like         53.5    2e-05   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g           53.5    2e-05   
ref|XP_011043530.1|  PREDICTED: subtilisin-like protease              53.5    2e-05   
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                  53.1    2e-05   
ref|XP_002282841.2|  PREDICTED: uncharacterized protein LOC100259061  53.5    2e-05   
gb|AAM60964.1|  subtilisin-like serine protease                       53.1    2e-05   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_008363295.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  53.1    2e-05   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   53.1    2e-05   
ref|XP_007143987.1|  hypothetical protein PHAVU_007G119500g           53.1    2e-05   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                 53.1    2e-05   
ref|XP_002267740.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
dbj|BAJ91233.1|  predicted protein                                    53.1    2e-05   
emb|CDP01316.1|  unnamed protein product                              53.1    2e-05   
gb|AIX97848.1|  SBT1.5                                                53.1    2e-05   
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_010464539.1|  PREDICTED: subtilisin-like protease              53.1    2e-05   
ref|XP_002465573.1|  hypothetical protein SORBIDRAFT_01g041350        53.1    2e-05   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                  53.1    2e-05   
gb|KEH30495.1|  subtilisin-like serine protease                       53.1    2e-05   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg           53.1    2e-05   
gb|EEC74847.1|  hypothetical protein OsI_10711                        52.8    2e-05   
dbj|BAJ94518.1|  predicted protein                                    52.8    2e-05   
ref|XP_003558354.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like         52.8    3e-05   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
emb|CDX99895.1|  BnaC09g28100D                                        52.8    3e-05   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase           52.8    3e-05   
ref|NP_001145972.1|  uncharacterized protein LOC100279499 precursor   52.8    3e-05   
ref|NP_566473.2|  Subtilase family protein                            52.8    3e-05   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_007158029.1|  hypothetical protein PHAVU_002G118200g           52.8    3e-05   
gb|AFW81831.1|  putative subtilase family protein                     52.8    3e-05   
ref|XP_003566210.2|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_008785921.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1   52.8    3e-05   
ref|NP_001049524.2|  Os03g0242900                                     52.8    3e-05   
ref|XP_010320531.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
gb|EMS68367.1|  Subtilisin-like protease                              52.8    3e-05   
ref|XP_002310134.2|  subtilase family protein                         52.8    3e-05   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              52.8    3e-05   
ref|XP_006473885.1|  PREDICTED: subtilisin-like protease-like         52.8    3e-05   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  52.8    3e-05   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like         52.8    3e-05   
ref|NP_566483.1|  Subtilase family protein                            52.8    3e-05   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like         52.8    3e-05   
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like         52.4    3e-05   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg           52.4    3e-05   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              52.4    3e-05   
emb|CDP05276.1|  unnamed protein product                              52.4    3e-05   
gb|KDO84128.1|  hypothetical protein CISIN_1g047470mg                 52.4    3e-05   
ref|XP_006342910.1|  PREDICTED: subtilisin-like protease-like         52.4    3e-05   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease              52.4    3e-05   
ref|XP_006434736.1|  hypothetical protein CICLE_v10003898mg           52.4    3e-05   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease              52.4    3e-05   
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease         52.4    4e-05   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   52.4    4e-05   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                 52.4    4e-05   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  52.4    4e-05   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease              52.4    4e-05   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease              52.4    4e-05   
ref|XP_008788427.1|  PREDICTED: subtilisin-like protease              52.4    4e-05   
emb|CDX72509.1|  BnaC07g45310D                                        52.4    4e-05   
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130        52.4    4e-05   
ref|XP_007135315.1|  hypothetical protein PHAVU_010G119000g           52.4    4e-05   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like         52.4    4e-05   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease              52.4    4e-05   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg           52.4    4e-05   
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease              52.4    4e-05   
ref|XP_007135313.1|  hypothetical protein PHAVU_010G118800g           52.4    4e-05   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g           52.0    4e-05   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like         52.0    4e-05   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_009771925.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_002886065.1|  predicted protein                                52.0    5e-05   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_011464036.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
gb|EMT12865.1|  Subtilisin-like protease                              52.0    5e-05   
ref|XP_010320326.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
emb|CBI19425.3|  unnamed protein product                              52.0    5e-05   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         52.0    5e-05   
ref|XP_011074393.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
gb|EMT01035.1|  Subtilisin-like protease                              52.0    5e-05   
ref|XP_010263512.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
emb|CDY33251.1|  BnaC01g37240D                                        52.0    5e-05   
ref|XP_002277899.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease              52.0    5e-05   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg           52.0    5e-05   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1   52.0    6e-05   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g           52.0    6e-05   
ref|XP_010111996.1|  Subtilisin-like protease                         52.0    6e-05   
ref|XP_006369129.1|  subtilase family protein                         52.0    6e-05   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2   51.6    6e-05   
ref|NP_569044.1|  Subtilisin-like serine endopeptidase family pro...  51.6    6e-05   
gb|ADD09584.1|  proteinase inhibitor                                  51.6    6e-05   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg           51.6    6e-05   
ref|XP_002510195.1|  Cucumisin precursor, putative                    51.6    6e-05   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease              51.6    6e-05   
gb|KHN12975.1|  Subtilisin-like protease                              51.6    6e-05   
gb|KEH35793.1|  subtilisin-like serine protease                       51.6    7e-05   
ref|XP_002313857.1|  hypothetical protein POPTR_0009s10340g           51.6    7e-05   
emb|CBI24480.3|  unnamed protein product                              51.6    7e-05   
ref|XP_006426784.1|  hypothetical protein CICLE_v10024934mg           51.6    7e-05   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  51.6    7e-05   



>ref|XP_007204263.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
 gb|EMJ05462.1| hypothetical protein PRUPE_ppa001798mg [Prunus persica]
Length=763

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 68/88 (77%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSL  357
            WF+A+ +L+  L      +A+AK+TYIV M HH KPSS+ TH DWY+AHLQ   S+EDSL
Sbjct  8    WFAALLLLVTCL------SAMAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYTTAYHGFAA+L +++ E LR+S++
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDS  89



>ref|XP_008242250.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSL  357
            WF+A+ +L+  L      +A AK+TYIV M HH KPSS+ TH DWY+AHLQ   S+EDSL
Sbjct  8    WFAALLLLVTCL------SAKAKQTYIVQMNHHSKPSSYATHHDWYSAHLQSLSSTEDSL  61

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYTTAYHGFAA+L +++ E LR+S++
Sbjct  62   LYTYTTAYHGFAASLDSEQAELLRQSDS  89



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/93 (57%), Positives = 65/93 (70%), Gaps = 8/93 (9%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAV---AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ----  339
            ++  S I ILL  L    +T+A+    KKTYIVHMKHH KP SF TH  WY  HLQ    
Sbjct  6    IILLSTINILL-FLHSSTSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTS  64

Query  340  SSEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
            S+++SLLYTYTTAYHGFAA+L + EVE LR+S+
Sbjct  65   STQNSLLYTYTTAYHGFAASLDSHEVELLRQSD  97



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 8/92 (9%)
 Frame = +1

Query  178  SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----S  345
            +++WF A++ ++    P       AKKTYIVHMKHH+KP+S+ TH DWY  HLQS    +
Sbjct  5    AVIWFLAVSFVI----PSCLHLTCAKKTYIVHMKHHQKPASYATHSDWYTDHLQSLTSGA  60

Query  346  EDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             DSLLYTY  AYHG+AAAL  +EVE LR+SE+
Sbjct  61   GDSLLYTYDVAYHGYAAALIPEEVESLRQSES  92



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 60/90 (67%), Gaps = 4/90 (4%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ----SSE  348
            ++   ++ IL  L    +A     KKTYIVHMKHH KP SF TH  WY  HLQ    S++
Sbjct  6    IILLFSMNILFFLHSSTSAIPISTKKTYIVHMKHHLKPPSFSTHHQWYKTHLQSLTSSTQ  65

Query  349  DSLLYTYTTAYHGFAAALGADEVERLRRSE  438
            +SLLYTYT AYHGFAA+L + EVE LR+SE
Sbjct  66   NSLLYTYTNAYHGFAASLDSHEVELLRKSE  95



>ref|XP_004287641.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=765

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 63/92 (68%), Gaps = 13/92 (14%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------S  345
            W  A+TILL    PC   +  AK+TYIV MKHH KPSSF TH DWY+A+LQ+        
Sbjct  9    WVVALTILL----PC--LSVTAKQTYIVQMKHHSKPSSFATHSDWYSANLQAVSSDSYSD  62

Query  346  EDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             D+LLYTY TAYHGFAA+L  D+ E LR+SE+
Sbjct  63   SDALLYTYDTAYHGFAASLDPDQAETLRQSES  94



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 6/93 (6%)
 Frame = +1

Query  181  LVWFSAIT-ILLHLLRP-CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----  342
            ++W  A+  +LLH   P  +ATAA A KTYIVHMKH++KP+S+ TH +WY+ HLQS    
Sbjct  6    VIWLCAVAFVLLHSWLPLVSATAAAAVKTYIVHMKHNQKPASYATHTEWYSDHLQSLTSA  65

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            + DSLLYTY  AY GFAAAL  +E + +R+S++
Sbjct  66   APDSLLYTYDAAYSGFAAALTPEEADSIRQSDS  98



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 57/67 (85%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSLLYTYTTAYHGFAAALGADEVE  420
            AKKTYIVHMKHH+KP SF+TH DWY++ LQ   ++ DSLLY+YTTA++GFAA+L  ++VE
Sbjct  21   AKKTYIVHMKHHDKPLSFETHHDWYSSSLQALSAAPDSLLYSYTTAFNGFAASLDPEQVE  80

Query  421  RLRRSEA  441
             LR+S++
Sbjct  81   LLRKSDS  87



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 70/95 (74%), Gaps = 9/95 (9%)
 Frame = +1

Query  172  MGSLVWFS-AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---  339
            M   +WFS ++ +LL L++ C +     K+TYIVHMK+H+KP ++ TH DWY+A+LQ   
Sbjct  1    MAKPIWFSFSVLLLLLLVQQCRSE----KRTYIVHMKNHDKPLAYATHHDWYSANLQSLS  56

Query  340  -SSEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             S+EDSLLYTYT +Y+GFAA+L  D+ E LR+S++
Sbjct  57   ASAEDSLLYTYTNSYNGFAASLDPDQAELLRKSDS  91



>emb|CBI27801.3| unnamed protein product [Vitis vinifera]
Length=703

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +1

Query  169  AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---  339
            AM S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQ   
Sbjct  42   AMASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSIS  95

Query  340  SSEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            S+ D LLYTY+TAYHGFAA+L  ++ E LR+S++
Sbjct  96   SNSDDLLYTYSTAYHGFAASLDPEQAEALRKSDS  129



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSLLYTYTTAYHGFAAALGAD  411
            +  AK+TYIVHMKH+ KP SF TH DWY+A LQ   S+ DSLLYTYTTA+ GFAA+L  +
Sbjct  21   SVTAKQTYIVHMKHNAKPESFATHHDWYSASLQSITSASDSLLYTYTTAFPGFAASLDPE  80

Query  412  EVERLRRSEA  441
            EV+ LR S+A
Sbjct  81   EVDSLRNSDA  90



>emb|CAN71376.1| hypothetical protein VITISV_001491 [Vitis vinifera]
Length=734

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---S  342
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQ   S
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYXTHDDWYSASLQSISS  54

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            + D LLYTY+TAYHGFAA+L  ++ E LR+S++
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDS  87



>ref|XP_002278292.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=761

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---S  342
            M S+VW      L      C + + +AK+TYIV M H +KP S+ TH DWY+A LQ   S
Sbjct  1    MASVVW------LFSFWFACFSLSVMAKRTYIVQMNHRQKPLSYATHDDWYSASLQSISS  54

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            + D LLYTY+TAYHGFAA+L  ++ E LR+S++
Sbjct  55   NSDDLLYTYSTAYHGFAASLDPEQAEALRKSDS  87



>ref|XP_006381615.1| subtilase family protein [Populus trichocarpa]
 gb|ERP59412.1| subtilase family protein [Populus trichocarpa]
Length=768

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSLLYTYTTAYHGFAAALGADEVE  420
            AK+TYIVHMKH+ KP SF TH DWY A LQ   S+ DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  421  RLRRSEA  441
             L++S++
Sbjct  89   LLKQSQS  95



>ref|XP_007138654.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
 gb|ESW10648.1| hypothetical protein PHAVU_009G226900g [Phaseolus vulgaris]
Length=761

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  342
            MGS  +F+  T  + L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQS   
Sbjct  1    MGS--FFTLFTFSVLLVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQSFTT  58

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
              D LLYTYT AY+GFAA+L  D+ + L RSE
Sbjct  59   DSDPLLYTYTDAYNGFAASLAEDQAQELLRSE  90



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  372
            S+ITI+   L       A AKKTYIV +KH +KP SFQTH DWY + LQ SE SLLYTYT
Sbjct  4    SSITIITTFLFLFLLHHASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQ-SESSLLYTYT  62

Query  373  TAYHGFAAALGADEVERLRR  432
            T++HG++A L +DE + L R
Sbjct  63   TSFHGYSAYLDSDEADSLLR  82



>ref|XP_011039978.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=767

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSEDSLLYTYTTAYHGFAAALGADEVE  420
            AK+TYIVHMKH+ KP SF TH DWY A LQ   S+ DSLLYTYT A+ GFAA+L  +EVE
Sbjct  29   AKQTYIVHMKHNTKPDSFPTHHDWYTASLQSVTSTPDSLLYTYTNAFDGFAASLSDEEVE  88

Query  421  RLRRSEA  441
             L++S++
Sbjct  89   FLKQSQS  95



>ref|XP_003533787.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 11/74 (15%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS-----------EDSLLYTYTTAYHGFAA  396
            AKKTYIVHMKHHEKPS + TH DWY+A LQ S            + LLY+YTTAY+GFAA
Sbjct  26   AKKTYIVHMKHHEKPSVYPTHTDWYSASLQQSLTLTTADSDSDSNPLLYSYTTAYNGFAA  85

Query  397  ALGADEVERLRRSE  438
            +L  ++ E+L RSE
Sbjct  86   SLNDEQAEQLLRSE  99



>gb|EYU25847.1| hypothetical protein MIMGU_mgv1a001711mg [Erythranthe guttata]
Length=770

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 8/95 (8%)
 Frame = +1

Query  169  AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  342
             + S+    AI ++L L   C  + + AKKTYIVHMKH  KP+ + TH +WY+ H QS  
Sbjct  2    GLASVFCVCAIAVVLQL---CLFSVS-AKKTYIVHMKHRHKPAIYATHGEWYSDHFQSLT  57

Query  343  --SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                DSLLYTY  AYHGFAAA+  +E E LR+S++
Sbjct  58   AADPDSLLYTYDAAYHGFAAAMSPEEAESLRQSDS  92



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  244  AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  423
            A AKKTYIV +KH +KP SFQTH DWY + LQ SE SLLYTYTT++HG++A L +DE + 
Sbjct  21   ASAKKTYIVRVKHSDKPDSFQTHHDWYTSQLQ-SESSLLYTYTTSFHGYSAYLDSDEADS  79

Query  424  LRR  432
            L R
Sbjct  80   LLR  82



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 4/68 (6%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  417
            AKKTYIVHMK H KP S++TH DWY+ HL S     ED+LLY Y  AY GFAAA+  +EV
Sbjct  2    AKKTYIVHMKRHMKPPSYRTHADWYSQHLASVASAEEDALLYAYDAAYPGFAAAMSPEEV  61

Query  418  ERLRRSEA  441
            + LRRS++
Sbjct  62   DSLRRSDS  69



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 5/75 (7%)
 Frame = +1

Query  232  AATAAV-AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ----SSEDSLLYTYTTAYHGFAA  396
            ++ AA+  KKTYIVHMKHH KP SF TH  WY ++LQ    S+++SLLYTY  A HGFAA
Sbjct  17   SSMAAIPTKKTYIVHMKHHLKPPSFSTHHQWYKSYLQSLTSSNKNSLLYTYDIASHGFAA  76

Query  397  ALGADEVERLRRSEA  441
            +L   EV+ LR+S++
Sbjct  77   SLYPHEVDLLRQSDS  91



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +1

Query  244  AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVER  423
            A AKKTYIV +KH +KP SFQ+H DWY++ L +SE SLLYTYTT++HGF+A L + E E 
Sbjct  23   AAAKKTYIVRVKHSDKPESFQSHHDWYSSQL-NSESSLLYTYTTSFHGFSAYLTSSEAES  81

Query  424  LRR  432
            L R
Sbjct  82   LLR  84



>gb|KJB82990.1| hypothetical protein B456_013G223900 [Gossypium raimondii]
Length=760

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  417
            AKKTYIVHMKH +KP SF+TH DWY++ LQS      +SLLY+Y  A+HGFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYSSSLQSLTATPAESLLYSYNAAFHGFAASLDPEQA  79

Query  418  ERLRRSEA  441
            E L +S++
Sbjct  80   EALSKSDS  87



>ref|XP_011093838.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=743

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 10/92 (11%)
 Frame = +1

Query  181  LVWFSAITILLHL-LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----S  345
            +V   A   LLH  L P +A     KKTYIV M H +KP S+ TH  WY+ HLQ+    +
Sbjct  6    VVCLCAAVFLLHSSLFPVSA-----KKTYIVQMNHQQKPPSYATHGQWYSDHLQTLTSAA  60

Query  346  EDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             +S+LYTY +AY+GFAAAL  +EVE LR+S++
Sbjct  61   PESILYTYGSAYNGFAAALSDEEVESLRQSDS  92



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  429
            AKKTYIV +KH ++P SFQTH DWY + LQ SE SLLYTYTT++HG++A L +DE + L 
Sbjct  24   AKKTYIVRVKHSDEPDSFQTHHDWYTSQLQ-SESSLLYTYTTSFHGYSAYLDSDEADSLL  82

Query  430  R  432
            R
Sbjct  83   R  83



>emb|CDY33400.1| BnaA07g04390D [Brassica napus]
Length=751

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 10/77 (13%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDSLLYTYTTAYHGF  390
            +A AK+TYIV +KH +KP SF TH DWY + LQS          SE  LLYTYTT+++GF
Sbjct  18   SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSESESPLLYTYTTSFNGF  77

Query  391  AAALGADEVERLRRSEA  441
            +A L  DE E L RSE+
Sbjct  78   SAFLDTDEAESLLRSES  94



>gb|AHA84190.1| subtilisin-like protease [Phaseolus vulgaris]
Length=760

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 56/91 (62%), Gaps = 10/91 (11%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ-----SS  345
            LV FS +     L+  C       KKTYIVHMKH  KP+ + TH DWY+A+LQ       
Sbjct  9    LVHFSVL-----LVAQCCWCLTSPKKTYIVHMKHRNKPAIYPTHTDWYSANLQLLLSPLH  63

Query  346  EDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
             D LLYTYTTAY+GFAA+L  D+ + L RSE
Sbjct  64   SDPLLYTYTTAYNGFAASLAEDQAQELLRSE  94



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 51/73 (70%), Gaps = 7/73 (10%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS-------EDSLLYTYTTAYHGFAAA  399
            A  +++TYIV M HH KP SF TH DWY++HLQS        E SLLYTYT+A+HGFAA 
Sbjct  28   AGASRRTYIVRMNHHAKPESFSTHHDWYSSHLQSLSSSSDSGEYSLLYTYTSAFHGFAAV  87

Query  400  LGADEVERLRRSE  438
            L  DE E LRRS+
Sbjct  88   LNPDEAEALRRSD  100



>gb|KJB27211.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=630

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----SLLYTYTTAYHGFAAALGADEV  417
            AKKTYIV MKH +KP SF+TH DW+++ LQS  D    SLLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  418  ERLRRSEA  441
            E L +SE+
Sbjct  85   ESLSKSES  92



>gb|KJB27210.1| hypothetical protein B456_004G284900 [Gossypium raimondii]
Length=762

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 4/68 (6%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED----SLLYTYTTAYHGFAAALGADEV  417
            AKKTYIV MKH +KP SF+TH DW+++ LQS  D    SLLY+YT A++GFAA+L  ++ 
Sbjct  25   AKKTYIVQMKHQDKPLSFETHHDWHSSSLQSLTDSPPESLLYSYTEAFNGFAASLNEEQA  84

Query  418  ERLRRSEA  441
            E L +SE+
Sbjct  85   ESLSKSES  92



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 13/96 (14%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAH------  333
            MGS + FS I +LL +L+PC     +AKK YIVHMK+H+ PSSF TH DWY A       
Sbjct  1    MGSFLCFSVIVVLL-VLQPC-----LAKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  334  -LQSSEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
               S E SLLY+Y  AY GFAA+L   E E LR+S+
Sbjct  55   SSTSDESSLLYSYDAAYSGFAASLDPHEAELLRQSD  90



>gb|KHG16003.1| Subtilisin-like protease [Gossypium arboreum]
Length=760

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 4/68 (6%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEV  417
            AKKTYIVHMKH +KP SF+TH DWY + LQS      +SLLY+Y  A++GFAA+L  ++ 
Sbjct  20   AKKTYIVHMKHQDKPLSFETHNDWYRSSLQSLTSTPAESLLYSYNAAFNGFAASLDPEQA  79

Query  418  ERLRRSEA  441
            E L +S++
Sbjct  80   EALGKSDS  87



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 62/99 (63%), Gaps = 16/99 (16%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAH------  333
            MGSL+ F  I  LL +L PC      AKKTYIVH+KHH+KPSS+ TH DWY A       
Sbjct  1    MGSLLCFCLIAFLL-VLHPC-----FAKKTYIVHVKHHQKPSSYSTHHDWYDAQLKSLSS  54

Query  334  ----LQSSEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
                  S+ +SLLY+Y TAY GFAA+L   E E LR+S+
Sbjct  55   SSSSSSSNSESLLYSYDTAYPGFAASLDPHEAELLRQSD  93



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 60/94 (64%), Gaps = 11/94 (12%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAH-----L  336
            MGSL  FS I  LL +L PC      AKKTYIVH+KH +KP S+ TH DWY A       
Sbjct  1    MGSLFCFSLIAFLL-VLHPC-----FAKKTYIVHVKHQQKPPSYSTHHDWYDAQLKSLSS  54

Query  337  QSSEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
             S+ +SLLY+Y TAY GFAA+L   E E LR+SE
Sbjct  55   SSNSESLLYSYDTAYPGFAASLDPHEAELLRQSE  88



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 12/79 (15%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-SED-----------SLLYTYTTAYH  384
            +A AK+TYIV +KH +KP SF TH DWY + LQS S D            LLYTYTT+++
Sbjct  18   SAEAKRTYIVRVKHSDKPESFSTHHDWYTSQLQSISTDPQSQSQSESESPLLYTYTTSFN  77

Query  385  GFAAALGADEVERLRRSEA  441
            GF+A L  DE E L RSE+
Sbjct  78   GFSAFLDTDEAESLLRSES  96



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 59/96 (61%), Gaps = 13/96 (14%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAH------  333
            MGS + FS I + L + +PC      +KK YIVHMK+H+ PSSF TH DWY A       
Sbjct  1    MGSFLCFSVIVLFL-VFQPC-----FSKKVYIVHMKNHQIPSSFATHHDWYNAQLQSLSS  54

Query  334  -LQSSEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
               S E SLLY+Y TAY GFAA+L   E E LR+S+
Sbjct  55   SSTSDESSLLYSYDTAYSGFAASLDPHEAELLRQSD  90



>ref|XP_004488082.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 16/86 (19%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLY  363
            +++   +KKTYIVHMK H KPS +QTH DWY A LQS                  D LLY
Sbjct  17   SSSINASKKTYIVHMKDHNKPSVYQTHHDWYTASLQSLSINTDSESSDSDSDSDFDPLLY  76

Query  364  TYTTAYHGFAAALGADEVERLRRSEA  441
            +YTTAY+GFA  L  ++V+ L RS++
Sbjct  77   SYTTAYNGFAVTLNDEQVQSLTRSDS  102



>ref|XP_010273846.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=761

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  238  TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEV  417
            T   AK+TYIVHM H +KP+SF TH DWY + L +   SL+Y+Y  A+HGFA +L  +++
Sbjct  21   TVFAAKQTYIVHMNHQQKPTSFPTHHDWYQS-LSTDPSSLIYSYNNAFHGFAISLDPNQL  79

Query  418  ERLRRSEA  441
              LRRS++
Sbjct  80   ASLRRSDS  87



>ref|XP_009359724.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY---AAHLQSSEDSL  357
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY      L S  DSL
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYT AYHGFAA+L  ++ E LR+S++
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLRQSDS  88



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 12/93 (13%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------  342
            S ITI L  L      +A AK+TYIV +KH +KP SF TH DWY   LQS          
Sbjct  3    SPITITLIFL--FLLYSAEAKRTYIVRVKHSDKPESFSTHHDWYTWQLQSISTDPQSQTE  60

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            SE  LLYTY T+++GF+A L  +E E L RS++
Sbjct  61   SESPLLYTYKTSFNGFSAFLDTEEAESLLRSDS  93



>gb|KDO73903.1| hypothetical protein CISIN_1g004261mg [Citrus sinensis]
Length=765

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYA---AHLQSSEDSLLYTYTTAYHGFAAALGADEVE  420
            AK+TYIVHMKH  KPS+F TH DWYA     L SS DSLLYTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  421  RLRRSEA  441
             LR+S+A
Sbjct  84   ALRQSDA  90



>ref|XP_006474722.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 ref|XP_006474723.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=765

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 51/67 (76%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYA---AHLQSSEDSLLYTYTTAYHGFAAALGADEVE  420
            AK+TYIVHMKH  KPS+F TH DWYA     L SS DSLLYTY TAY+GFAA+L  D+ +
Sbjct  24   AKQTYIVHMKHQAKPSTFSTHNDWYASSVQSLSSSTDSLLYTYNTAYNGFAASLDPDQAQ  83

Query  421  RLRRSEA  441
             LR+S+A
Sbjct  84   ALRQSDA  90



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  372
            S+I++   LL+    +A   KKTYIVHMK     S   T RDWYAA L SS DSLLY YT
Sbjct  3    SSISLFFLLLQLTMLSAT--KKTYIVHMKQRHDSSVHPTQRDWYAATLDSSPDSLLYAYT  60

Query  373  TAYHGFAAALGADEVERLRRSEA  441
             +Y+GFAA L   E   LR S++
Sbjct  61   ASYNGFAAILDPQEAHVLRASDS  83



>ref|XP_008388846.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY---AAHLQSSEDSL  357
            WF A+ +L     PC   +A+AK+TYIVHM  H KP S+ TH DWY      L S  DSL
Sbjct  7    WFGALLLL----LPC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYT AYHGFAA+L  D+ E LR+S++
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDS  88



>ref|XP_009337216.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY---AAHLQSSEDSL  357
            WF A+ +L     PC   +A+AK+TYIVHM  H KP S+ TH DWY      L S  DSL
Sbjct  7    WFGALLLL----LPC--LSAMAKQTYIVHMNQHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYT AYHGFAA+L  D+ E LR+S++
Sbjct  61   LYTYTDAYHGFAASLDPDQAELLRQSDS  88



>ref|XP_008337844.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=764

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY---AAHLQSSEDSL  357
            WF  + +LL    PC   +A+AK+TYIV M HH KP S+ TH DWY      L S  DSL
Sbjct  7    WFGVLLLLL----PC--FSAMAKQTYIVQMNHHSKPESYATHHDWYSASLQSLSSDSDSL  60

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTYT AYHGFAA+L  ++ E L +S++
Sbjct  61   LYTYTDAYHGFAASLDPEQAELLHQSDS  88



>ref|XP_006452813.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
 gb|ESR66053.1| hypothetical protein CICLE_v10007510mg [Citrus clementina]
Length=784

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYA---AHLQSSEDSLLYTYTTAYHGFAAALGADEVE  420
            AK+TYIVHMKH  KPS+F TH DWYA     L SS DSLLYTY TAY GFAA+L  D+ +
Sbjct  43   AKQTYIVHMKHQAKPSTFSTHYDWYASSVQSLSSSTDSLLYTYNTAYDGFAASLDPDQAQ  102

Query  421  RLRRSEA  441
             LR+S+A
Sbjct  103  ALRQSDA  109



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +1

Query  169  AMGSLVWFSAITILLHLLRPCA--ATAAVAKKTYIVHMKHHEKPSSFQTHRDWY----AA  330
            AM SL W S  T LL LL        + +AK+TYIVHMKHH KP S+ TH DWY     +
Sbjct  2    AMASLAWSSCFTFLLLLLLLLLLHCLSVLAKQTYIVHMKHHLKPLSYATHHDWYSAQLQS  61

Query  331  HLQSSEDSLLYTYTTAYHGFAAALGADEVERLRRS  435
               S   +LLYTY+TAYHGFAA+L  D+VE LR S
Sbjct  62   LSSSGSSTLLYTYSTAYHGFAASLDPDQVEALRLS  96



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 5/69 (7%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAH-----LQSSEDSLLYTYTTAYHGFAAALGADE  414
            AKKTYIVHMKHH  PS + TH DWY+A+       SS DSLLYTYT+++HGFAA L + E
Sbjct  23   AKKTYIVHMKHHALPSQYLTHHDWYSANLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSQE  82

Query  415  VERLRRSEA  441
            VE LR+S++
Sbjct  83   VELLRQSDS  91



>ref|XP_009590702.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=778

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 20/83 (24%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ--------------------SSEDSLLYTYT  372
            KKTYIVHMK H KP SF TH  WY ++LQ                    S+++SLLYTY 
Sbjct  26   KKTYIVHMKRHLKPPSFSTHNQWYKSYLQSLTSSNKNSLLYTYNISLTSSNKNSLLYTYN  85

Query  373  TAYHGFAAALGADEVERLRRSEA  441
             A HGFAA+L   EV+ LR+S++
Sbjct  86   IASHGFAASLYPHEVDLLRQSDS  108



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 10/91 (11%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY--------AAHLQSSE  348
            S+ITI   L+    +T A  KKTYIV +KH +KP SF TH DWY              SE
Sbjct  3    SSITISFLLIFLLYSTEA--KKTYIVRVKHSDKPDSFPTHHDWYTSQLQSLSTQQQSESE  60

Query  349  DSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             SLLYTYTT+++GF+A L ++E E L RS++
Sbjct  61   SSLLYTYTTSFNGFSAFLDSNEAESLLRSDS  91



>emb|CDP03080.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 5/60 (8%)
 Frame = +1

Query  274  MKHHEKPSSFQTHRDWYAAHLQS-----SEDSLLYTYTTAYHGFAAALGADEVERLRRSE  438
            MKHH+KP S+ TH DWY+  LQS       DS++Y+YTTAYHGFAA+L   E E LR+S+
Sbjct  1    MKHHQKPPSYSTHTDWYSDRLQSLTSSSRPDSIVYSYTTAYHGFAASLDPKEAESLRQSD  60



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVE  420
            AKKTYI+ + H +KP SF TH DWY + L +SE SLLYTYTT++HGF+A L + E +
Sbjct  26   AKKTYIIRVNHSDKPESFLTHHDWYTSQL-NSESSLLYTYTTSFHGFSAYLDSTEAD  81



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 46/73 (63%), Gaps = 10/73 (14%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  402
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  33   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  92

Query  403  GADEVERLRRSEA  441
              DE + LR S +
Sbjct  93   DPDEADALRSSAS  105



>ref|XP_008450936.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=765

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWY-----AAHLQSSEDSLLYTYTTAYHGFAAALGADE  414
            AKKTYIVHMKHH  PS + TH DWY     +    SS DSLLYTYT+++HGFAA L ++E
Sbjct  25   AKKTYIVHMKHHALPSEYLTHHDWYSASLQSLSSSSSSDSLLYTYTSSFHGFAAFLDSEE  84

Query  415  VERLRRSEA  441
            VE LR+S++
Sbjct  85   VELLRQSDS  93



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/88 (45%), Positives = 58/88 (66%), Gaps = 6/88 (7%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSL------  357
            A+T+L  L      +  +AK+TYIVHMKHH KP +F TH++WY+A LQS   +       
Sbjct  5    ALTLLSLLFISITCSTTIAKQTYIVHMKHHTKPEAFATHQEWYSASLQSVTTTTSPSDSL  64

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LY+Y++A+ GFAA+L  +E + LR+S A
Sbjct  65   LYSYSSAFPGFAASLDPEEADSLRKSNA  92



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 46/73 (63%), Gaps = 10/73 (14%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------LLYTYTTAYHGFAAAL  402
            KKTYIVHM  H  PSSF THRDWYA+ LQS   S          LLYTYT A+HGFAA L
Sbjct  30   KKTYIVHMNPHHMPSSFATHRDWYASSLQSLSSSSDASAAAADPLLYTYTAAFHGFAATL  89

Query  403  GADEVERLRRSEA  441
              DE + LR S +
Sbjct  90   DPDEADALRSSAS  102



>ref|XP_007154575.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
 gb|ESW26569.1| hypothetical protein PHAVU_003G130300g [Phaseolus vulgaris]
Length=761

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLR  429
            AKK+YIVHMK    P    TH DWY A L SS DSL+Y YT+ Y+GFAA L   ++  LR
Sbjct  30   AKKSYIVHMKERHDPGVHPTHLDWYTATLLSSSDSLIYAYTSVYNGFAATLDPQQLHALR  89

Query  430  RSEA  441
             S++
Sbjct  90   TSDS  93



>ref|XP_010050438.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79388.1| hypothetical protein EUGRSUZ_C00800 [Eucalyptus grandis]
Length=759

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 8/91 (9%)
 Frame = +1

Query  178  SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ---SSE  348
            S  W   + + L L  PCA    +AKKTYIV M     P +F T +DWY+A+LQ   S  
Sbjct  4    SAAWLPFLALSL-LAFPCA----MAKKTYIVQMTDQSVPGTFNTSQDWYSANLQSLASGA  58

Query  349  DSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
              +LY Y+ A+HG+AA+L  ++ E LR S+A
Sbjct  59   TDILYVYSEAFHGYAASLEPNQAEALRSSDA  89



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 46/72 (64%), Gaps = 9/72 (13%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWY---------AAHLQSSEDSLLYTYTTAYHGFAAAL  402
             ++TYIV M H+EKP SF TH DWY         ++     E SLLYTYT+A+HGF+A L
Sbjct  23   GRRTYIVRMNHNEKPESFSTHHDWYSSHLHSLSSSSSSGDDESSLLYTYTSAFHGFSAVL  82

Query  403  GADEVERLRRSE  438
              DE E LRRS+
Sbjct  83   DPDEAEALRRSD  94



>ref|XP_009380035.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380036.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009380037.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE----DSLL  360
            +++T L+ L   CA       +TYIV+M    +P+   TH DWYAAHLQS +      LL
Sbjct  2    ASVTALVMLFLACAGGLVCGNQTYIVYMNPAHRPAVHPTHADWYAAHLQSLDIDPGRHLL  61

Query  361  YTYTTAYHGFAAALGADEVERLRRSEA  441
            YTY+ A HGFAA+L    ++ LRRS A
Sbjct  62   YTYSDALHGFAASLLPHHLDLLRRSPA  88



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 44/72 (61%), Gaps = 9/72 (13%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  405
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  406  ADEVERLRRSEA  441
             DE + LR S +
Sbjct  90   PDEADALRSSAS  101



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 44/72 (61%), Gaps = 9/72 (13%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE---------DSLLYTYTTAYHGFAAALG  405
            KKTYIVH   H  P SF THRDWYA+ LQS           D LLYTYT A+HGFAA L 
Sbjct  30   KKTYIVHKNPHHMPPSFATHRDWYASSLQSLSSSDASAAAGDPLLYTYTAAFHGFAATLD  89

Query  406  ADEVERLRRSEA  441
             DE + LR S +
Sbjct  90   PDEADALRSSAS  101



>gb|EMT29812.1| hypothetical protein F775_42283 [Aegilops tauschii]
Length=702

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--S  354
            L W + + + L  +RP A+   VA  +YIVHM     PS F +H  WY + L  +     
Sbjct  2    LPWVALVLVAL-WVRPAASADTVAASSYIVHMDKSAMPSGFSSHLRWYESTLAVAAPGAE  60

Query  355  LLYTYTTAYHGFAAALGADEVERLRRS  435
            + Y Y  A HGFAA L  DE++RLRRS
Sbjct  61   MFYVYDHAMHGFAARLPEDELDRLRRS  87



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease [Fragaria vesca subsp. vesca]
Length=761

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  372
            + +LL      AA    ++ TYIVHM   E P+SFQ H  WY A L+S+ DS  +LYTY+
Sbjct  8    LVVLLLGFSGYAAAEVSSRSTYIVHMAKSEMPASFQHHTHWYDASLKSASDSAEMLYTYS  67

Query  373  TAYHGFAAALGADEVERLR  429
             A HGF+  L  +E E L+
Sbjct  68   NAIHGFSTQLTPEEAEMLK  86



>gb|KCW79387.1| hypothetical protein EUGRSUZ_C00799 [Eucalyptus grandis]
Length=729

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +1

Query  178  SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SE  348
            S  W + + + L L  PCA    +AKKTYIV MK    P +F T  DWY+A+LQS     
Sbjct  4    SAAWLTFLALSL-LAFPCA----MAKKTYIVQMKEQSVPGTFNTSLDWYSANLQSLAPGV  58

Query  349  DSLLYTYTTAYHGFAAALGADEVERLRRSE  438
             ++LY Y+ A+HG+A +L   + E LR S+
Sbjct  59   ANILYVYSEAFHGYAVSLEPHQAEALRSSD  88



>gb|AGT16155.1| subtilisin-like protease [Saccharum hybrid cultivar R570]
Length=711

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 53/103 (51%), Gaps = 14/103 (14%)
 Frame = +1

Query  175  GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA------  330
            G + W  A+ + L L  L+ C    A + KTYIV M   E PSSF  H +WYA+      
Sbjct  4    GGIRWKKALPLCLALVALQACLPARAASPKTYIVQMAASEMPSSFDFHHEWYASTVKTVS  63

Query  331  --HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRSEA  441
               L+   D     ++Y Y TA+HGFAA L  DE ER+  ++ 
Sbjct  64   SVQLEGDADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADG  106



>ref|XP_004976550.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=777

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 55/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query  175  GSLVWFSAITILLHL---LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA-----  330
            GS  W  A+ + L L   L+ C +  A A KTYIV M   E PSSF  H +WYA+     
Sbjct  4    GSTRW-RALPLCLALAVALQACLSACAPAPKTYIVQMAASEMPSSFDFHHEWYASTVKSV  62

Query  331  ---HLQSSEDS----LLYTYTTAYHGFAAALGADEVERLRRSEA  441
                L+  ED     ++Y Y TA+HGFAA L  DE ER+  ++ 
Sbjct  63   SSVQLEGEEDDPFARIVYNYETAFHGFAAKLDEDEAERMADADG  106



>ref|XP_004510560.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=789

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 46/62 (74%), Gaps = 3/62 (5%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---SEDSLLYTYTTAYHGFAAALGADEVER  423
            KKT+I+ ++H  KPS F TH++WY + L S   ++D++++TY T +HGF+A L A EVE+
Sbjct  35   KKTFIIQVQHQSKPSIFPTHKNWYQSSLSSITKTQDTIIHTYDTVFHGFSAKLTALEVEK  94

Query  424  LR  429
            L+
Sbjct  95   LQ  96



>gb|EMT07781.1| Subtilisin-like protease [Aegilops tauschii]
Length=602

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 13/90 (14%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-------  354
            ++ ++L LL+   +  A A KTYIVHM   EKPSSF  H +WYA+ ++S   +       
Sbjct  12   SLCLVLVLLQASISACAGAPKTYIVHMAASEKPSSFDFHHEWYASTVKSVSSAQIEAEEE  71

Query  355  ------LLYTYTTAYHGFAAALGADEVERL  426
                  ++Y Y TA HGFAA L  DE ER+
Sbjct  72   EDAYARIVYNYETAIHGFAARLDEDEAERM  101



>ref|XP_009401756.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=782

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 16/73 (22%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------------SEDSLLYTYTTAYHG  387
            KTYIVH+   EKP SF TH DWY + + S                  D ++Y+Y TA+HG
Sbjct  33   KTYIVHVAKSEKPDSFATHVDWYLSTINSVAATSSELDASTEADDPADRIVYSYETAFHG  92

Query  388  FAAALGADEVERL  426
            FA  LGADE ERL
Sbjct  93   FATKLGADEAERL  105



>ref|XP_002448366.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
 gb|EES12694.1| hypothetical protein SORBIDRAFT_06g025980 [Sorghum bicolor]
Length=777

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 14/99 (14%)
 Frame = +1

Query  187  WFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA--------HL  336
            W  A+ + L L  L+ C    A A KTYIV M   E PSSF  H +WYA+         L
Sbjct  8    WRKALPMCLALVALQACLPARAAAPKTYIVQMAASEMPSSFDFHHEWYASTVKTVSSVQL  67

Query  337  QSSEDS----LLYTYTTAYHGFAAALGADEVERLRRSEA  441
            +   D     ++Y Y TA+HGFAA L  DE ER+  ++ 
Sbjct  68   EGGADDPYARIVYNYETAFHGFAAKLDEDEAERMAEADG  106



>ref|XP_002519361.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42978.1| conserved hypothetical protein [Ricinus communis]
Length=192

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 55/91 (60%), Gaps = 5/91 (5%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY-AAHLQSSE  348
            MGS+    A T     L    +  A+AKKTYIVHM H+ KP+S+ TH  WY +    SS 
Sbjct  1    MGSM----ATTFYFFSLVLSFSLPAIAKKTYIVHMNHNAKPNSYPTHHHWYQSLVTSSSS  56

Query  349  DSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
            DSLLYTYT A+HGFAA L   E + LR  ++
Sbjct  57   DSLLYTYTAAFHGFAAHLDPQEADALREMDS  87



>gb|EMS67510.1| Subtilisin-like protease [Triticum urartu]
Length=574

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 13/90 (14%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---------SE  348
            ++ + L LL+   +  A A KTYIV M   EKPSSF  H +WYA+ ++S          E
Sbjct  12   SLCMALVLLQASISACAGAPKTYIVQMAASEKPSSFDFHHEWYASTVKSVSSAQVEAEEE  71

Query  349  DS----LLYTYTTAYHGFAAALGADEVERL  426
            D     ++Y Y TA+HGFAA L  DE ER+
Sbjct  72   DGAYARIVYNYETAFHGFAARLDEDEAERM  101



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 13/81 (16%)
 Frame = +1

Query  238  TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ-------------SSEDSLLYTYTTA  378
            +++  +KTYIVHM HH+KPS FQTH +WY+++L              SS  SLLYTY  +
Sbjct  22   SSSSLRKTYIVHMNHHQKPSIFQTHHEWYSSNLHSLSSFDTLSSSSSSSSPSLLYTYENS  81

Query  379  YHGFAAALGADEVERLRRSEA  441
            Y GFAA L   EV+ L++++A
Sbjct  82   YSGFAATLTNSEVQSLQQNDA  102



>ref|XP_007017192.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14417.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=1160

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 6/68 (9%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFAAALGADEV  417
            KTYIVHM H  KPSSF TH  W+ A L+S       +D LLY+Y    HGF+A L   +V
Sbjct  439  KTYIVHMDHSRKPSSFLTHESWHRATLRSLSKPVDDKDMLLYSYNHVMHGFSARLTPSQV  498

Query  418  ERLRRSEA  441
              L++S A
Sbjct  499  SELKKSPA  506



>gb|EPS61652.1| hypothetical protein M569_13143, partial [Genlisea aurea]
Length=738

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 11/78 (14%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSE-----------DSLLYTYTTAYHG  387
            ++ AK TY++ MK H+ P  + T  +WY+ H  S             D LLYTY++A+HG
Sbjct  1    SSAAKSTYLIQMKRHKMPEKYSTAAEWYSDHFLSHTKPSSSSSSEKFDGLLYTYSSAFHG  60

Query  388  FAAALGADEVERLRRSEA  441
            +AA L  +EV+ +R S+A
Sbjct  61   YAAVLAPEEVDAVRGSDA  78



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  229  CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  393
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  394  AALGADEVERLRR  432
            A L   E   + R
Sbjct  78   ARLTPAEARAMER  90



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYT  372
            S+ITI   L      T A  KKTYI+ +KH +KP SF TH DWY +    S+ SLLYTYT
Sbjct  5    SSITITTFLFLFLLHTTA--KKTYIIRVKHSDKPESFLTHHDWYTSQ-LQSQSSLLYTYT  61

Query  373  TAYHGFAAALGADEVERLRRSEA  441
            T++HGF+A L ++E + L  S +
Sbjct  62   TSFHGFSAYLDSNEADSLLSSNS  84



>ref|XP_003520892.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKT-YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTY  369
            S I IL  L    A+   V KKT YIV ++H  KPS F THR WY + L  +  S+++TY
Sbjct  7    SHIIILFVLSLASASAWEVEKKTTYIVQVQHEAKPSIFPTHRHWYQSSLADTTASVIHTY  66

Query  370  TTAYHGFAAALGADEVERL  426
             T +HGF+A L   E  +L
Sbjct  67   QTVFHGFSARLSPAEAHKL  85



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 5/73 (7%)
 Frame = +1

Query  229  CAATAAVA---KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFA  393
            C++TAAVA   K+TYIVHM   + P +F  HR WY A L+S  D+  +LY Y T  HGF+
Sbjct  18   CSSTAAVAAAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDTAEILYAYDTVAHGFS  77

Query  394  AALGADEVERLRR  432
            A L   E   + R
Sbjct  78   ARLTPAEARAMER  90



>gb|EYU21279.1| hypothetical protein MIMGU_mgv1a023973mg, partial [Erythranthe 
guttata]
Length=520

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +1

Query  169  AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  342
            A+  +   S I      L P +  AA  +KT+IV +KH  KPS F  H +WY + L+S  
Sbjct  2    AISPITTISTIFFCTLFLTPSSIEAAEQRKTFIVRVKHEAKPSVFPNHSNWYESSLRSIS  61

Query  343  -SEDSLLYTYTTAYHGFAAALGADEVERL  426
             +   ++++Y T +HGF+A+L A E  +L
Sbjct  62   AASVGVIHSYDTVFHGFSASLSASEAVKL  90



>gb|ACN28204.1| unknown [Zea mays]
 gb|ACN28823.1| unknown [Zea mays]
 gb|AFW59138.1| putative subtilase family protein [Zea mays]
Length=777

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query  175  GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  342
            G + W  A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S  
Sbjct  4    GGVRW-KALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKSVS  62

Query  343  -------SED----SLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                   ++D     ++Y Y TA+HGFAA L  DE ER+  ++ 
Sbjct  63   SVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADG  106



>ref|NP_001152427.1| LOC100286067 precursor [Zea mays]
 gb|ACG47554.1| subtilisin-like protease precursor [Zea mays]
Length=777

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query  175  GSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--  342
            G + W  A+ + L L  L+ C      A KTYIV M   E PSSF  H +WYA+ ++S  
Sbjct  4    GGVRW-KALPLCLALVALQACLPARGAAPKTYIVQMAASEMPSSFDFHHEWYASTVKSVS  62

Query  343  -------SED----SLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                   ++D     ++Y Y TA+HGFAA L  DE ER+  ++ 
Sbjct  63   SVQLEGDADDHYAARIVYNYETAFHGFAAKLDEDEAERMAEADG  106



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = +1

Query  145  TSFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY  324
            +SFLSS     +  +F    IL   LR  +++++  + TYIVHM   + PSSF  H +WY
Sbjct  2    SSFLSS----STTAFF---LILCLGLRHVSSSSSNEQGTYIVHMAQSQMPSSFDLHSNWY  54

Query  325  AAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
             + L+S  DS  LLYTY  A HGFA  L  DE + L
Sbjct  55   DSSLRSISDSAELLYTYENAIHGFATRLTQDEADSL  90



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = +1

Query  172  MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  345
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  346  EDS--LLYTYTTAYHGFAAALGADEVERL  426
             +S  LLYTY  A HGF+  L   E + L
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSL  89



>ref|XP_004961962.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=762

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLL  360
            W  A+  LL +LR  AA+A    ++YIVHM     P +F +H+ WY + L ++     + 
Sbjct  15   WLLALVCLLAMLRVPAASAET--ESYIVHMDKSAMPRAFSSHQRWYESTLSAAAPGADMY  72

Query  361  YTYTTAYHGFAAALGADEVERLRRSEA  441
            Y Y  A HGFAA L  +E+E LRRS  
Sbjct  73   YVYDHAAHGFAARLRTEELESLRRSRG  99



>emb|CDY29697.1| BnaA04g17300D [Brassica napus]
Length=747

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/89 (42%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = +1

Query  172  MGSLVWFSAIT--ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS  345
            M S   FS  +  I+L  L  C  +    + TYIVHM   + PSSF  H  WYA+ L+S 
Sbjct  1    MSSSFLFSTASFFIVLLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDLHSLWYASSLKSV  60

Query  346  EDS--LLYTYTTAYHGFAAALGADEVERL  426
             +S  LLYTY  A HGF+  L   E + L
Sbjct  61   SESAELLYTYNNAIHGFSTRLTPQEADSL  89



>ref|XP_003595292.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES65543.1| subtilisin-like serine protease [Medicago truncatula]
Length=779

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 21/100 (21%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY------------AAHLQ  339
            +I +LL L+  C +  +  KKTYIVHMK+H  P+ + TH +WY            +++L 
Sbjct  7    SIFLLLTLISQCYSLPS--KKTYIVHMKNHYNPTIYPTHYNWYSSTLQSLSLSIDSSNLD  64

Query  340  SSE-------DSLLYTYTTAYHGFAAALGADEVERLRRSE  438
            S +       D LLY+YTTAY GFAA L   + E L +++
Sbjct  65   SDDVVDETDSDPLLYSYTTAYTGFAAKLNTQQAETLLQND  104



>dbj|BAJ87780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=778

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 50/91 (55%), Gaps = 14/91 (15%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHL-----------QS  342
            ++ + L LL+   +  A A +TYIV M   EKPS+F  H +WYA+ +           Q 
Sbjct  12   SLRLALVLLQASISACAGASQTYIVQMAASEKPSAFDFHHEWYASTVKSVSSAQVEAEQQ  71

Query  343  SEDS---LLYTYTTAYHGFAAALGADEVERL  426
             ED    ++Y Y TA+HGFAA L  DE ER+
Sbjct  72   EEDGYARIVYNYETAFHGFAARLDEDEAERM  102



>ref|XP_002533167.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF29226.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=760

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            +K TYIVHM   E P+SFQ H  WY + L+S  DS  ++YTY  A HGF+  L ++E E 
Sbjct  30   SKSTYIVHMSKSEMPASFQHHTHWYDSSLKSVSDSAQMIYTYENAIHGFSTRLTSEEAEL  89

Query  424  LR  429
            L+
Sbjct  90   LQ  91



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +1

Query  229  CAATAAVA----KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGF  390
            C++TA VA    K+TYIVHM   + P +F  HR WY A L+S  D+  ++Y Y TA HGF
Sbjct  20   CSSTAVVAAVAKKRTYIVHMAKSQMPPAFAEHRHWYDASLRSVSDAAEIIYAYDTAAHGF  79

Query  391  AAALGADEVERL  426
            +A L   E   L
Sbjct  80   SARLSPAEARAL  91



>ref|XP_003547873.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=776

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = +1

Query  190  FSAITILLHLL---RPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ--SSEDS  354
            F ++ IL  LL     C+ +     KT+IV + H  KPS F TH+ WY + L   S+  S
Sbjct  4    FGSLVILPFLLIATVTCSTSEKENSKTFIVQVHHQTKPSIFPTHKHWYDSSLSSISTTAS  63

Query  355  LLYTYTTAYHGFAAALGADEVERLR  429
            +++TY T +HGF+A L   E ++L+
Sbjct  64   VIHTYDTVFHGFSAKLSPSEAQKLQ  88



>emb|CDY63219.1| BnaAnng18730D [Brassica napus]
Length=743

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I+L  L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  LLYTY +A
Sbjct  14   IVLLYLGACHISDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLRSVSESAELLYTYNSA  73

Query  379  YHGFAAALGADEVERL  426
             HGF+  L  +E + L
Sbjct  74   IHGFSTRLTPEEADSL  89



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  342
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  78   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLIKPENQEDGG  137

Query  343  -SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
              +  ++YTY  A+HG AA L   E ERL   + 
Sbjct  138  EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDG  171



>ref|XP_008354210.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=783

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  342
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +QS            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQSVLINPENQEDGG  74

Query  343  -SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
              +  ++YTY  A+HG AA L   E ERL   + 
Sbjct  75   EDQQRVIYTYQNAFHGVAARLSEQEAERLEEQDG  108



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +1

Query  190  FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLY  363
            F ++ + L L    A      K TYIVH+   E P SF+ H  WY + L++  DS  ++Y
Sbjct  11   FLSVVLFLGLYEAAAEQTQTHKSTYIVHVAKSEMPESFEHHAVWYESSLKTVSDSAEMIY  70

Query  364  TYTTAYHGFAAALGADEVERLRR  432
            TY  A HG+A  L A+E   L+R
Sbjct  71   TYDNAIHGYATRLTAEEARLLQR  93



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = +1

Query  193  SAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  354
            S  +ILL    H+ R   AT    K TYIVHM   E P+SF+ H  WY + L+S  DS  
Sbjct  12   SLFSILLLGVCHVSRATLATNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSAQ  71

Query  355  LLYTYTTAYHGFAAALGADEVERL  426
            +LYTY  A HGF+  L   E + L
Sbjct  72   MLYTYENAIHGFSTRLTLAEAKLL  95



>ref|XP_009343496.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=783

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 45/94 (48%), Gaps = 13/94 (14%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------------  342
            +TI +      +A   + KKTYIV M    KP SF  H DWY++ +Q+            
Sbjct  15   LTIFMFFNIALSAKTPLTKKTYIVQMDKSAKPESFSNHIDWYSSKVQAVLIKPDNQEDGG  74

Query  343  -SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
              +  +LYTY  A+HG AA L   E ERL   + 
Sbjct  75   EDQQRVLYTYQNAFHGVAARLSEQEAERLEEQDG  108



>gb|EYU36336.1| hypothetical protein MIMGU_mgv1a019012mg, partial [Erythranthe 
guttata]
Length=733

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS------EDSLLYTYTTAYHGFAAALGADE  414
            + TYIVHM     P +F +H  WY++ L+S+      E  ++YTY  A+HGF+A L  DE
Sbjct  1    RSTYIVHMDKFSMPKAFSSHHHWYSSMLKSAKSLDEPESKIIYTYDNAFHGFSAVLSEDE  60

Query  415  VERLRRSEA  441
            +E +++S+ 
Sbjct  61   LEAVKKSQG  69



>ref|XP_004496012.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=761

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 9/88 (10%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAK---KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS------L  357
            +LL+++ P    +  AK    TYIVHM     P  F TH++WY + LQS+         L
Sbjct  12   MLLNIITPFVLLSLHAKAESSTYIVHMDKSLMPQVFTTHQNWYESTLQSTNSEVDQSKKL  71

Query  358  LYTYTTAYHGFAAALGADEVERLRRSEA  441
            LYTY  A HGF+A L ++++  L++S  
Sbjct  72   LYTYNHAMHGFSAVLSSNDLNTLKKSHG  99



>ref|XP_007135377.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
 gb|ESW07371.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
Length=781

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  426
            KKT+IV + H  KPS F THR WY + L S  +  S+++TY T +HGF+A L   E ++L
Sbjct  29   KKTFIVQVHHQTKPSVFPTHRHWYQSSLASISNTASVIHTYDTVFHGFSAKLSPSEAQKL  88

Query  427  R  429
            +
Sbjct  89   Q  89



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            IL+  +  C A++++ K TYIVHM   E P SF+ H  WY + LQS  DS  ++YTY  A
Sbjct  13   ILVLFMGLCDASSSL-KSTYIVHMAKSEMPESFEHHTLWYESSLQSVSDSAEMMYTYENA  71

Query  379  YHGFAAALGADEVERLRRSE  438
             HGF+  L  +E  RL  S+
Sbjct  72   IHGFSTRLTPEEA-RLLESQ  90



>emb|CDY22001.1| BnaC09g01070D [Brassica napus]
Length=734

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I+L  L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  LLYTY +A
Sbjct  14   IVLLYLGACHISDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLRSVSESAELLYTYNSA  73

Query  379  YHGFAAALGADEVERL  426
             HGF+  L  +E + L
Sbjct  74   IHGFSTRLTPEEADSL  89



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A HGFA  L  DE + L
Sbjct  33   TYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFATRLTQDEADSL  90



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A HGFA  L  DE + L
Sbjct  32   TYIVHMAQSQMPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFATRLTQDEADSL  89



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            +TYIVHM H   P  F  H DWYA+ LQS  DS  +LYTY T  HG++A L   E E L
Sbjct  32   RTYIVHMSHSAMPDGFAEHGDWYASSLQSVSDSAAVLYTYDTLLHGYSARLTRAEAEAL  90



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  229  CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  402
            C  + A  KKTYIVHM   + P SF+ H  WY + L+S  DS  +LYTY    HGF+  L
Sbjct  16   CHLSMAAEKKTYIVHMAKFQMPESFEEHTHWYDSSLKSVSDSAEMLYTYNNVIHGFSTRL  75

Query  403  GADEVERL  426
              +E + L
Sbjct  76   TDEEAKLL  83



>gb|ACN39811.1| unknown [Picea sitchensis]
Length=690

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 13/90 (14%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVA------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----S  345
            +++LL L   C AT   A      KKTY+VHM   + P+ F +H  WYA+ ++S      
Sbjct  11   VSVLLVL--GCLATVLAAISHDGVKKTYVVHMAKSQMPAGFTSHEHWYASAVKSVLSEEE  68

Query  346  EDSLLYTYTTAYHGFAAALGADEVERLRRS  435
            E S+LY Y  A+HGFAA L A + E L ++
Sbjct  69   EPSILYNYDDAFHGFAARLNAAQAEALEKT  98



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            + A   KKTYI+HM   + P++F  H  WY A L+S  +S  ++Y Y    HGFAA L A
Sbjct  30   SVAMEEKKTYIIHMAKSQMPATFDDHTHWYDASLKSVSESAEMIYVYNNVIHGFAARLTA  89

Query  409  DEVERLR  429
             E E L+
Sbjct  90   QEAESLK  96



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +1

Query  274  MKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERLRR  432
            M H+ KP ++ TH  WY + L S+ DS+LYTYTTA+ GFAA L  +E E L++
Sbjct  1    MNHNSKPDTYTTHHQWYQS-LTSTSDSILYTYTTAFQGFAAYLDPEEAESLKK  52



>ref|XP_007139067.1| hypothetical protein PHAVU_009G262100g [Phaseolus vulgaris]
 gb|ESW11061.1| hypothetical protein PHAVU_009G262100g [Phaseolus vulgaris]
Length=771

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL  426
            KKT+IV ++H  KPS F THR WY + L  +  S+++TY T +HGF+A L A EV  L
Sbjct  29   KKTFIVQVQHDAKPSIFPTHRHWYESSLGEAT-SIIHTYQTVFHGFSATLSAAEVANL  85



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 13/95 (14%)
 Frame = +1

Query  151  FLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAA  330
            F+S I  M  +V   A  +LL  L   +A A   KKTYI+ M    KP +F  H DWY++
Sbjct  2    FMSPITPMEKMVLILASYLLLSTL--FSANAEFVKKTYIIQMDKSAKPDTFSNHLDWYSS  59

Query  331  HLQS-----------SEDSLLYTYTTAYHGFAAAL  402
             ++S            E+ ++YTY TA+HG AA L
Sbjct  60   KVKSILSKSVEAEMDKEERIIYTYQTAFHGVAAKL  94



>gb|KCW79385.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=564

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = +1

Query  262  YIVHMKHHEKPSSFQTHRDWY---------AAHLQSSEDSLLYTYTTAYHGFAAALGADE  414
            YIVHM HHEKPS F TH DWY         ++   +S  +LLY+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  415  VERLRRSEA  441
               LRRS A
Sbjct  91   AASLRRSPA  99



>gb|EYU36337.1| hypothetical protein MIMGU_mgv1a020902mg, partial [Erythranthe 
guttata]
Length=734

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ------SSEDSLLYTYTTAYHGFAAALGADE  414
            + TYIVHM     P +F +H  WY++ L         E  L+YTY  A+HGF+A L  DE
Sbjct  2    RSTYIVHMDKSSMPKAFSSHHHWYSSMLSFGKPLDEPESKLIYTYDNAFHGFSAVLSEDE  61

Query  415  VERLRRS  435
            +E L++S
Sbjct  62   LEALKKS  68



>ref|XP_003553808.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=768

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 5/82 (6%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKT-YIVHMKHHEKPSSFQTHRDWYAAH--LQSSEDSLLY  363
            S I ILL LL     TA+  KKT YIV ++   KPS F THR WY +   L  S  S+L+
Sbjct  6    SRIMILLFLLS--LGTASEEKKTTYIVQVQQEAKPSIFPTHRHWYQSSLALADSTASILH  63

Query  364  TYTTAYHGFAAALGADEVERLR  429
            TY T +HGF+A L   E  RL+
Sbjct  64   TYQTVFHGFSARLSPAEANRLQ  85



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = +1

Query  193  SAITILL----HLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--  354
            S  +ILL    H+ R   A+    K TYIVHM   E P+SF+ H  WY + L+S  DS  
Sbjct  12   SLFSILLLGVCHVSRATLASNKEKKATYIVHMSKPEMPASFEHHTHWYESSLKSVSDSAQ  71

Query  355  LLYTYTTAYHGFAAALGADEVERL  426
            +LYTY  A HGF+  L   E + L
Sbjct  72   MLYTYENAIHGFSTRLTLAEAKLL  95



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 46/87 (53%), Gaps = 6/87 (7%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  351
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWM----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  352  S--LLYTYTTAYHGFAAALGADEVERL  426
            S  ++Y Y    HGF+  L A+E +RL
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRL  83



>ref|XP_011468374.1| PREDICTED: uncharacterized protein LOC101302380 [Fragaria vesca 
subsp. vesca]
Length=1517

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 13/80 (16%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAA-------HLQSSED------SLLYTYTTAY  381
            A   + TYIVHM     P SF +H  WY++        L +S D      SLLYTY  A+
Sbjct  2    ALAERSTYIVHMDKSLMPKSFTSHHHWYSSIVDSFKTDLHTSSDPHRLTPSLLYTYDNAF  61

Query  382  HGFAAALGADEVERLRRSEA  441
            HGF+A L  DE+E L +S A
Sbjct  62   HGFSAVLSTDELETLGKSPA  81


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 11/77 (14%)
 Frame = +1

Query  238  TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-----------SLLYTYTTAYH  384
            T+   + TYIVHM     P  F +H+ WY++ + S +            S+LYTY  A+H
Sbjct  775  TSLAERSTYIVHMDKSLMPKFFTSHQHWYSSIVDSFKTETQTDSHSFSPSILYTYDNAFH  834

Query  385  GFAAALGADEVERLRRS  435
            GF+A L  DE+E L++S
Sbjct  835  GFSAVLSIDELETLKKS  851



>ref|XP_010501809.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=775

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYA---AHLQSSEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYI+H+ H  KPS F THR WY    A L S+  S+++TY T +HGF+A L + +  +L
Sbjct  27   TYIIHVDHEAKPSIFPTHRHWYTSSLASLTSTTPSIIHTYDTVFHGFSARLTSQDAAQL  85



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 46/87 (53%), Gaps = 6/87 (7%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  351
            M + VW      LL       + A   KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVWI----FLLLCFFSVPSMAVGDKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  56

Query  352  S--LLYTYTTAYHGFAAALGADEVERL  426
            S  ++Y Y    HGF+  L A+E +RL
Sbjct  57   SAEMIYAYNNVVHGFSTRLTAEEAQRL  83



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
             +++  K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L  
Sbjct  26   GSSSNKKSTYIVHVAKSQMPESFENHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTV  85

Query  409  DEVERLRR  432
             E E L R
Sbjct  86   QEAESLER  93



>ref|XP_009135372.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=767

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S  S  S+++TY T +HGF+A L A +   L
Sbjct  26   TYIVHVDHEAKPSIFPTHRHWYTSSLASLTSTPSIIHTYDTVFHGFSARLTAQDATHL  83



>emb|CDX82491.1| BnaA03g33300D [Brassica napus]
Length=767

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S  S  S+++TY T +HGF+A L A +   L
Sbjct  26   TYIVHVDHEAKPSIFPTHRHWYTSSLASLTSTPSIIHTYDTVFHGFSARLTAQDATHL  83



>ref|XP_007207210.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
 gb|EMJ08409.1| hypothetical protein PRUPE_ppa001938mg [Prunus persica]
Length=739

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 13/79 (16%)
 Frame = +1

Query  238  TAAVAKKTYIVHMKHHEKPSSFQTHRDWYA-------AHLQSSED------SLLYTYTTA  378
            ++A  + TYIVHM     P S+ +H+ WY+       A + +S D      SLLYTY  A
Sbjct  2    SSAAERSTYIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSSDGHKISPSLLYTYDNA  61

Query  379  YHGFAAALGADEVERLRRS  435
            +HGF+A L A+E+E L+ S
Sbjct  62   FHGFSAVLSAEELETLKNS  80



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            +K+TYI+ +KH +KP SF TH DWY++ LQS   +  LLY+Y+T++HG++A L + E + 
Sbjct  22   SKRTYIIRVKHSDKPDSFSTHHDWYSSQLQSLSSNPQLLYSYSTSFHGYSAFLDSHEADT  81

Query  424  LRRSEA  441
            L  S++
Sbjct  82   LLNSDS  87



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 5/87 (6%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED  351
            M + VW     +LL L    +      KKTYIVHM  ++ P SF+ H  WY + L+S  D
Sbjct  1    MANPVW---TFLLLCLFSVPSMAVGDKKKTYIVHMAKYQMPESFEHHLHWYDSSLRSVSD  57

Query  352  S--LLYTYTTAYHGFAAALGADEVERL  426
            S  ++Y Y    HGF+  L  +E +RL
Sbjct  58   SAEMIYAYNNVVHGFSTRLTTEEAQRL  84



>emb|CDX98438.1| BnaC05g39370D [Brassica napus]
Length=770

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S+  S+++TY T +HGF+A L A E  +L
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLTSTSSSIIHTYDTVFHGFSARLTAQEATQL  80



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 11/79 (14%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------S  345
            +TI L L    +A A  AKKTYI+ M  + KP +F +H +WY + ++S            
Sbjct  14   VTIFLLLCILSSANAEFAKKTYIIQMDKYAKPDTFSSHIEWYTSKVKSILSISVEAEMEK  73

Query  346  EDSLLYTYTTAYHGFAAAL  402
            E+ ++YTY TA+HG AA L
Sbjct  74   EERIIYTYQTAFHGMAAKL  92



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 12/96 (13%)
 Frame = +1

Query  145  TSFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY  324
            +SFLSS          +A  +LL L     ++++  + TYIVHM   + PSSF  H +WY
Sbjct  3    SSFLSS----------TAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWY  52

Query  325  AAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
             + L+S  DS  LLYTY  A HGF+  L  +E + L
Sbjct  53   DSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSL  88



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SBT17_ARATH RecName: Full=Subtilisin-like protease SBT1.7; AltName: Full=Cucumisin-like 
serine protease; AltName: Full=Subtilase subfamily 
1 member 7; Short=AtSBT1.7; AltName: Full=Subtilisin-like 
serine protease 1; Short=At-SLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 53/96 (55%), Gaps = 12/96 (13%)
 Frame = +1

Query  145  TSFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWY  324
            +SFLSS          +A  +LL L     ++++  + TYIVHM   + PSSF  H +WY
Sbjct  3    SSFLSS----------TAFFLLLCLGFCHVSSSSSDQGTYIVHMAKSQMPSSFDLHSNWY  52

Query  325  AAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
             + L+S  DS  LLYTY  A HGF+  L  +E + L
Sbjct  53   DSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSL  88



>gb|KCW63975.1| hypothetical protein EUGRSUZ_G01657, partial [Eucalyptus grandis]
Length=743

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/95 (33%), Positives = 50/95 (53%), Gaps = 11/95 (12%)
 Frame = +1

Query  178  SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----  342
            +++W     +LL  +     + +  ++TYI+HM H +KP+SF TH  W+ A + S     
Sbjct  11   AILWL----LLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSL  66

Query  343  --SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
               ED  LY+Y    HGF+A L   E+ ++  S A
Sbjct  67   SDGEDKFLYSYNHVTHGFSARLTPSELAKIEESPA  101



>ref|XP_010527146.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=727

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 52/98 (53%), Gaps = 11/98 (11%)
 Frame = +1

Query  145  TSFLSSI*AMGSLVWFSAITILLHL--LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRD  318
            TSFLS       L   +  +++LHL      +A A   + TYIVHM   + P+SF  H  
Sbjct  2    TSFLS-------LTVLTVFSLVLHLGFCHVSSAPAGHGRATYIVHMARSQMPASFDRHSH  54

Query  319  WYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            WY + L+S  DS  LLYTY  A HGF+  L  +E + L
Sbjct  55   WYDSSLRSVSDSAELLYTYDNAIHGFSTRLTPEEADSL  92



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAA  399
            A T     +TYIV+MK   KPS+  TH  WY AHLQS        LLY Y+ A+HGFAA 
Sbjct  21   APTLVSCNQTYIVYMKPAHKPSAHPTHALWYEAHLQSLSIDPSRHLLYAYSAAFHGFAAH  80

Query  400  LGADEVERLRRSEA  441
            L    +  LRRS A
Sbjct  81   LLPHHLPLLRRSPA  94



>ref|XP_009112374.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=758

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 47/95 (49%), Gaps = 11/95 (12%)
 Frame = +1

Query  148  SFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYA  327
            SFLSS          +   I+   L  C  +    + TYIVHM   + PSSF  H  WY 
Sbjct  4    SFLSST---------APFFIVFLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDQHSLWYD  54

Query  328  AHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            + L+S  +S  ++YTY  A HGFA  L  +E + L
Sbjct  55   SSLRSVSESAAMIYTYNNAIHGFATRLTPEEADSL  89



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 9/69 (13%)
 Frame = +1

Query  262  YIVHMKHHEKPSSFQTHRDWY---------AAHLQSSEDSLLYTYTTAYHGFAAALGADE  414
            YIVHM HHEKPS F TH DWY         ++   +S  +LLY+Y+ AY GFAA+L   +
Sbjct  31   YIVHMSHHEKPSLFPTHHDWYLSRLLSLPSSSSSSTSSPNLLYSYSAAYPGFAASLDPSQ  90

Query  415  VERLRRSEA  441
               LRRS A
Sbjct  91   AASLRRSPA  99



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 10/65 (15%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  426
            ++TYIVHM H   PS F  H +WYAA LQ+  D  ++LYTY T  HG++A        RL
Sbjct  33   RQTYIVHMSHSAMPSDFVEHEEWYAASLQAVSDAATVLYTYNTLLHGYSA--------RL  84

Query  427  RRSEA  441
             R+EA
Sbjct  85   TRAEA  89



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYT  372
            + L + R   A +AV +K  TYIVH+   + P+SF  H  WY + L+S  +S  +LYTY 
Sbjct  17   VFLGVCRVSVAASAVQQKKNTYIVHVAKSQMPASFDDHTRWYDSSLKSVSESAEMLYTYN  76

Query  373  TAYHGFAAALGADEVERLR  429
             A HGFA  L A E + L+
Sbjct  77   NAIHGFATRLTAQEAKSLQ  95



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 7/70 (10%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------SEDSLLYTYTTAYHGFAAALGA  408
            AKKTYI+ M     P SF  H +WY++ ++S        E+ ++Y+Y TA+HG AA L  
Sbjct  27   AKKTYIIQMDKSAMPESFSDHLEWYSSKVKSVLMKQSDDEERIIYSYQTAFHGVAAQLSE  86

Query  409  DEVERLRRSE  438
            +E E+L + +
Sbjct  87   EEAEKLEQDD  96



>gb|KJB08038.1| hypothetical protein B456_001G060600 [Gossypium raimondii]
Length=752

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHL----QSSEDSLLYTYTTAYHGFAAALGADEVER  423
            KTYIVH+ H  KPSSF TH  W+ A L    +S ++ LLY+Y    HGF+A L   +  +
Sbjct  31   KTYIVHIDHSLKPSSFLTHETWHRAILRSLSKSDKEMLLYSYNHVMHGFSARLTPSQASK  90

Query  424  LRRSEA  441
            +R+S A
Sbjct  91   IRKSPA  96



>gb|EYU36340.1| hypothetical protein MIMGU_mgv1a001790mg [Erythranthe guttata]
Length=759

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 6/74 (8%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFA  393
            A      + TYIVH+     P +F +H  WY++ L+S      SE  ++YTY  A+HGF+
Sbjct  19   AGDVLAERSTYIVHVDKSSMPKAFSSHHHWYSSMLKSVKSIDESESKIIYTYDNAFHGFS  78

Query  394  AALGADEVERLRRS  435
            A +   E+E L++S
Sbjct  79   AVMNKHELEALKKS  92



>ref|XP_010068558.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=765

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------SEDSLLY  363
            +LL  +     + +  ++TYI+HM H +KP+SF TH  W+ A + S        ED  LY
Sbjct  21   LLLSTVTSFVMSESEERQTYIIHMDHSQKPASFPTHETWHRATVDSISPSLSDGEDKFLY  80

Query  364  TYTTAYHGFAAALGADEVERLRRSEA  441
            +Y    HGF+A L   E+ ++  S A
Sbjct  81   SYNHVTHGFSARLTPSELAKIEESPA  106



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = +1

Query  184  VWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--L  357
            ++   +++LL L   C A++++ K TYIVHM   E P SF  H  WY + LQS  +S  +
Sbjct  8    IFLIVLSVLL-LTNLCDASSSL-KSTYIVHMAKSEMPESFDHHTMWYESSLQSVSESAEM  65

Query  358  LYTYTTAYHGFAAALGADEVERL  426
            LYTY  A HG++  L A+E   L
Sbjct  66   LYTYENAIHGYSTRLTAEEARLL  88



>emb|CDY09336.1| BnaA02g26740D [Brassica napus]
Length=727

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 5/83 (6%)
 Frame = +1

Query  196  AITILLHLLRP-CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLL  360
            AIT+++ LL P   ATA      YI+HM    KP+ F  H+ W++  L S     +  +L
Sbjct  2    AITVMILLLIPFSVATATTETSIYIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKIL  61

Query  361  YTYTTAYHGFAAALGADEVERLR  429
            Y YT + HGF+A L   E++RL+
Sbjct  62   YAYTDSVHGFSAVLTNSELKRLQ  84



>emb|CDX97560.1| BnaA05g25190D [Brassica napus]
Length=770

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S+  S+++TY T +HGF+A L A E  +L
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLTSTSSSIIHTYDTVFHGFSARLTAQEATQL  80



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = +1

Query  229  CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAAL  402
            C++  A  K TYIVHM     P SF  HR WY A L+S   S  +LY Y T  HGF+A L
Sbjct  18   CSSAVAAKKPTYIVHMAKSRMPPSFAEHRHWYDASLRSVSGSAEVLYFYDTVAHGFSARL  77

Query  403  GADEVERLRR  432
               E   L R
Sbjct  78   TPAEARALAR  87



>ref|XP_008367646.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVE  420
            AKKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E  
Sbjct  33   AKKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAG  92

Query  421  RLRR  432
             L +
Sbjct  93   LLEK  96



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 16/94 (17%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------  342
            +F  I++L+    P     A  +KT+I+H++H  KPS F TH  WY + L+S        
Sbjct  14   YFLVISLLI--FSPSPTQEAEQRKTFIIHVQHDAKPSIFPTHNHWYESSLRSLSTVSVNA  71

Query  343  -SEDS-----LLYTYTTAYHGFAAALGADEVERL  426
             S DS     ++++Y   +HGF+A L A E ++L
Sbjct  72   ASPDSADASRIIHSYNNVFHGFSAKLSASEAQKL  105



>emb|CDY18653.1| BnaA09g07420D [Brassica napus]
Length=717

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I+   L  C  +    + TYIVHM   + PSSF  H  WY + L+S  +S  ++YTY  A
Sbjct  14   IVFLYLGSCHVSNGAQQATYIVHMAKSQMPSSFDQHSLWYDSSLRSVSESAEMIYTYNNA  73

Query  379  YHGFAAALGADEVERL  426
             HGFA  L  +E + L
Sbjct  74   IHGFATRLTPEEADSL  89



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +1

Query  229  CAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ--SSEDSLLYTYTTAYHGFAAAL  402
            C  +     KT+I+ ++H  KPS F TH+ WY + L   S+  S+++TY T +HGF+A L
Sbjct  21   CYGSEKEKSKTFIIQVQHEAKPSIFPTHKHWYDSSLSSISTTASVIHTYHTVFHGFSAKL  80

Query  403  GADEVERLR  429
               E ++L+
Sbjct  81   SPSEAQKLQ  89



>gb|EYU36342.1| hypothetical protein MIMGU_mgv1a001789mg [Erythranthe guttata]
Length=759

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 6/73 (8%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFA  393
            A   +  + TYIVHM     P +F +H  WY++ L S      SE  ++YTY  A+HGF+
Sbjct  19   AGDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLTSAKSLDESESKIIYTYDNAFHGFS  78

Query  394  AALGADEVERLRR  432
              +   E+E L++
Sbjct  79   VVMNKQELEALKK  91



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLL---RPCAATAAVAKK--TYIVHMKHHEKPSSFQTHRDWYAAHL  336
            M SL   +   ++LHL     P AAT    ++  TYIVHM   + P+SF  H  WY + L
Sbjct  1    MTSLTSLAVFLLVLHLGLYHVPSAATGDGRQRRATYIVHMARSQMPASFDHHSHWYDSSL  60

Query  337  QSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            +S  DS  LLYTY  A HGF+  L  +E E L
Sbjct  61   RSVSDSAELLYTYDNAIHGFSTRLTPEEAESL  92



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            K TYIVH+   + P SF+ H+ WY + L+S  DS  +LY Y    HGF+A L   E E L
Sbjct  32   KSTYIVHVAKSQMPESFEDHKHWYDSSLKSVSDSAEMLYVYNNVVHGFSARLTIQEAESL  91

Query  427  RR  432
             R
Sbjct  92   ER  93



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  426
            ++TYIVHM    KP+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  34   RRTYIVHMSRSAKPNDFVEHGEWYAASLQSVSDAATVLYTYDTIVHGYSARLTRAEAEAL  93



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I L  L     +    + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY  A
Sbjct  14   IFLLYLSSFHVSDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNNA  73

Query  379  YHGFAAALGADEVERL  426
             HGFA  L  +E + L
Sbjct  74   IHGFATRLTPEEADSL  89



>emb|CDX75758.1| BnaC03g38410D [Brassica napus]
Length=305

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQS--SEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S  S  S+++TY T +HGF+A L A +  +L
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLASLTSTPSIIHTYDTVFHGFSARLTAQDATQL  82



>ref|XP_008218400.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=766

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 53/95 (56%), Gaps = 14/95 (15%)
 Frame = +1

Query  190  FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYA-------AHLQSSE  348
            FS + + L  L    ++AA  + T+IVHM     P S+ +H+ WY+       A + +S 
Sbjct  14   FSLVGLFLLALHVNMSSAA-ERSTHIVHMDKSLMPKSYASHQHWYSSIVDSFKAQIPTSS  72

Query  349  D------SLLYTYTTAYHGFAAALGADEVERLRRS  435
            D      SLLYTY  A+HGF+A L A+E+E L+ S
Sbjct  73   DGHKISPSLLYTYDNAFHGFSAVLSAEELETLKNS  107



>gb|EMS48839.1| Subtilisin-like protease [Triticum urartu]
Length=1050

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHL--QSSEDS  354
            L W + + + L + RP A+  AVA  +YIVHM     PS F +H  WY + L   +    
Sbjct  2    LPWVALLLVALSV-RPAASADAVAAASYIVHMDKSAMPSGFSSHLRWYESTLAAAAPAAE  60

Query  355  LLYTYTTAYHGFAAALGADEVERLRRS  435
            + Y Y  A HGFAA L  +E++RLRRS
Sbjct  61   MFYVYDHAMHGFAARLPEEELDRLRRS  87



>ref|XP_009360421.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            KKTYI+HM   E P+SF+  R +WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFEWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  424  LRR  432
            L +
Sbjct  94   LEK  96



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 10/66 (15%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVER  423
             ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A        R
Sbjct  32   GRQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSA--------R  83

Query  424  LRRSEA  441
            L R+EA
Sbjct  84   LTRAEA  89



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 10/66 (15%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVER  423
             ++TYIVHM H   P  F  H +WYAA LQ+  D  ++LYTY+T  HG++A        R
Sbjct  32   GRQTYIVHMSHSAMPDEFAEHEEWYAASLQAVSDAATVLYTYSTLLHGYSA--------R  83

Query  424  LRRSEA  441
            L R+EA
Sbjct  84   LTRAEA  89



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQVSDGAQQSTYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  379  YHGFAAALGADEVERL  426
             HGF+  L  +E + L
Sbjct  76   IHGFSTRLTPEEADSL  91



>ref|XP_010240288.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=778

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = +1

Query  244  AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDS----LLYTYTTAY  381
            A A KTYIV M   E PSSF  H +WYA+ ++S           +D     ++Y Y TA+
Sbjct  28   AGAPKTYIVQMAASEMPSSFDYHHEWYASTVKSVSSAQLEAEAGDDDAYTRIVYNYETAF  87

Query  382  HGFAAALGADEVERL  426
            HGFAA L  DE ER+
Sbjct  88   HGFAARLDEDEAERM  102



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I L  L     +    + TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY  A
Sbjct  14   IFLLYLSSFHVSDGAQQSTYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNNA  73

Query  379  YHGFAAALGADEVERL  426
             HGFA  L  +E + L
Sbjct  74   IHGFATRLTPEEADSL  89



>ref|XP_007017191.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
 gb|EOY14416.1| Subtilisin-like serine protease 2, putative [Theobroma cacao]
Length=761

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 6/68 (9%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHLQS------SEDSLLYTYTTAYHGFAAALGADEV  417
            KTY+VHM H  KP+SF TH  W+ + L+S       E+ LLY+Y    HGF+A L + ++
Sbjct  37   KTYVVHMNHSHKPTSFSTHELWHRSTLRSLSNPVDDEEKLLYSYNHIIHGFSARLTSSQL  96

Query  418  ERLRRSEA  441
              + +S A
Sbjct  97   SEIEKSPA  104



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 6/85 (7%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVA--KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYT  366
            +LL  L   AAT ++   K+TYIV+M    +  +  TH  WY AHL+S        LLY+
Sbjct  8    LLLVFLSSFAATVSMVACKQTYIVYMNAAHRTEAHPTHAHWYEAHLRSLSIDPARHLLYS  67

Query  367  YTTAYHGFAAALGADEVERLRRSEA  441
            Y+ A HGFAA L  +++  LRR  A
Sbjct  68   YSAAVHGFAAVLHPEQLPLLRRHPA  92



>ref|XP_010105482.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04838.1| Subtilisin-like protease [Morus notabilis]
Length=765

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            K TYI+HM +  KP+ F+ H +WY + L+S  DS  +LYTY    HGF+ +L   E E L
Sbjct  33   KTTYIIHMDNSNKPAVFEDHVNWYDSSLRSVSDSGEMLYTYNNVIHGFSTSLNYKEAELL  92

Query  427  R  429
            +
Sbjct  93   K  93



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM+  E PSSF  H  WY + L+S  +S  LLYTYT A HGF+  L  +E + L
Sbjct  32   TYIVHMEKSEMPSSFDLHSLWYDSSLRSVSESAELLYTYTNAIHGFSTRLTPEEADSL  89



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            + A   KKTYI+HM   + P +F  H  WY A L+S  +S  ++Y Y    HGFAA L A
Sbjct  31   SVAMEEKKTYIIHMAKSQMPVTFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTA  90

Query  409  DEVERL  426
             E E L
Sbjct  91   QEAESL  96



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = +1

Query  190  FSAITILLHLLRPC-AATAAVAKKTYIVHMKHHEKPSSFQ-THRDWYAAHLQSSEDS--L  357
            +  I +++ LL  C  + A V KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLFRCHMSVAMVKKKTYIIHMAKSQMPATFNDDHTHWYDSSLRSVSDSAEM  72

Query  358  LYTYTTAYHGFAAALGADEVERL  426
            LY Y    HGF+A L   E E L
Sbjct  73   LYVYNNVIHGFSARLTPQEAESL  95



>emb|CDY63300.1| BnaCnng41800D [Brassica napus]
Length=716

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 47/95 (49%), Gaps = 11/95 (12%)
 Frame = +1

Query  148  SFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYA  327
            SFLSS          +   I+   L  C  +    + TYIVHM   + PSSF  H  WY 
Sbjct  4    SFLSST---------APFFIVFLYLGSCHVSHGAQQATYIVHMAKSQMPSSFDHHSLWYD  54

Query  328  AHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            + L+S  +S  ++YTY  A HGFA  L  +E + L
Sbjct  55   SSLRSVSESAEMIYTYNNAIHGFATRLTPEEADSL  89



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + PSSFQ H +WY + L+S   S  LLYTY  A HGFA  L   E + L
Sbjct  28   TYIVHMARSQMPSSFQLHSNWYDSSLRSISTSAELLYTYENAIHGFATRLTQQEADSL  85



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 11/78 (14%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----------SEDS-LLYTYTTA  378
            +A+A+   +TYIV ++H  KPS F TH+ WY + L+S          SE S +L+TY T 
Sbjct  25   SASASALHRTYIVFVQHDAKPSVFPTHKHWYDSSLRSLSSTIQTTSHSETSRILHTYETV  84

Query  379  YHGFAAALGADEVERLRR  432
            +HGF+A L   E ++L++
Sbjct  85   FHGFSAKLSPLEADQLQK  102



>gb|AES62637.2| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 14/80 (18%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ-------------SSEDSLLYTYTTAY  381
            A   KKTYI+HM    KP  F +H++WY++ ++             S E+ ++Y+Y TA+
Sbjct  30   AEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEAEIDSSEEERIIYSYNTAF  89

Query  382  HGFAAALGADEVERLRRSEA  441
            HG AA L  +E ++L  SEA
Sbjct  90   HGMAAKLSTEEAKKL-ESEA  108



>ref|XP_008351977.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  424  LRR  432
            L +
Sbjct  94   LEK  96



>ref|XP_008393753.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=771

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHR-DWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            KKTYI+HM   E P+SF+  R  WY + L+S  DS  +LY Y T +HGFA  L A+E   
Sbjct  34   KKTYIIHMDKSEMPASFEDDRFQWYDSSLKSVSDSADMLYAYKTIFHGFATRLTAEEAGL  93

Query  424  LRR  432
            L +
Sbjct  94   LEK  96



>ref|XP_003592386.1| Subtilisin-like protease [Medicago truncatula]
Length=830

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 14/80 (18%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ-------------SSEDSLLYTYTTAY  381
            A   KKTYI+HM    KP  F +H++WY++ ++             S E+ ++Y+Y TA+
Sbjct  30   AEFVKKTYIIHMDQSAKPDIFSSHQEWYSSKVKSVLSKSVEAEIDSSEEERIIYSYNTAF  89

Query  382  HGFAAALGADEVERLRRSEA  441
            HG AA L  +E ++L  SEA
Sbjct  90   HGMAAKLSTEEAKKL-ESEA  108



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            ++L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYTY  A
Sbjct  16   LILYLLGSSQISDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYTYNNA  75

Query  379  YHGFAAALGADEVERL  426
             HGF+  L  +E + L
Sbjct  76   IHGFSTRLTPEEADSL  91



>ref|XP_002441162.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
 gb|EES19592.1| hypothetical protein SORBIDRAFT_09g021490 [Sorghum bicolor]
Length=744

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 2/71 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            A+A    K YIVHM     P +F +H+ WY + L ++     + Y Y  A HGFAA L  
Sbjct  34   ASAETTAKPYIVHMDKSAMPRAFASHQRWYESTLSAAAPGAGMYYVYDHAAHGFAARLRG  93

Query  409  DEVERLRRSEA  441
            DE+E LRRS  
Sbjct  94   DELEALRRSRG  104



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYT  366
            S    +L+LL     +    + TYIVHM   + PSS+  H  WY + L+S  +S  LLYT
Sbjct  11   SFFLFILYLLGSSQVSDGAQQATYIVHMAKSQMPSSYDLHSLWYDSSLRSVSESAQLLYT  70

Query  367  YTTAYHGFAAALGADEVERL  426
            Y  A HGF+  L  +E + L
Sbjct  71   YNNAIHGFSTRLTPEEADSL  90



>ref|XP_009129098.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=727

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKT-YIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLL  360
            AIT+++ LL P + T A  + + +I+HM    KP+ F  H+ W++  L S     +  +L
Sbjct  2    AITVMILLLIPFSVTTATTETSIFIIHMDLSAKPAPFTDHQSWFSTTLTSVTTGRKPKIL  61

Query  361  YTYTTAYHGFAAALGADEVERLR  429
            Y YT + HGF+A L   E++RL+
Sbjct  62   YAYTDSVHGFSAVLTNSELKRLQ  84



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAA  396
            A T  V  +TYIV+M    KPS+  TH  WY AHLQS        LLY+Y+ A+HGFAA
Sbjct  21   APTLVVCNQTYIVYMNPAHKPSAHPTHALWYQAHLQSLSIDPSRHLLYSYSAAFHGFAA  79



>gb|KJB58524.1| hypothetical protein B456_009G213600 [Gossypium raimondii]
Length=734

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/93 (38%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAK--KTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  342
            + S +T LL LL       +  +  KTYIV++ H +KPSSF TH  W+   L+S      
Sbjct  7    YISILTFLLALLFGINNVLSKPEEYKTYIVYLDHSQKPSSFLTHETWHQTILKSLSKPVH  66

Query  343  SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
             ++ LLY+Y  A +GF+A L   +V +L++S A
Sbjct  67   GKEMLLYSYNHAMNGFSARLTPAQVSKLKKSPA  99



>gb|EYU36339.1| hypothetical protein MIMGU_mgv1a001782mg [Erythranthe guttata]
Length=760

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 47/86 (55%), Gaps = 6/86 (7%)
 Frame = +1

Query  196  AITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED------SL  357
            A+ ++L  +   A   +  + TYIVHM     P +F +H  WY++ L S++        +
Sbjct  8    AVALILVSIFLLADDVSAERSTYIVHMDKSSMPKAFSSHHHWYSSMLNSAKSLDERGLKI  67

Query  358  LYTYTTAYHGFAAALGADEVERLRRS  435
            +YTY  A+HGF+  +   E+E L++S
Sbjct  68   IYTYDNAFHGFSVVMNKHELEALKKS  93



>ref|XP_011076276.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=781

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 14/78 (18%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------------SEDSLLYTYTTAYHG  387
            A KTYIV+M    KP  F  HR WY++ ++S              ++D ++Y Y TA+HG
Sbjct  32   ATKTYIVYMDKWAKPQEFSDHRQWYSSMIKSVASSRTEKRDDADENDDRIIYNYQTAFHG  91

Query  388  FAAALGADEVERLRRSEA  441
             AA L  +EVE+L   + 
Sbjct  92   VAAQLSEEEVEKLLEQDG  109



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            ++++  + TYIVHM   + PSSF  H +WY + L+S  DS  LLYTY  A HGF+  L  
Sbjct  14   SSSSSDQGTYIVHMAKSQTPSSFDLHSNWYDSSLRSISDSAELLYTYENAIHGFSTRLTQ  73

Query  409  DEVERL  426
            +E + L
Sbjct  74   EEADSL  79



>gb|AFW84453.1| putative subtilase family protein [Zea mays]
Length=770

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 41/76 (54%), Gaps = 10/76 (13%)
 Frame = +1

Query  232  AATAAVAKKT-YIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS---------LLYTYTTAY  381
            +  AA A++T YIVHM     P     HRDWYAA + S  D+         LLYTY  A 
Sbjct  27   SPVAARAERTGYIVHMDKSAMPRHHSDHRDWYAATVASVTDASAGVRTKPQLLYTYDEAL  86

Query  382  HGFAAALGADEVERLR  429
            HGFAA L A E+  LR
Sbjct  87   HGFAATLSASELRALR  102



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  405
            AA     + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L 
Sbjct  23   AAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLT  82

Query  406  ADEVERLRR  432
             +E E L +
Sbjct  83   REEAESLEQ  91



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGA  408
            +T   AK TYI+HM     P++F  H +WY + L+S  D   +LYTY +  HGF+  L A
Sbjct  24   STKKPAKSTYIIHMDKSNMPTTFAGHLEWYDSSLKSVSDGADMLYTYNSVLHGFSVRLTA  83

Query  409  DEVERLRR  432
             E E L +
Sbjct  84   KEAELLEK  91



>ref|XP_004142885.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
 ref|XP_004172334.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
Length=641

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 15/95 (16%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVA--------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  342
            WF     LL L+  C+ +   A        KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  343  SEDS--LLYTYTTAYHGFAAALGADEVERLRRSEA  441
              DS  +LY+Y T  HGF+  L  +E + + + E 
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEG  98



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            ++++  + TYIVHM   + PS+F  H +WY + L+S  DS  LLYTY  A HGF+  L  
Sbjct  19   SSSSSQQGTYIVHMAKSQMPSTFDLHSNWYDSSLRSVSDSAELLYTYENAIHGFSTRLTQ  78

Query  409  DEVERL  426
            +E + L
Sbjct  79   EEADSL  84



>ref|XP_004142884.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 ref|XP_004172333.1| PREDICTED: subtilisin-like protease-like isoform 1 [Cucumis sativus]
 gb|KGN62460.1| Xylem serine proteinase 1 [Cucumis sativus]
Length=770

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 15/95 (16%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVA--------KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS  342
            WF     LL L+  C+ +   A        KKTYI+HM     P +F  H  WY + L+S
Sbjct  9    WF-----LLFLISFCSCSFTEAQKSNQQLKKKTYIIHMDKTNMPQAFDDHFQWYDSSLKS  63

Query  343  SEDS--LLYTYTTAYHGFAAALGADEVERLRRSEA  441
              DS  +LY+Y T  HGF+  L  +E + + + E 
Sbjct  64   VSDSAQMLYSYNTVIHGFSTRLTVEEAKLMEKQEG  98



>dbj|BAJ88973.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 4/85 (5%)
 Frame = +1

Query  187  WFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLL  360
            W + + + L  +RP A+  A A  +YIVHM     PS F +H  WY + L ++     + 
Sbjct  17   WVALVLVAL-WVRPVASVDAPAA-SYIVHMDKSAIPSGFSSHLRWYESMLAAAAPGADMF  74

Query  361  YTYTTAYHGFAAALGADEVERLRRS  435
            Y Y  A HGFAA L  +E+ RLRRS
Sbjct  75   YVYDHAMHGFAARLPEEELVRLRRS  99



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  405
            +A   + K  +IVHM   + P SF+ H  WY + L+S   S  +LY Y  A HGFAA L 
Sbjct  29   SAGMNMMKSNFIVHMAKSQMPESFEDHTHWYDSSLRSVSGSAEMLYVYNNAVHGFAARLT  88

Query  406  ADEVERLR  429
            A+E E L+
Sbjct  89   AEEAESLQ  96



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGA  408
            + A V KKTYI+HM   + P+ F  H  WY A L+S  +S  ++Y Y    HGFAA L A
Sbjct  18   SVAMVEKKTYIIHMAKSQMPAIFDDHTHWYDASLKSVSESAEMIYVYKNVVHGFAARLTA  77

Query  409  DEVERL  426
             + E L
Sbjct  78   RQAESL  83



>ref|XP_009146389.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=770

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGADEVERL  426
            TYIVH+ H  KPS F THR WY + L S+  S+++TY T  HGF+A L A E  +L
Sbjct  25   TYIVHVDHEAKPSIFPTHRHWYTSSLTSTSSSIIHTYDTVSHGFSARLTAQEATQL  80



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (56%), Gaps = 16/97 (16%)
 Frame = +1

Query  178  SLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----  342
            S +W+  +T++  +     AT +  KKTYIVHM     P SF  H +WY++ ++S     
Sbjct  16   SFLWY--LTVVFAV---STATLSSLKKTYIVHMDKSVLPESFADHLEWYSSTVKSVMATP  70

Query  343  -SEDS-----LLYTYTTAYHGFAAALGADEVERLRRS  435
             SED      ++Y+Y TA+HGFAA L  +E +RL   
Sbjct  71   QSEDEDASERIIYSYETAFHGFAARLIEEEAQRLEEG  107



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = +1

Query  190  FSAITILLHLLRPCAATAAVA-KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--L  357
            +  I +++ LL  C  + A+  KKTYI+HM   + P++F   H  WY + L+S  DS  +
Sbjct  13   YPVILVVVALLSLCRMSVAMEEKKTYIIHMAKSQMPATFNDDHAHWYDSSLKSVSDSAEM  72

Query  358  LYTYTTAYHGFAAALGADEVERL  426
            LY Y    HGF+A L   E E L
Sbjct  73   LYVYNNVVHGFSARLTPQEAESL  95



>gb|EYU25025.1| hypothetical protein MIMGU_mgv1a001588mg [Erythranthe guttata]
Length=789

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 17/77 (22%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-----------------SEDSLLYTYTTA  378
            +K TYI++M    KP  F  H+ WY++ ++S                  +D ++Y+Y TA
Sbjct  34   SKNTYIIYMDKLAKPEEFSDHKQWYSSLIKSVTTKTDEYDEKTGEYENDDDRIIYSYETA  93

Query  379  YHGFAAALGADEVERLR  429
            +HG AA L  DEVE+L+
Sbjct  94   FHGVAARLNGDEVEKLQ  110



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQ--SSEDSLLYTYTTAYHGFAAALGADEVER  423
             ++TYIVHM H   P+ F  H +WYAA LQ  S   ++LYTY T  HG++A L   E E 
Sbjct  29   GRQTYIVHMSHSAMPNDFVEHGEWYAASLQAVSEAATVLYTYDTLVHGYSARLTRAEAEA  88

Query  424  L  426
            L
Sbjct  89   L  89



>ref|XP_008782639.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Phoenix 
dactylifera]
Length=772

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAA  399
            +AT     +TYIV+M    +P+   TH  WY AHLQS     +  LLY+Y+ A +GFAA 
Sbjct  26   SATHVQGNRTYIVYMNPAHRPAVHPTHAHWYRAHLQSLAIDPDRHLLYSYSAAANGFAAR  85

Query  400  LGADEVERLRRSEA  441
            L  D +  LRR  A
Sbjct  86   LLPDHLPLLRRHPA  99



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  405
            AA     + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L 
Sbjct  22   AAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLT  81

Query  406  ADEVERLRR  432
             +E E L +
Sbjct  82   REEAESLEQ  90



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            K+TYIVHM   E P+ FQ H  WY + L+S  DS  +LYTY    HGF+  L  +E + +
Sbjct  29   KRTYIVHMAKSEMPAVFQDHTHWYDSSLKSVSDSAEMLYTYNNVIHGFSTRLTPEEAQAM  88



>ref|XP_006651839.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=716

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERL  426
            ++TYIVHM     P+ F  H +WYAA LQS  D  ++LYTY T  HG++A L   E E L
Sbjct  31   RRTYIVHMSRSAMPNDFAEHGEWYAASLQSVSDAATVLYTYDTLVHGYSARLTRAEAEAL  90



>ref|XP_010919193.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=784

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 18/99 (18%)
 Frame = +1

Query  187  WFSAITILLHL-LRPCAATAAVA-KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  342
            W S     LHL L  C  T      +TYI+HM   E P SF  H  WYA+ ++S      
Sbjct  11   WLSLCLAALHLTLSLCTTTPPKPLPRTYIIHMAKSEMPQSFTHHLQWYASTIKSVTTSSK  70

Query  343  ----SEDS------LLYTYTTAYHGFAAALGADEVERLR  429
                +ED       ++Y+Y TA+HGFAA L  DE E L+
Sbjct  71   PEAVAEDEEDPAERIIYSYETAFHGFAAKLTEDEAEMLQ  109



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            K+TYI+HM    KP++F  H +WY + L+S  DS  +LYTY    HGF+ +L   E + L
Sbjct  33   KRTYIIHMDKSNKPATFDNHFNWYDSSLKSVSDSADMLYTYNNVIHGFSTSLTEKEAQFL  92

Query  427  RR  432
            ++
Sbjct  93   KQ  94



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  405
            AA     + TYI+HM   E P+SF+ H  WY + L+S  DS  +LYTY    HGF+  L 
Sbjct  22   AAQNPDQRATYIIHMAKSEMPASFEHHTHWYESSLKSVSDSAEILYTYDNVIHGFSTQLT  81

Query  406  ADEVERLRR  432
             +E E L +
Sbjct  82   REEAESLEQ  90



>emb|CDY18651.1| BnaA09g07440D [Brassica napus]
Length=751

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L
Sbjct  32   TYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSL  89



>ref|XP_004141727.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45447.1| hypothetical protein Csa_7G448090 [Cucumis sativus]
Length=777

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +1

Query  208  LLHLLRPCAATAAV--AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-----SLLYT  366
            L  LL P ++++++  +KKT+IV +    KPS F TH++WY + L S        ++++T
Sbjct  10   LFSLLIPFSSSSSIDASKKTFIVQVHKDSKPSIFPTHKNWYESSLASISSVNDVGAIIHT  69

Query  367  YTTAYHGFAAALGADEVERLR  429
            Y T +HGF+A L   EVE+L+
Sbjct  70   YETLFHGFSAKLSPLEVEKLQ  90



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            +KTYIVHM   E P+SF  H  WY + L+S  DS  +LYTY    HGF+  L  +E ++L
Sbjct  30   RKTYIVHMAKSEMPASFLHHTHWYDSSLKSVSDSAQMLYTYDNVIHGFSTQLTNEEAQQL  89



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + PSSF  H  WY + L+S+ +S  +LYTY +A HGFA  L  +E + L
Sbjct  32   TYIVHMAKSQMPSSFDQHSLWYESSLKSASESAEMLYTYNSAIHGFATRLTPEEADSL  89



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            KKTY+VHM     P++F  H +WY + L+S   S  +LYTY    HGF+  L A E E L
Sbjct  30   KKTYVVHMDKSTMPATFNDHFEWYDSSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESL  89

Query  427  RR  432
            ++
Sbjct  90   QK  91



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQ--SSEDSLLYTYTTAYHGFAAALGADEVERL  426
            KKTY+VHM     P++F  H +WY + L+  S+  ++LYTY    HGF+  L A E E L
Sbjct  30   KKTYVVHMDKSTMPATFNDHFEWYDSSLKSVSASAAMLYTYKNVIHGFSTRLTAKEAESL  89

Query  427  RR  432
            ++
Sbjct  90   QK  91



>ref|XP_010263511.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 44/90 (49%), Gaps = 13/90 (14%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS----------  354
            +LL +   C ++       YIVHM     P +F +H  WY A L S  ++          
Sbjct  8    LLLFITFSCLSSILAQSNVYIVHMDLSAMPETFSSHDSWYMAMLSSVSEATYAVASTTSK  67

Query  355  ---LLYTYTTAYHGFAAALGADEVERLRRS  435
               L+YTY+ A HGFAAAL   E++ L+ S
Sbjct  68   ASKLIYTYSNAIHGFAAALSPSELDLLKSS  97



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (59%), Gaps = 2/63 (3%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            +KKTYI+HM     P SF  H  WY + L+S  +S  +LYTY T  HGF+  L  +E E 
Sbjct  10   SKKTYIIHMDKANVPESFDDHLQWYDSALKSVSESADILYTYNTVIHGFSTRLTPEEAEL  69

Query  424  LRR  432
            L +
Sbjct  70   LEK  72



>ref|XP_011069659.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=754

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/90 (36%), Positives = 47/90 (52%), Gaps = 14/90 (16%)
 Frame = +1

Query  190  FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-----  354
            F AIT+      P   + +    TYIVHM     P +F +HR WY+  L S  +S     
Sbjct  13   FLAITV------PQLMSTSTDSDTYIVHMDLTAMPKAFSSHRTWYSTTLSSVSNSNKATT  66

Query  355  ---LLYTYTTAYHGFAAALGADEVERLRRS  435
               L+Y YTTA +GF+A L + E++ ++ S
Sbjct  67   TSNLVYAYTTAINGFSAVLSSSELDAIKNS  96



>ref|XP_007152373.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
 gb|ESW24367.1| hypothetical protein PHAVU_004G124600g [Phaseolus vulgaris]
Length=781

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 12/101 (12%)
 Frame = +1

Query  172  MGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS---  342
            MG++  F + + LL L    +A A  AKKTY++ M     P +F  H +WY++ ++S   
Sbjct  6    MGNMGCFLS-SYLLVLTMLFSANAQFAKKTYLIQMDKSAMPKAFPNHLEWYSSKVKSALS  64

Query  343  --------SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                    SE  ++YTY  A+HG AA L   E ++L   E 
Sbjct  65   TLPEADADSEKRIIYTYQNAFHGVAAKLTEGEAKKLETEEG  105



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            TYIVHM   + P+SF+ H  WY + L+S  DS  +LYTYT+A HGF+  L  ++   L
Sbjct  40   TYIVHMAKSQMPASFEHHTHWYDSSLKSVSDSAEMLYTYTSAIHGFSTRLTPEQAASL  97



>gb|KJB58523.1| hypothetical protein B456_009G213500 [Gossypium raimondii]
Length=759

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 8/72 (11%)
 Frame = +1

Query  244  AVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------SEDSLLYTYTTAYHGFAAA  399
            A +  TYIVHM     P  F +H  WY++ + S        S  SL+Y+Y +  HGF+A 
Sbjct  23   AASVNTYIVHMDKSFMPKVFASHHSWYSSIVDSLKSTNIPQSSPSLIYSYDSGAHGFSAV  82

Query  400  LGADEVERLRRS  435
            L  DE+E L++S
Sbjct  83   LSGDELETLKKS  94



>gb|KHN06066.1| Subtilisin-like protease [Glycine soja]
Length=598

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 11/66 (17%)
 Frame = +1

Query  274  MKHHEKPSSFQTHRDWY-----------AAHLQSSEDSLLYTYTTAYHGFAAALGADEVE  420
            MKHH+K S + TH DWY                S  + LLY+YTT+Y GFAA+L  ++VE
Sbjct  1    MKHHKKSSVYPTHSDWYNTTLLQSLTLTTTDSDSKSNPLLYSYTTSYKGFAASLNDEQVE  60

Query  421  RLRRSE  438
             L +SE
Sbjct  61   ELLKSE  66



>gb|EYU25440.1| hypothetical protein MIMGU_mgv1a0017511mg, partial [Erythranthe 
guttata]
Length=650

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 13/78 (17%)
 Frame = +1

Query  241  AAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-------------SLLYTYTTAY  381
            A+  + TYI+HM     P +F +HR WY++ L S +               L+YTY  A+
Sbjct  19   ASAQRSTYIIHMDKSLMPKAFSSHRYWYSSILHSVQSPTSFAGGGEKLRPKLVYTYDNAF  78

Query  382  HGFAAALGADEVERLRRS  435
            HGF A +  D+V+ +R+S
Sbjct  79   HGFTAVMSEDDVDAVRKS  96



>ref|XP_003627424.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AET01900.1| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/64 (36%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS----SEDSLLYTYTTAYHGFAAALGADEVE  420
            K+T+I+ ++H+ KPS F TH++WY + L S    + +++++TY T +HGF+  L   E +
Sbjct  27   KQTFIIQVQHNSKPSIFPTHKNWYESSLSSITKTTSNNIIHTYDTVFHGFSTKLTQLEAQ  86

Query  421  RLRR  432
             L++
Sbjct  87   NLQK  90



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 13/77 (17%)
 Frame = +1

Query  250  AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYTTAYHGF  390
            A KTYIV M    KP SF  H DWY++ + S              ++ ++YTY  A+HG 
Sbjct  31   AHKTYIVQMDKSAKPESFTNHLDWYSSKVNSIVFKPENEEDGGHDQERVIYTYQNAFHGV  90

Query  391  AAALGADEVERLRRSEA  441
            AA L  +E ERL+  + 
Sbjct  91   AARLSEEEAERLQEQDG  107



>ref|XP_004496643.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=780

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (54%), Gaps = 13/78 (17%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  372
            ++ A   KKTYI+ M    KP+ F  H++WY++ ++S             +E+ ++Y Y 
Sbjct  29   SSNAEFVKKTYIIQMDKSAKPNIFSNHKEWYSSKVKSVMSISLEAERDNNNEERIIYNYN  88

Query  373  TAYHGFAAALGADEVERL  426
            TA+HG AA L   E  +L
Sbjct  89   TAFHGMAAKLSQKEANKL  106



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            + TYIVHM   + PS+F  H +WY + L+S  DS  LLYTY  A HGF+  L  +E + L
Sbjct  36   QGTYIVHMAKSQMPSTFDLHSNWYDSSLRSISDSAELLYTYENAIHGFSTRLTQEEADSL  95



>dbj|BAJ87233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  187  WFSAITILLHL-LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SL  357
            W + + + L++     A   A A  +YIVHM     P+ F +H  WY + L ++     +
Sbjct  4    WLALVLVALYVRPAAPADPVAAASSSYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADM  63

Query  358  LYTYTTAYHGFAAALGADEVERLRRS  435
             Y Y  A HGFAA L A+E++RLRRS
Sbjct  64   FYVYDHAMHGFAARLPAEELDRLRRS  89



>emb|CAN60787.1| hypothetical protein VITISV_034533 [Vitis vinifera]
Length=763

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 18/100 (18%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  342
            L++ + I   LH       +A+  + TYI+HM     P +F TH  WYA+ + S      
Sbjct  12   LIFLAWILFTLHF-----RSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  66

Query  343  -------SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                   S   L+Y Y    HGF+A L   E+E+LRRS A
Sbjct  67   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTA  106



>dbj|BAJ88882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=747

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSED--SLLYTYTTAYHGFAAALGADEVERLRR  432
            +YIVHM     P+ F +H  WY + L ++     + Y Y  A HGFAA L A+E++RLRR
Sbjct  29   SYIVHMDKSAMPTGFASHLSWYESTLAAAAPGADMFYVYDHAMHGFAARLPAEELDRLRR  88

Query  433  S  435
            S
Sbjct  89   S  89



>gb|KJB43875.1| hypothetical protein B456_007G221100 [Gossypium raimondii]
Length=761

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            +KTYIVHM   E P SFQ H  WY + L+S   S  +LYTY    HGF+  L   E E+L
Sbjct  31   RKTYIVHMAKSEMPPSFQHHTHWYDSSLKSVSGSAAMLYTYDNVIHGFSTQLTDKEAEQL  90



>ref|XP_009338017.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 15/95 (16%)
 Frame = +1

Query  190  FSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--SED----  351
            FS + + L  L+   + A   + TYIVHM     P S+ +H  WY++ + S  SE+    
Sbjct  13   FSLVALFLLALQVNVSFAD--RSTYIVHMDKSLMPKSYTSHDHWYSSIVDSFKSENPTSF  70

Query  352  -------SLLYTYTTAYHGFAAALGADEVERLRRS  435
                   S+LYTY  A+HGF+A L ADE+  L++S
Sbjct  71   DGNKIWPSILYTYDNAFHGFSAVLSADELVTLKKS  105



>emb|CDY55359.1| BnaCnng28690D [Brassica napus]
Length=704

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +1

Query  205  ILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTA  378
            I+L  L     +    + TYIVHM   + PSSF  H  WY + L+S  +S  +LYTY  A
Sbjct  15   IVLLYLSSFHVSDGAQQATYIVHMAKSQMPSSFDHHSLWYDSSLRSVSESAEMLYTYNNA  74

Query  379  YHGFAAALGADEVERL  426
             HGFA  L  +E + L
Sbjct  75   IHGFATRLTPEEADSL  90



>ref|XP_008220305.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=769

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 10/88 (11%)
 Frame = +1

Query  199  ITILLHLLRPCAATAAVA-------KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS  354
            + +L  +L P +    VA       KKTYI+HM   + P+SF+  H  WY + L+S  +S
Sbjct  7    MLLLAVMLLPISHICVVAEDREQQVKKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNS  66

Query  355  --LLYTYTTAYHGFAAALGADEVERLRR  432
              +LYTY T  HGF+  L A+E E L +
Sbjct  67   ADMLYTYRTIIHGFSTRLTAEEAELLEK  94



>emb|CDY40653.1| BnaA03g53100D [Brassica napus]
Length=767

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDSLLYTYTTAYHGFAAALGAD  411
            AA A+ A KT+I  +     PS F TH  WY++   + E S+L+ Y T +HGF+A +  D
Sbjct  21   AADASQAAKTFIFRVDGGSMPSVFPTHYHWYSSEF-AQESSILHVYHTVFHGFSAVVTPD  79

Query  412  EVERLRRSEA  441
            E + LR   A
Sbjct  80   EADNLRNHPA  89



>ref|XP_002284864.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=763

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 18/100 (18%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  342
            L++ + I+  LH       +A+  + TYI+HM     P +F TH  WYA+ + S      
Sbjct  12   LIFIAWISFTLHF-----RSASGERSTYIIHMDKSLMPRAFATHHHWYASTVDSLTTAAS  66

Query  343  -------SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                   S   L+YTY    HGF A L  DE+E+LR+S A
Sbjct  67   TRSNAVQSTPKLIYTYDHVLHGFCAVLSKDELEKLRKSTA  106



>emb|CAA59964.1| subtilisin-like protease [Alnus glutinosa]
Length=761

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 11/87 (13%)
 Frame = +1

Query  193  SAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHL------QSSEDS  354
            S I + LH     A++ ++ K TYIVHM     P +F +H +WY++ +      + +  S
Sbjct  17   SCICLALH-----ASSTSMEKSTYIVHMDKSHMPKAFTSHHNWYSSIVDCLNSEKPTTSS  71

Query  355  LLYTYTTAYHGFAAALGADEVERLRRS  435
             +YTY    HGF+A+L   E++ LR S
Sbjct  72   FVYTYNHVLHGFSASLSHQELDTLRES  98



>ref|XP_004496644.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 14/84 (17%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSS--------------EDSLLYTY  369
            ++ A  AKKTYI+ M +  KP  F  H++WY + ++S               ED ++Y Y
Sbjct  29   SSNAEFAKKTYIIQMDNSAKPDIFSNHQEWYTSKVKSVVYKSLEADEIDNNIEDRIIYNY  88

Query  370  TTAYHGFAAALGADEVERLRRSEA  441
             TA+ G AA L  +E ++L   + 
Sbjct  89   NTAFQGMAAKLSQEEAKKLENEDG  112



>ref|XP_009337959.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Pyrus 
x bretschneideri]
Length=798

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 13/74 (18%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--SED-----------SLLYTYTTAYHGFA  393
            + TYIVHM     P S+ +H  WY++ + S  SE+           S+LYTY TA+HGF+
Sbjct  66   RSTYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFS  125

Query  394  AALGADEVERLRRS  435
            A L  DE+  L++S
Sbjct  126  AVLSPDELVTLKKS  139



>ref|XP_002284869.3| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=778

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 18/100 (18%)
 Frame = +1

Query  181  LVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS------  342
            L++ + I   LH       +A+  + TYI+HM     P +F TH  WYA+ + S      
Sbjct  27   LIFLAWILFTLHF-----RSASGERSTYIIHMDKSLMPKAFATHHHWYASTVDSLMTAAS  81

Query  343  -------SEDSLLYTYTTAYHGFAAALGADEVERLRRSEA  441
                   S   L+Y Y    HGF+A L   E+E+LRRS A
Sbjct  82   TTSIAVQSTPKLIYIYDHVLHGFSAVLSKGELEKLRRSTA  121



>emb|CDY67452.1| BnaCnng55020D [Brassica napus]
Length=748

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +1

Query  259  TYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVERLR  429
            TYIVHM   + PSSF  H  WY + L+S  +S  +LYTY  A HGFA  L  +E + L+
Sbjct  32   TYIVHMAKSQMPSSFDHHSLWYESSLKSISESAEMLYTYNNAIHGFATRLTPEEADSLK  90



>ref|XP_003516516.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=775

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +1

Query  238  TAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGAD  411
            +A   K TYIVH+   E PSSF  H  WY + L+S+ +S  +LYTY    HGF+  L  +
Sbjct  31   SAENPKGTYIVHLAKSEMPSSFNQHSIWYKSVLKSASNSAEMLYTYDNVIHGFSTRLTHE  90

Query  412  EVERLR  429
            E   LR
Sbjct  91   EAWLLR  96



>ref|XP_009342993.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=764

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 13/74 (18%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--SED-----------SLLYTYTTAYHGFA  393
            + TYIVHM     P S+ +H  WY++ + S  SE+           S+LYTY TA+HGF+
Sbjct  32   RSTYIVHMDKSLMPKSYSSHDHWYSSIVDSFKSENPTSFDGNKILPSILYTYDTAFHGFS  91

Query  394  AALGADEVERLRRS  435
            A L  DE+  L++S
Sbjct  92   AVLSPDELVTLKKS  105



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 5/64 (8%)
 Frame = +1

Query  256  KTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS-----LLYTYTTAYHGFAAALGADEVE  420
            +T+I+H+    KPS F +H DWY + + S   S     LLY Y  A HGF+A L   +VE
Sbjct  31   RTFIIHVSRSHKPSLFSSHHDWYTSIIHSLPPSPHPAKLLYNYNHATHGFSAQLTTTQVE  90

Query  421  RLRR  432
             LRR
Sbjct  91   MLRR  94



>ref|XP_008462247.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=777

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 7/81 (9%)
 Frame = +1

Query  208  LLHLLRPCAATAAV--AKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSED-----SLLYT  366
            L  LL P ++++++  +KKT+IV +    KPS F TH+ WY + L S        ++++T
Sbjct  10   LFSLLIPFSSSSSIDASKKTFIVQVHKDSKPSIFPTHKHWYESSLASISSVNDGGAIIHT  69

Query  367  YTTAYHGFAAALGADEVERLR  429
            Y T +HGF+A L   EVE+L+
Sbjct  70   YETLFHGFSAKLSPLEVEKLQ  90



>emb|CDY63302.1| BnaCnng41810D [Brassica napus]
Length=748

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 50/95 (53%), Gaps = 10/95 (11%)
 Frame = +1

Query  148  SFLSSI*AMGSLVWFSAITILLHLLRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYA  327
            SFLSS     +L +F    I+L  L    A+    + TYIVHM   + PSSF  H  WY 
Sbjct  2    SFLSST----ALFFF----IVLLNLSSFHASDGAQQATYIVHMAKSQMPSSFDHHSLWYD  53

Query  328  AHLQSSEDS--LLYTYTTAYHGFAAALGADEVERL  426
            + L+S  +S  ++YTY  A HGFA  L   E + L
Sbjct  54   SSLRSVSESAEMIYTYNNAIHGFATRLTPGEADSL  88



>ref|XP_007226995.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
 gb|EMJ28194.1| hypothetical protein PRUPE_ppa001756mg [Prunus persica]
Length=769

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +1

Query  253  KKTYIVHMKHHEKPSSFQT-HRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALGADEVER  423
            KKTYI+HM   + P+SF+  H  WY + L+S  +S  +LYTY T  HGF+  L A+E E 
Sbjct  32   KKTYIIHMDKSQMPASFEDDHFQWYDSSLKSVSNSADMLYTYRTIIHGFSTRLTAEEAEL  91

Query  424  LRR  432
            L +
Sbjct  92   LEK  94



>dbj|BAJ90426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = +1

Query  205  ILLHL-LRPCAATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTT  375
            +L+ L +RP A+  A A  +YIVHM     PS F +H  WY + L ++     + Y Y  
Sbjct  1    VLVALWVRPVASVDAPAA-SYIVHMDKSAMPSGFSSHLRWYESMLAAAAPGADMFYVYDH  59

Query  376  AYHGFAAALGADEVERLRRSEA  441
            A HGFAA L  +E+ RLRRS  
Sbjct  60   AMHGFAARLPEEELVRLRRSPG  81



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQSSEDS--LLYTYTTAYHGFAAALG  405
            A T    KKTYIVHM   + P+SF+ H  WY + L+S   S  +LY Y  A HGF+  L 
Sbjct  2    ATTQKQDKKTYIVHMAKSQMPASFEQHVHWYDSSLKSVSGSAQMLYFYDNAIHGFSTRLT  61

Query  406  ADEVERL  426
             +E E L
Sbjct  62   PEEAELL  68



>gb|AAO62352.1| subtilase [Casuarina glauca]
Length=764

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 13/81 (16%)
 Frame = +1

Query  232  AATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS-------------SEDSLLYTYT  372
             ++A+V K TYIVHM     P +F +H  WY + + S             S  S LYTY 
Sbjct  25   GSSASVEKSTYIVHMDKSHMPKAFTSHHSWYLSIIDSLNSERPTSTEELKSASSFLYTYN  84

Query  373  TAYHGFAAALGADEVERLRRS  435
               HGF+ AL  ++VE L+ +
Sbjct  85   HVLHGFSVALCQEDVESLKNT  105



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 8/74 (11%)
 Frame = +1

Query  235  ATAAVAKKTYIVHMKHHEKPSSFQTHRDWYAAHLQS--------SEDSLLYTYTTAYHGF  390
            A ++  ++TYIVH+   +KPS F TH  WY++ L+S            L+YTY  A HGF
Sbjct  22   AASSDGRETYIVHVAKAQKPSVFPTHHHWYSSILRSLSPLSAHHPPTKLIYTYDHAVHGF  81

Query  391  AAALGADEVERLRR  432
            +A L + +   LRR
Sbjct  82   SARLTSSQAAELRR  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860