BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034K14

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDY01177.1|  BnaA04g06420D                                          201   1e-66   
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    201   1e-66   Arabis alpina [alpine rockcress]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                201   1e-66   Brassica rapa
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             201   1e-66   Capsella rubella
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            201   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            201   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             201   2e-66   Arabidopsis lyrata subsp. lyrata
ref|NP_193130.1|  adenosylhomocysteinase 1                              201   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62888.1|  adenosylhomocysteinase                                  201   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            201   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                198   3e-66   
emb|CDY50423.1|  BnaCnng19320D                                          201   4e-66   Brassica napus [oilseed rape]
ref|NP_001078387.1|  adenosylhomocysteinase 1                           200   7e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    202   7e-66   Arabis alpina [alpine rockcress]
gb|ABK25129.1|  unknown                                                 195   1e-64   Picea sitchensis
gb|ABK24229.1|  unknown                                                 195   1e-64   Picea sitchensis
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             186   6e-64   
gb|KJB28098.1|  hypothetical protein B456_005G027700                    197   8e-64   Gossypium raimondii
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    194   1e-63   Petroselinum crispum
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  189   6e-63   Nelumbo nucifera [Indian lotus]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             193   7e-63   Phoenix dactylifera
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             189   8e-63   Nelumbo nucifera [Indian lotus]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                183   8e-63   Erythranthe guttata [common monkey flower]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       189   3e-62   Gentiana triflora
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     182   4e-62   Eucalyptus grandis [rose gum]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  188   5e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       182   6e-62   
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      186   8e-62   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             180   9e-62   
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   186   1e-61   Citrus sinensis [apfelsine]
emb|CDY47309.1|  BnaAnng08830D                                          185   1e-61   Brassica napus [oilseed rape]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             186   1e-61   Citrus sinensis [apfelsine]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   186   1e-61   Citrus sinensis [apfelsine]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           185   2e-61   Brassica rapa
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       184   2e-61   Nicotiana benthamiana
emb|CDY58805.1|  BnaC08g46780D                                          185   2e-61   Brassica napus [oilseed rape]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     184   2e-61   Nicotiana tabacum [American tobacco]
ref|NP_001289538.1|  adenosylhomocysteinase                             184   2e-61   Nicotiana sylvestris
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             184   2e-61   Glycine max [soybeans]
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       184   2e-61   Gentiana triflora
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             184   2e-61   Populus euphratica
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                184   3e-61   Tarenaya hassleriana [spider flower]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                184   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             184   3e-61   Solanum tuberosum [potatoes]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               184   3e-61   Capsicum annuum
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             185   3e-61   Citrus clementina [clementine]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                184   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             184   3e-61   Glycine max [soybeans]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             184   3e-61   Nicotiana tomentosiformis
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             184   3e-61   Nicotiana sylvestris
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             184   3e-61   Solanum lycopersicum
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      184   3e-61   Petunia x hybrida [garden petunia]
ref|XP_010097949.1|  hypothetical protein L484_026840                   184   3e-61   Morus notabilis
gb|AEI54335.1|  adenosylhomocysteinase                                  183   3e-61   Glycine max [soybeans]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                184   3e-61   Erythranthe guttata [common monkey flower]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    182   3e-61   Linum usitatissimum
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             183   3e-61   
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           184   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   183   4e-61   Ricinus communis
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                183   4e-61   Cucumis melo [Oriental melon]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             183   4e-61   
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      183   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             183   4e-61   Phaseolus vulgaris [French bean]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          183   5e-61   Amborella trichopoda
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  183   5e-61   Eucalyptus grandis [rose gum]
emb|CDP11183.1|  unnamed protein product                                183   5e-61   Coffea canephora [robusta coffee]
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             183   5e-61   Vitis vinifera
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     183   5e-61   Eucalyptus grandis [rose gum]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
emb|CDX85127.1|  BnaC07g07790D                                          182   7e-61   
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   182   7e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-61   Populus tomentosa [Chinese white poplar]
gb|AGV54286.1|  adenosylhomocysteinase                                  182   9e-61   Phaseolus vulgaris [French bean]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           182   9e-61   Brassica rapa
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  182   9e-61   Sesamum indicum [beniseed]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             182   1e-60   Pyrus x bretschneideri [bai li]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     182   1e-60   Phaseolus vulgaris [French bean]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             186   1e-60   Phoenix dactylifera
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  182   1e-60   Solanum lycopersicum
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  182   1e-60   Malus domestica [apple tree]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    184   1e-60   Mesembryanthemum crystallinum
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  182   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             182   1e-60   Prunus persica
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       182   1e-60   Prunus mume [ume]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   182   1e-60   Populus tomentosa [Chinese white poplar]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  182   1e-60   Vitis vinifera
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     182   1e-60   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    181   1e-60   
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     184   1e-60   Populus tomentosa [Chinese white poplar]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                182   1e-60   Eucalyptus grandis [rose gum]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     184   1e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     184   1e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     184   1e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     184   2e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    183   2e-60   Catharanthus roseus [chatas]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              183   2e-60   Populus trichocarpa [western balsam poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
gb|EPS72602.1|  adenosylhomocysteinase                                  177   2e-60   Genlisea aurea
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     183   2e-60   Populus tomentosa [Chinese white poplar]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   181   2e-60   Populus tomentosa [Chinese white poplar]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  181   2e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    183   2e-60   Gossypium raimondii
gb|KJB72024.1|  hypothetical protein B456_011G154000                    183   2e-60   Gossypium raimondii
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   182   2e-60   Populus tomentosa [Chinese white poplar]
gb|KHG17040.1|  Adenosylhomocysteinase                                  183   2e-60   Gossypium arboreum [tree cotton]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   181   2e-60   Populus tomentosa [Chinese white poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    180   2e-60   Lupinus luteus
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    180   2e-60   Lupinus luteus
dbj|BAE71233.1|  putative adenosylhomocysteinase                        181   3e-60   Trifolium pratense [peavine clover]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   180   3e-60   Populus tomentosa [Chinese white poplar]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         181   3e-60   Jatropha curcas
ref|XP_003629610.1|  Adenosylhomocysteinase                             181   3e-60   Medicago truncatula
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                180   3e-60   Solanum tuberosum [potatoes]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   182   3e-60   Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  182   3e-60   Populus euphratica
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  184   3e-60   
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              180   3e-60   Populus trichocarpa [western balsam poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     182   3e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
emb|CDY50106.1|  BnaC01g43540D                                          176   4e-60   Brassica napus [oilseed rape]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    182   4e-60   Gossypium raimondii
gb|ACN40278.1|  unknown                                                 180   4e-60   Picea sitchensis
gb|ABR16547.1|  unknown                                                 180   4e-60   Picea sitchensis
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              181   4e-60   Allium cepa
gb|ABR17322.1|  unknown                                                 180   4e-60   Picea sitchensis
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     180   4e-60   Nicotiana tabacum [American tobacco]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             180   4e-60   Eutrema salsugineum [saltwater cress]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
gb|ABR16573.1|  unknown                                                 180   4e-60   Picea sitchensis
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     182   4e-60   Populus tomentosa [Chinese white poplar]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    181   4e-60   Medicago sativa [alfalfa]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   182   4e-60   Populus tomentosa [Chinese white poplar]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                180   4e-60   Brassica rapa
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   179   4e-60   Populus tomentosa [Chinese white poplar]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  179   4e-60   Fragaria vesca subsp. vesca
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        180   4e-60   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             186   5e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  184   5e-60   Gossypium arboreum [tree cotton]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     182   5e-60   Populus tomentosa [Chinese white poplar]
emb|CDX77483.1|  BnaA07g06210D                                          179   5e-60   
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             183   6e-60   Elaeis guineensis
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  179   6e-60   Malus domestica [apple tree]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     179   6e-60   Cucumis sativus [cucumbers]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   179   6e-60   Populus tomentosa [Chinese white poplar]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    179   6e-60   Pinus pinaster [cluster pine]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   179   6e-60   Populus tomentosa [Chinese white poplar]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    181   7e-60   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  181   7e-60   Gossypium arboreum [tree cotton]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     183   7e-60   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     181   7e-60   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-60   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   182   8e-60   Populus tomentosa [Chinese white poplar]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             179   1e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19670.1|  AT4G13940                                              180   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               185   1e-59   Oryza sativa Japonica Group [Japonica rice]
gb|ABR16138.1|  unknown                                                 180   1e-59   Picea sitchensis
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   178   1e-59   Populus tomentosa [Chinese white poplar]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             182   1e-59   Selaginella moellendorffii
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   178   1e-59   Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  184   1e-59   
ref|NP_001031628.1|  adenosylhomocysteinase 1                           202   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     180   2e-59   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     180   2e-59   Populus tomentosa [Chinese white poplar]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             181   2e-59   Cicer arietinum [garbanzo]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     180   2e-59   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  183   2e-59   Phoenix dactylifera
ref|XP_003601687.1|  Adenosylhomocysteinase                             181   2e-59   Medicago truncatula
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     179   3e-59   Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           177   3e-59   Camelina sativa [gold-of-pleasure]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       177   3e-59   Arabidopsis thaliana [mouse-ear cress]
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    183   3e-59   Phalaenopsis sp.
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                177   3e-59   Camelina sativa [gold-of-pleasure]
ref|NP_189023.1|  adenosylhomocysteinase 2                              177   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             177   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    177   3e-59   Camelina sativa [gold-of-pleasure]
emb|CDP15078.1|  unnamed protein product                                182   3e-59   Coffea canephora [robusta coffee]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    177   4e-59   Arabis alpina [alpine rockcress]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             180   4e-59   Cucumis melo [Oriental melon]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             179   4e-59   Sesamum indicum [beniseed]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        180   4e-59   Kalanchoe daigremontiana
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             179   4e-59   Sesamum indicum [beniseed]
emb|CDY53211.1|  BnaC03g74050D                                          176   9e-59   Brassica napus [oilseed rape]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     177   1e-58   Populus tomentosa [Chinese white poplar]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        175   1e-58   Cicer arietinum [garbanzo]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      177   1e-58   Gossypium hirsutum [American cotton]
gb|AGT16642.1|  Adenosylhomocysteinase                                  181   1e-58   Saccharum hybrid cultivar R570
ref|XP_001755926.1|  predicted protein                                  177   1e-58   
ref|XP_001755906.1|  predicted protein                                  177   1e-58   
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             181   1e-58   Setaria italica
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       182   1e-58   Nicotiana suaveolens
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             181   1e-58   Setaria italica
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    181   2e-58   
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     177   2e-58   Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    180   2e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             181   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             185   3e-58   Oryza brachyantha
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     176   3e-58   Populus tomentosa [Chinese white poplar]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                178   4e-58   
ref|NP_001234012.1|  adenosylhomocysteinase                             173   4e-58   
ref|NP_001148534.1|  adenosylhomocysteinase                             181   4e-58   
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                177   4e-58   Brassica rapa
gb|ACN34730.1|  unknown                                                 181   4e-58   Zea mays [maize]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             174   7e-58   Phaseolus vulgaris [French bean]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             176   8e-58   Cucumis sativus [cucumbers]
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        181   8e-58   
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    176   8e-58   
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             180   1e-57   Elaeis guineensis
ref|XP_001755929.1|  predicted protein                                  174   1e-57   
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  178   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             178   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    170   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB19538.1|  hypothetical protein B456_003G108500                    172   5e-57   Gossypium raimondii
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     181   4e-56   Eucalyptus grandis [rose gum]
gb|KIZ05177.1|  adenosylhomocysteinase                                  178   4e-55   Monoraphidium neglectum
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                     163   6e-55   Campanula persicifolia [peach-bells]
ref|NP_001067845.2|  Os11g0455500                                       167   3e-54   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      172   4e-52   Polytomella sp. Pringsheim 198.80
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     159   4e-52   Eucalyptus grandis [rose gum]
ref|XP_010024046.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    182   7e-52   Eucalyptus grandis [rose gum]
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                     153   1e-51   Zea mays [maize]
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                174   1e-51   Chlorella variabilis
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       166   2e-51   Chlamydomonas sp. ICE-L
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  168   3e-51   Chlamydomonas reinhardtii
ref|XP_001756025.1|  predicted protein                                  152   5e-51   
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                     149   1e-50   Clermontia kakeana
ref|XP_011397211.1|  Adenosylhomocysteinase                             163   1e-50   Auxenochlorella protothecoides
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       166   2e-50   Dunaliella salina
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     157   2e-50   Eucalyptus grandis [rose gum]
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              166   2e-50   Volvox carteri f. nagariensis
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      164   5e-50   Chlamydomonas incerta
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     153   9e-50   Helicosporidium sp. ATCC 50920
gb|ABR16332.1|  unknown                                                 150   1e-49   Picea sitchensis
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  162   1e-49   Coccomyxa subellipsoidea C-169
dbj|BAA03710.1|  cytokinin binding protein CBP57                        142   5e-49   Nicotiana sylvestris
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    147   6e-48   Eucalyptus grandis [rose gum]
ref|XP_005708566.1|  adenosylhomocysteinase                             154   1e-47   Galdieria sulphuraria
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             144   2e-47   Oryza sativa Japonica Group [Japonica rice]
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    163   2e-47   Ostreococcus tauri
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             144   3e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001419579.1|  predicted protein                                  160   4e-47   Ostreococcus lucimarinus CCE9901
ref|WP_027472887.1|  adenosylhomocysteinase                             144   2e-46   Saccharicrinis fermentans
gb|EKD42945.1|  hypothetical protein ACD_72C00527G0002                  140   3e-46   uncultured bacterium
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     138   3e-46   Petunia x hybrida [garden petunia]
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     144   4e-46   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   146   2e-45   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        145   3e-45   
gb|KFH13893.1|  putative adenosylhomocysteinase                         145   3e-45   
gb|EPR62066.1|  putative adenosylhomocysteinase                         145   3e-45   
gb|KFG55060.1|  putative adenosylhomocysteinase                         145   3e-45   
gb|ESS32583.1|  putative adenosylhomocysteinase                         145   3e-45   
gb|KFG42936.1|  putative adenosylhomocysteinase                         145   3e-45   
ref|XP_002177758.1|  adenosylhomocysteinase                             157   4e-45   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   145   4e-45   
ref|WP_029018156.1|  hypothetical protein                               149   5e-45   
ref|XP_002505983.1|  adenosylhomocysteinase                             154   5e-45   
ref|XP_010024042.1|  PREDICTED: adenosylhomocysteinase-like             164   6e-45   
gb|KJB72029.1|  hypothetical protein B456_011G154000                    132   6e-45   
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                149   8e-45   
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                149   8e-45   
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             154   1e-44   
ref|WP_044107885.1|  adenosylhomocysteinase                             138   1e-44   
ref|XP_001423621.1|  hypothetical protein                               146   1e-44   
ref|WP_033354750.1|  hypothetical protein                               148   2e-44   
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 148   2e-44   
ref|XP_008611237.1|  adenosylhomocysteinase                             153   2e-44   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           143   2e-44   
ref|WP_043962062.1|  adenosylhomocysteinase                             140   2e-44   
ref|XP_008893590.1|  adenosylhomocysteinase                             152   3e-44   
ref|WP_031077053.1|  hypothetical protein                               147   3e-44   
gb|ABR16616.1|  unknown                                                 127   3e-44   
ref|WP_007074914.1|  S-adenosyl-L-homocysteine hydrolase                140   3e-44   
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 148   4e-44   
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               145   4e-44   
ref|XP_003057172.1|  adenosylhomocysteinase                             153   4e-44   
ref|WP_030572588.1|  adenosylhomocysteinase                             145   4e-44   
ref|WP_037910293.1|  adenosylhomocysteinase                             145   4e-44   
ref|WP_037787267.1|  hypothetical protein                               148   5e-44   
emb|CCA20123.1|  unnamed protein product                                152   5e-44   
ref|WP_027734715.1|  adenosylhomocysteinase                             145   5e-44   
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    145   5e-44   
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                146   5e-44   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           152   5e-44   
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                146   5e-44   
ref|WP_031509769.1|  adenosylhomocysteinase                             145   6e-44   
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                146   6e-44   
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                146   6e-44   
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                146   7e-44   
dbj|BAH40894.1|  adenosylhomocysteinase                                 140   7e-44   
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                148   8e-44   
ref|WP_030155670.1|  hypothetical protein                               144   8e-44   
ref|WP_030998790.1|  adenosylhomocysteinase                             147   8e-44   
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       148   9e-44   
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                147   1e-43   
ref|WP_007822968.1|  S-adenosyl-L-homocysteine hydrolase                147   1e-43   
ref|WP_008746056.1|  S-adenosyl-L-homocysteine hydrolase                147   1e-43   
ref|WP_013731725.1|  S-adenosyl-L-homocysteine hydrolase                138   1e-43   
ref|WP_009068214.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    147   1e-43   
ref|WP_030310801.1|  hypothetical protein                               147   1e-43   
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 146   1e-43   
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                146   1e-43   
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                144   1e-43   
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                146   1e-43   
ref|WP_044347377.1|  adenosylhomocysteinase                             147   1e-43   
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                144   1e-43   
ref|WP_010420190.1|  S-adenosyl-L-homocysteine hydrolase                136   1e-43   
ref|WP_010662080.1|  S-adenosyl-L-homocysteine hydrolase                136   1e-43   
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                141   1e-43   
ref|WP_033824956.1|  hypothetical protein                               145   1e-43   
ref|WP_030245490.1|  hypothetical protein                               146   2e-43   
ref|WP_030672749.1|  adenosylhomocysteinase                             143   2e-43   
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                143   2e-43   
ref|WP_027357796.1|  adenosylhomocysteinase                             141   2e-43   
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase                148   2e-43   
gb|KGA09210.1|  adenosylhomocysteinase                                  142   2e-43   
gb|AFY99086.1|  S-adenosyl-l-homocysteine hydrolase                     125   2e-43   
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                145   2e-43   
ref|WP_033364626.1|  hypothetical protein                               142   2e-43   
ref|WP_031519542.1|  adenosylhomocysteinase                             147   2e-43   
ref|WP_030363261.1|  MULTISPECIES: adenosylhomocysteinase               143   2e-43   
emb|CAL34094.1|  putative adenosylhomocysteinase                        145   2e-43   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           150   2e-43   
ref|XP_002776364.1|  adenosylhomocysteinase, putative                   142   2e-43   
ref|XP_002788757.1|  conserved hypothetical protein                     141   2e-43   
ref|WP_028429456.1|  adenosylhomocysteinase                             145   3e-43   
ref|WP_042156564.1|  adenosylhomocysteinase                             142   3e-43   
ref|WP_006605245.1|  S-adenosyl-L-homocysteine hydrolase                142   3e-43   
ref|WP_030266050.1|  adenosylhomocysteinase                             142   3e-43   
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                145   3e-43   
gb|ADE53810.1|  adenosylhomocysteinase                                  142   3e-43   
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                143   3e-43   
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                138   3e-43   
ref|WP_016642080.1|  putative Adenosylhomocysteinase                    142   3e-43   
ref|WP_041744815.1|  S-adenosyl-L-homocysteine hydrolase                142   3e-43   
ref|WP_030350966.1|  adenosylhomocysteinase                             142   4e-43   
ref|WP_039635900.1|  adenosylhomocysteinase                             142   4e-43   
ref|WP_003960672.1|  S-adenosyl-L-homocysteine hydrolase                140   4e-43   
ref|WP_026206556.1|  adenosylhomocysteinase                             149   4e-43   
ref|WP_017575237.1|  S-adenosyl-L-homocysteine hydrolase                142   4e-43   
ref|WP_020252885.1|  hypothetical protein                               141   4e-43   
ref|WP_033326694.1|  adenosylhomocysteinase                             142   4e-43   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  143   4e-43   
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                142   4e-43   
ref|WP_031065684.1|  adenosylhomocysteinase                             142   4e-43   
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                144   4e-43   
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    141   4e-43   
ref|WP_033266625.1|  adenosylhomocysteinase                             143   4e-43   
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                144   4e-43   
ref|WP_023550043.1|  S-adenosyl-L-homocysteine hydrolase                140   4e-43   
ref|WP_030816232.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_030018045.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase                142   5e-43   
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                142   5e-43   
ref|WP_031013219.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_035848617.1|  hypothetical protein                               144   5e-43   
ref|WP_030793284.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_029384937.1|  MULTISPECIES: adenosylhomocysteinase               140   5e-43   
ref|WP_033173798.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_037628275.1|  adenosylhomocysteinase                             142   5e-43   
ref|WP_030635830.1|  adenosylhomocysteinase                             141   5e-43   
gb|AJD20014.1|  S-adenosyl-L-homocysteine hy-drolase                    146   5e-43   
ref|WP_030374685.1|  MULTISPECIES: adenosylhomocysteinase               141   6e-43   
ref|WP_003985902.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    141   6e-43   
ref|WP_030676096.1|  adenosylhomocysteinase                             141   6e-43   
ref|WP_030644233.1|  adenosylhomocysteinase                             141   6e-43   
ref|WP_030594860.1|  adenosylhomocysteinase                             141   6e-43   
ref|WP_043501387.1|  adenosylhomocysteinase                             142   6e-43   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   155   6e-43   
ref|WP_018533659.1|  S-adenosyl-L-homocysteine hydrolase                141   6e-43   
ref|WP_037954273.1|  adenosylhomocysteinase                             142   6e-43   
ref|WP_028810729.1|  adenosylhomocysteinase                             141   7e-43   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                146   7e-43   
ref|WP_030742429.1|  adenosylhomocysteinase                             141   7e-43   
ref|WP_030802969.1|  MULTISPECIES: adenosylhomocysteinase               141   7e-43   
ref|WP_044363456.1|  adenosylhomocysteinase                             142   7e-43   
ref|WP_030723207.1|  adenosylhomocysteinase                             141   7e-43   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                144   7e-43   
ref|WP_041266969.1|  adenosylhomocysteinase                             140   7e-43   
ref|WP_030331527.1|  adenosylhomocysteinase                             139   8e-43   
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                140   8e-43   
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    143   8e-43   
ref|WP_020940427.1|  S-adenosyl-L-homocysteine hydrolase                141   9e-43   
ref|WP_018087062.1|  S-adenosyl-L-homocysteine hydrolase                142   9e-43   
ref|WP_030603770.1|  adenosylhomocysteinase                             141   9e-43   
ref|WP_030417229.1|  adenosylhomocysteinase                             142   9e-43   
ref|WP_017604622.1|  S-adenosyl-L-homocysteine hydrolase                143   9e-43   
ref|WP_038519785.1|  adenosylhomocysteinase                             143   1e-42   
ref|WP_030250255.1|  MULTISPECIES: adenosylhomocysteinase               141   1e-42   
ref|WP_028072996.1|  hypothetical protein                               141   1e-42   
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    157   1e-42   
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                140   1e-42   
ref|WP_030837066.1|  adenosylhomocysteinase                             141   1e-42   
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                135   1e-42   
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                142   1e-42   
gb|EEB33178.1|  adenosylhomocysteinase                                  135   1e-42   
ref|WP_030282304.1|  adenosylhomocysteinase                             142   1e-42   
ref|WP_010527565.1|  S-adenosyl-L-homocysteine hydrolase                134   1e-42   
ref|WP_018721087.1|  S-adenosyl-L-homocysteine hydrolase                140   1e-42   
ref|WP_030993673.1|  adenosylhomocysteinase                             142   1e-42   
ref|WP_037837039.1|  adenosylhomocysteinase                             140   1e-42   
ref|WP_019356875.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    142   1e-42   
ref|WP_027739704.1|  adenosylhomocysteinase                             140   1e-42   
ref|WP_044574415.1|  adenosylhomocysteinase                             140   1e-42   
ref|WP_007499603.1|  S-adenosyl-L-homocysteine hydrolase                140   1e-42   
ref|WP_030623890.1|  adenosylhomocysteinase                             142   1e-42   
ref|WP_037605447.1|  hypothetical protein                               141   1e-42   
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                142   1e-42   
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    127   1e-42   
ref|WP_016472770.1|  MULTISPECIES: adenosylhomocysteinase               140   1e-42   
ref|WP_014155919.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    140   1e-42   
ref|WP_004000737.1|  putative Adenosylhomocysteinase                    140   2e-42   
ref|WP_017585142.1|  S-adenosyl-L-homocysteine hydrolase                142   2e-42   
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_028436987.1|  adenosylhomocysteinase                             142   2e-42   
ref|WP_020137950.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_007511841.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_031050199.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_027763965.1|  adenosylhomocysteinase                             142   2e-42   
ref|WP_030543976.1|  adenosylhomocysteinase                             142   2e-42   
ref|WP_030404302.1|  MULTISPECIES: adenosylhomocysteinase               140   2e-42   
gb|EST38030.1|  hypothetical protein N566_09650                         142   2e-42   
ref|WP_032787207.1|  adenosylhomocysteinase                             141   2e-42   
ref|WP_043440795.1|  adenosylhomocysteinase                             139   2e-42   
ref|WP_007460887.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_035277573.1|  adenosylhomocysteinase                             140   2e-42   
gb|KIZ22480.1|  adenosylhomocysteinase                                  140   2e-42   
ref|WP_024886447.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_031481220.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_009996356.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_030365247.1|  adenosylhomocysteinase                             142   2e-42   
ref|WP_040623224.1|  adenosylhomocysteinase                             137   2e-42   
ref|WP_030497957.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_030447842.1|  hypothetical protein                               142   2e-42   
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_030700076.1|  adenosylhomocysteinase                             141   2e-42   
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                142   2e-42   
ref|WP_032784234.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_032769603.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_023417428.1|  S-adenosyl-L-homocysteine hydrolase                141   2e-42   
ref|WP_003968738.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    140   2e-42   
ref|WP_030681104.1|  MULTISPECIES: adenosylhomocysteinase               140   2e-42   
ref|WP_010059945.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_027585853.1|  adenosylhomocysteinase                             131   2e-42   
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                142   2e-42   
ref|WP_005221374.1|  S-adenosyl-L-homocysteine hydrolase                141   2e-42   
ref|WP_037677242.1|  adenosylhomocysteinase                             139   2e-42   
ref|WP_030451260.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_003957148.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_030119663.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_027721098.1|  adenosylhomocysteinase                             136   2e-42   
ref|WP_030593735.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_019065449.1|  S-adenosyl-L-homocysteine hydrolase                140   2e-42   
ref|WP_006125011.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    140   2e-42   
ref|WP_033286660.1|  adenosylhomocysteinase                             140   2e-42   
ref|WP_023421854.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    141   2e-42   
ref|WP_030759761.1|  adenosylhomocysteinase                             139   3e-42   
ref|WP_016436303.1|  adenosylhomocysteinase                             140   3e-42   
ref|WP_003950444.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    141   3e-42   
ref|WP_030199703.1|  MULTISPECIES: adenosylhomocysteinase               139   3e-42   
ref|WP_030927023.1|  adenosylhomocysteinase                             139   3e-42   
ref|WP_030337328.1|  adenosylhomocysteinase                             139   3e-42   
ref|WP_030977071.1|  adenosylhomocysteinase                             139   3e-42   



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   201 bits (512),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   201 bits (512),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   198 bits (504),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDS  103


 Score = 80.5 bits (197),  Expect(2) = 3e-66, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   201 bits (512),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 76.6 bits (187),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPG GPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGAGPDLIVD  138



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   200 bits (509),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 77.0 bits (188),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   202 bits (513),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 75.5 bits (184),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWG GGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGTGGGPDLIVD  138



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDS
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   195 bits (495),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDS
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   186 bits (471),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  168  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  197


 Score = 85.5 bits (210),  Expect(2) = 6e-64, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  209  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  241



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   197 bits (501),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +V+KTS GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDS
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDS  103


 Score = 73.2 bits (178),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE++LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEKSLDWGAGGGPDLIVD  138



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   194 bits (492),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMS ADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 75.9 bits (185),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   189 bits (480),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   193 bits (490),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V KTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 74.3 bits (181),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLDWGPAGGPDLIVD  138



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   189 bits (480),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/99 (95%), Positives = 98/99 (99%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   183 bits (465),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDM+QADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  127  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  156


 Score = 84.0 bits (206),  Expect(2) = 8e-63, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  168  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  200



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   189 bits (479),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KT++GREYKVKDMSQADFGRLE+ LAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARD  383
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARD  102


 Score = 76.3 bits (186),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   182 bits (463),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+ GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 82.4 bits (202),  Expect(2) = 4e-62, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   188 bits (478),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/99 (94%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 76.3 bits (186),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPSGGPDLIVD  138



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   182 bits (461),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 82.4 bits (202),  Expect(2) = 6e-62, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   186 bits (471),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   180 bits (456),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  87   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  116


 Score = 84.0 bits (206),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  128  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  160



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   186 bits (473),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK++SGRE+KVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 77.0 bits (188),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEKALDWGPGGGPDLIVD  138



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   185 bits (470),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   186 bits (472),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK++SGRE+KVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 77.0 bits (188),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEKALDWGPGGGPDLIVD  138



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   186 bits (472),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK++SGRE+KVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 77.0 bits (188),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEKALDWGPGGGPDLIVD  138



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   185 bits (469),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.6 bits (192),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   185 bits (469),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.6 bits (192),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/99 (93%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDM+QADFGRLE+ LAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   184 bits (467),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   184 bits (467),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   184 bits (467),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  154  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  183


 Score = 77.8 bits (190),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  195  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  227



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   185 bits (469),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 99/100 (99%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +V+K++SGRE+KVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 77.0 bits (188),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEKALDWGPGGGPDLIVD  138



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   184 bits (467),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   183 bits (465),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   182 bits (461),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KT++GREYKVKDMSQADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  141  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  170


 Score = 79.7 bits (195),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  182  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  214



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   183 bits (465),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   184 bits (466),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   183 bits (465),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   183 bits (465),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   183 bits (465),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   183 bits (465),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTS GREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   183 bits (464),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   183 bits (465),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   183 bits (464),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+ GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   183 bits (464),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   183 bits (464),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP QPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   183 bits (464),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+ GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   182 bits (463),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   182 bits (463),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   182 bits (462),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   182 bits (462),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   182 bits (462),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   186 bits (471),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLDWGPAGGPDLIVD  138



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.6 bits (192),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   184 bits (468),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.5 bits (184),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWG GGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGAGGGPDLIVD  138



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            +QTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            TVEKT+SGREYKVKDMS ADFGRLEL LAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQT VLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   181 bits (460),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   184 bits (466),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+ GREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   184 bits (466),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   184 bits (466),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   184 bits (466),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   184 bits (466),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+H
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQEH  94


 Score = 76.3 bits (186),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   177 bits (448),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT++GRE+KVKDMSQADFGRLE+ LAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87   VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  147  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  176


 Score = 82.4 bits (202),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  188  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  220



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   181 bits (459),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   181 bits (458),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  66   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  96


 Score = 78.2 bits (191),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  108  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  140



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   183 bits (465),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   183 bits (464),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.6 bits (187),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAW+GETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWEGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   183 bits (464),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   181 bits (458),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQA+FGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   180 bits (457),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  68   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  97


 Score = 78.6 bits (192),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  109  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  141



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   180 bits (457),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.6 bits (192),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   181 bits (458),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            TVEKT++GREYKVKD+SQADFGRLE+ LAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   180 bits (457),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTA LIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAALIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   181 bits (458),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+ GREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   181 bits (458),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            TVEKT +GREYKV+D+SQADFGRLE+ LAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   180 bits (457),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.6 bits (192),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.3 bits (186),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDW PGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWSPGGGPDLIVD  138



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   184 bits (467),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLDWGPAGGPDLIVD  138



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   180 bits (457),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGR YKVKD+SQADFGRLE+ LAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   176 bits (446),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 82.0 bits (201),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   182 bits (461),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.6 bits (187),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   180 bits (457),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETL ALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   180 bits (457),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETL ALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   181 bits (458),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.4 bits (189),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETL ALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +3

Query  96   KTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  275
            KT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  276  TAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  61   TAVLIETLTALGAEVRWCSCNIFSTQDH  88


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  100  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  132



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETL ALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (462),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   181 bits (460),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VE T+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.6 bits (187),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWC+ERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCSERALDWGPGGGPDLIVD  138



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (461),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            +QTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.3 bits (186),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPSGGPDLIVD  138



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   180 bits (457),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   179 bits (455),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   179 bits (455),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK SSGREYKVKDMSQADFGRLE+ LAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   180 bits (456),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   186 bits (471),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 87/91 (96%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLEL LAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.0 bits (175),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGAGGGPDLIVD  138



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   184 bits (467),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 95/99 (96%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V +T++GRE+KVKD++QADFGRLE+ LAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDS  103


 Score = 73.6 bits (179),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTE+AL+WGPGGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTEKALEWGPGGGPDLIVD  138



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   182 bits (461),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKV+DMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   179 bits (455),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   183 bits (465),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLDWGPAGGPDLIVD  138



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   179 bits (455),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEK+SSGREYKVKDMSQADFGRLE+ LAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   179 bits (455),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT++GRE KVKDMSQADFGRLE+ LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   179 bits (454),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGR YKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   179 bits (454),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGRE+KVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   179 bits (454),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQ H
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQGH  94


 Score = 78.2 bits (191),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   183 bits (465),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 73.6 bits (179),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDL VD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLTVD  138



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   181 bits (460),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.7 bits (182),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALD GPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDRGPGGGPDLIVD  138



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   182 bits (463),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWW TERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWSTERALDWGPGGGPDLIVD  138



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   179 bits (453),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   180 bits (456),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRL L LAEVEMPGLMACR  FGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.0 bits (188),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   185 bits (469),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 71.6 bits (174),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGVGGGPDLIVD  138



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   180 bits (457),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            EKT SGREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            QTAVLIETL ALGAEVRWCSCNIFSTQDH
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDH  94


 Score = 76.3 bits (186),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIV+
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVN  138



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   178 bits (451),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   182 bits (463),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 73.6 bits (179),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGE LQEYWWCTERALDWG GGGPDLIVD
Sbjct  106  VFAWKGENLQEYWWCTERALDWGVGGGPDLIVD  138



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   178 bits (451),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEV WCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVPWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   184 bits (467),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.0 bits (175),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGAGGGPDLIVD  138



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/99 (97%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDS  103



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   180 bits (457),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVL ETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLTETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   180 bits (456),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   181 bits (460),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VE T+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWC+ERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCSERALDWGPTGGPDLIVD  138



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   180 bits (456),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   183 bits (464),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLEL LAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.8 bits (177),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER L+WGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLEWGPAGGPDLIVD  138



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   181 bits (460),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VE T+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 73.9 bits (180),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWC+ERALDWG GGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCSERALDWGTGGGPDLIVD  138



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   179 bits (455),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGA VRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAGVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   177 bits (449),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   177 bits (449),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   183 bits (465),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 71.6 bits (174),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER L+WG GGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERCLEWGAGGGPDLIVD  138



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   177 bits (449),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   177 bits (449),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   177 bits (449),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   177 bits (448),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   182 bits (462),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGA VRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGASVRWCSCNIFSTQDH  94


 Score = 72.8 bits (177),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWG  GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGSEGGPDLIVD  138



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   177 bits (448),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   180 bits (457),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KTS+GREYKVKDM+QADFGRLE+ LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER+LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERSLDWGPEGGPDLIVD  138



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   179 bits (453),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   180 bits (457),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFS+QDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSSQDH  94


 Score = 74.3 bits (181),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLI D
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPSGGPDLIFD  138



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   179 bits (453),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   176 bits (445),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 77.8 bits (190),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   177 bits (450),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCS NIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSRNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   175 bits (444),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT++GREYKVKD+SQADFGRLE+ LAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   177 bits (450),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT++GREYKVKDMSQADFGRLE+ LAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQ  353
            TIQTAVLIETLTALGAEVRWCSCNIFSTQ
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQ  92


 Score = 75.9 bits (185),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPTGGPDLIVD  138



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   181 bits (459),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.0 bits (175),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEGGGPDLIVD  138



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   177 bits (449),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+SGREYKV+DMSQADFGRLEL LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   177 bits (449),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+SGREYKV+DMSQADFGRLEL LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   181 bits (458),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.0 bits (175),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEGGGPDLIVD  138



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   182 bits (461),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFG LE+ LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDSGRRLRLE  407
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS    R+E
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVE  110


 Score = 71.2 bits (173),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VF  +GETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFRVEGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   181 bits (458),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 72.0 bits (175),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEGGGPDLIVD  138



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   181 bits (459),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSC IFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCXIFSTQDH  94


 Score = 71.6 bits (174),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGVGGGPDLIVD  138



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   177 bits (448),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQ  353
            IQTAVLIETLTALGAEVRWCSCNIFSTQ
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQ  92


 Score = 75.9 bits (185),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   180 bits (457),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+ QADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDH  94


 Score = 71.6 bits (174),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGVGGGPDLIVD  138



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   181 bits (459),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTS+GREYKVKD+SQADFGRLE+ LAEVEMPGLM+CRAEFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 70.9 bits (172),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL EYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLAEYWWCTERCLDWGPTGGPDLIVD  138



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   185 bits (469),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/91 (95%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 67.0 bits (162),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWW TER LDWG GGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWGTERCLDWGVGGGPDLIVD  138



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   176 bits (446),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQ  353
            IQTAVLIETLTALGAEVRWCSCNIFSTQ
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQ  92


 Score = 75.9 bits (185),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   178 bits (452),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            T+ +T +GREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDS
Sbjct  64   TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDS  103


 Score = 73.2 bits (178),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTE+AL+WGPGGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTEKALEWGPGGGPDLIVD  138



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   173 bits (439),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKT+SGREYKVKDMSQADFGRLE+ LAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTA LIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAFLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 78.2 bits (191),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  138



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   181 bits (459),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 70.1 bits (170),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG  GGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEAGGPDLIVD  138



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   177 bits (449),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMSQADFGRLE+ LAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLI D
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPGGGPDLIGD  138



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   181 bits (459),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 70.5 bits (171),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG  GGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEAGGPDLIVD  138



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   174 bits (441),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKDMS ADFGR+E+ LAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 76.3 bits (186),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   176 bits (446),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KTS+GREYKVKDM+QADFGRLE+ LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER+LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERSLDWGPEGGPDLIVD  138



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   181 bits (458),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 69.7 bits (169),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTER LDWG  GGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTERCLDWGEAGGPDLIVD  138



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   176 bits (446),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            V+KTS+GREYKVKDM+QADFGRLE+ LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 74.3 bits (181),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTER+LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERSLDWGPEGGPDLIVD  138



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   180 bits (456),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTSSGREYKVKD+SQADFGRLE+ LAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 70.1 bits (170),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTE+ LDWG  GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTEQCLDWGAAGGPDLIVD  138



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   174 bits (441),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            +VEKT+SGREYKV+DMSQADFGRLEL LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLI+TLT LGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDH  94


 Score = 75.9 bits (185),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGP GGPDLIVD
Sbjct  106  VFAWKGETLQEYWWCTERALDWGPDGGPDLIVD  138



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   178 bits (452),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTS+GREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 71.2 bits (173),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL EYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLAEYWWCTERCLDWGPNGGPDLIVD  138



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   178 bits (451),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 82/90 (91%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  90   VEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  269
            VEKTS+GREYKVKD+SQADFGRLE+ LAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  270  IQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            IQTAVLIE+LTALGAEVRWCSCNIFSTQDH
Sbjct  65   IQTAVLIESLTALGAEVRWCSCNIFSTQDH  94


 Score = 71.6 bits (174),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL EYWWCTER LDWGP GGPDLIVD
Sbjct  106  VFAWKGETLAEYWWCTERCLDWGPAGGPDLIVD  138



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   170 bits (431),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 80/85 (94%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +3

Query  132  MSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  311
            MSQADFGRLEL LAEVEMPGLMACR EFGPSQPFKGARITGSLHMTIQTAVLIETLTALG
Sbjct  1    MSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  60

Query  312  AEVRWCSCNIFSTQDHAAAAVARDS  386
            A+VRWCSCNIFSTQDHA AA+ARDS
Sbjct  61   AQVRWCSCNIFSTQDHARAAIARDS  85


 Score = 78.2 bits (191),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  88   VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   172 bits (437),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +3

Query  87   TVEKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  266
            TV +T++GRE+KVKD++QADFGRLE+ LAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  267  TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  359
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDH
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDH  94


 Score = 75.1 bits (183),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTE+ALDWGPGGGPDLIVD
Sbjct  106  VFAWKGETLEEYWWCTEKALDWGPGGGPDLIVD  138



>gb|KCW60457.1| hypothetical protein EUGRSUZ_H03177 [Eucalyptus grandis]
Length=465

 Score =   181 bits (458),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            E+T+SGREYKVKDMSQADFGRLE+ LAEV+MP LM+CR+ FGPSQP KGARITGS+HMTI
Sbjct  6    ERTASGREYKVKDMSQADFGRLEIQLAEVQMPALMSCRSVFGPSQPLKGARITGSVHMTI  65

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDSGRRLRLERGDSP  422
            QTAVLIETLTALGAE RWCSCN FSTQDHAAA +ARDS       +G++P
Sbjct  66   QTAVLIETLTALGAEARWCSCNTFSTQDHAAAVIARDSAAVFA-PKGETP  114


 Score = 63.9 bits (154),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIV  489
            VFA KGET QEYWWC ERAL+WGPGGGPDLIV
Sbjct  106  VFAPKGETPQEYWWCIERALEWGPGGGPDLIV  137



>gb|KIZ05177.1| adenosylhomocysteinase [Monoraphidium neglectum]
Length=1031

 Score =   178 bits (452),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +3

Query  93   EKTSSGREYKVKDMSQADFGRLELXLAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  272
            E+ +SGRE+KVKD+++ADFGRLE+ LAE EMPGLMACR EFGPSQPFKG RI GSLHMTI
Sbjct  553  EQGASGREFKVKDINEADFGRLEIELAEAEMPGLMACRDEFGPSQPFKGTRIAGSLHMTI  612

Query  273  QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAVARDS  386
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAA+A+ARDS
Sbjct  613  QTAVLIETLVALGAEVRWCSCNIFSTQDHAASAIARDS  650


 Score = 62.8 bits (151),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  394  VFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  492
            VFAWKGETL+EYWWCTE+AL W  G G DL+VD
Sbjct  653  VFAWKGETLEEYWWCTEQALTWPDGEGADLLVD  685



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780