BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034M11

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAV88066.1|  NBS-LRR protein                                       59.3    3e-07   Ipomoea batatas [batate]



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 9/87 (10%)
 Frame = +3

Query  24   MACVAVNSLVRTIELEFLQPLPRPIVRQSQLIPANENLIQNLHQKLGDLIDLFDENR-MD  200
            MACVA+ SL+ TI+LEFLQP PR ++        ++  +++ ++KL  L     E     
Sbjct  1    MACVALTSLMATIKLEFLQPNPRVVL--------DDEAMESFYEKLSSLQGFVQEKSGAR  52

Query  201  DIQAIKHLETKLRDVAFRVEDEIEFQI  281
               AI+HLE ++RD A   ED IE Q+
Sbjct  53   GGTAIRHLEIQIRDFALEAEDRIETQL  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370