BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034I09

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588400.1|  PREDICTED: histidine protein methyltransfera...    179   2e-51   Nicotiana tomentosiformis
ref|XP_009781246.1|  PREDICTED: uncharacterized protein LOC104230205    179   3e-51   Nicotiana sylvestris
ref|XP_007034061.1|  S-adenosyl-L-methionine-dependent methyltran...    175   1e-49   
gb|KJB27983.1|  hypothetical protein B456_005G020100                    170   4e-48   Gossypium raimondii
ref|XP_002534114.1|  conserved hypothetical protein                     171   4e-48   Ricinus communis
gb|KJB27982.1|  hypothetical protein B456_005G020100                    171   6e-48   Gossypium raimondii
ref|XP_009363653.1|  PREDICTED: histidine protein methyltransfera...    170   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_008453987.1|  PREDICTED: uncharacterized protein LOC103494545    170   1e-47   Cucumis melo [Oriental melon]
ref|XP_008372076.1|  PREDICTED: histidine protein methyltransfera...    169   1e-47   Malus domestica [apple tree]
ref|XP_009344374.1|  PREDICTED: histidine protein methyltransfera...    169   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_011037077.1|  PREDICTED: uncharacterized protein LOC105134384    169   4e-47   Populus euphratica
ref|XP_004152105.1|  PREDICTED: histidine protein methyltransfera...    167   8e-47   Cucumis sativus [cucumbers]
ref|XP_002264228.1|  PREDICTED: histidine protein methyltransfera...    167   1e-46   Vitis vinifera
ref|XP_006443065.1|  hypothetical protein CICLE_v10020882mg             167   1e-46   Citrus clementina [clementine]
gb|KHG16096.1|  Histidine methyltransferase 1                           167   1e-46   Gossypium arboreum [tree cotton]
ref|XP_006372889.1|  hypothetical protein POPTR_0017s06020g             167   2e-46   Populus trichocarpa [western balsam poplar]
gb|KDP42809.1|  hypothetical protein JCGZ_23751                         166   3e-46   Jatropha curcas
ref|XP_010097465.1|  hypothetical protein L484_024670                   165   8e-46   Morus notabilis
ref|XP_008222628.1|  PREDICTED: uncharacterized protein LOC103322485    164   1e-45   Prunus mume [ume]
gb|KJB71894.1|  hypothetical protein B456_011G146300                    163   3e-45   Gossypium raimondii
ref|XP_006858675.1|  hypothetical protein AMTR_s00066p00080930          161   2e-44   Amborella trichopoda
ref|XP_010912793.1|  PREDICTED: uncharacterized protein LOC105038627    161   2e-44   
ref|XP_004309612.1|  PREDICTED: histidine protein methyltransfera...    161   3e-44   Fragaria vesca subsp. vesca
ref|XP_006347281.1|  PREDICTED: histidine protein methyltransfera...    160   4e-44   Solanum tuberosum [potatoes]
ref|XP_010043656.1|  PREDICTED: uncharacterized protein LOC104432789    160   5e-44   Eucalyptus grandis [rose gum]
ref|XP_008791776.1|  PREDICTED: histidine protein methyltransfera...    160   8e-44   Phoenix dactylifera
ref|XP_008799945.1|  PREDICTED: histidine protein methyltransfera...    158   4e-43   Phoenix dactylifera
ref|XP_010930203.1|  PREDICTED: histidine protein methyltransfera...    158   4e-43   Elaeis guineensis
gb|KHG29074.1|  Histidine methyltransferase 1                           157   8e-43   Gossypium arboreum [tree cotton]
ref|XP_004241398.1|  PREDICTED: histidine protein methyltransfera...    156   2e-42   
ref|XP_009416014.1|  PREDICTED: histidine protein methyltransfera...    154   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002310441.1|  hypothetical protein POPTR_0007s02090g             154   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011026390.1|  PREDICTED: uncharacterized protein LOC105127016    148   1e-39   Populus euphratica
ref|XP_010242753.1|  PREDICTED: histidine protein methyltransfera...    145   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008798999.1|  PREDICTED: histidine protein methyltransfera...    145   3e-38   Phoenix dactylifera
ref|XP_010525954.1|  PREDICTED: uncharacterized protein LOC104803653    144   6e-38   Tarenaya hassleriana [spider flower]
ref|XP_009401143.1|  PREDICTED: histidine protein methyltransfera...    144   9e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907676.1|  PREDICTED: histidine protein methyltransfera...    142   4e-37   Elaeis guineensis
ref|XP_009405561.1|  PREDICTED: uncharacterized protein LOC103988679    142   5e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010520847.1|  PREDICTED: uncharacterized protein LOC104799618    137   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_010907675.1|  PREDICTED: histidine protein methyltransfera...    136   7e-35   Elaeis guineensis
ref|XP_003580042.1|  PREDICTED: histidine protein methyltransfera...    133   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_004957334.1|  PREDICTED: histidine protein methyltransfera...    132   2e-33   Setaria italica
gb|EMT24897.1|  hypothetical protein F775_32531                         131   4e-33   
ref|XP_002446718.1|  hypothetical protein SORBIDRAFT_06g021130          131   5e-33   Sorghum bicolor [broomcorn]
gb|EMS59379.1|  hypothetical protein TRIUR3_33843                       131   1e-32   Triticum urartu
gb|KDO43477.1|  hypothetical protein CISIN_1g018716mg                   130   1e-32   Citrus sinensis [apfelsine]
emb|CAH67536.1|  H0425E08.4                                             130   2e-32   Oryza sativa [red rice]
ref|NP_001053176.1|  Os04g0492400                                       130   2e-32   
ref|XP_004976058.1|  PREDICTED: uncharacterized protein LOC101755614    129   2e-32   Setaria italica
ref|XP_006652451.1|  PREDICTED: uncharacterized protein LOC102711251    128   7e-32   Oryza brachyantha
ref|XP_010671826.1|  PREDICTED: uncharacterized protein LOC104888516    127   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006660841.1|  PREDICTED: uncharacterized protein LOC102708742    127   1e-31   Oryza brachyantha
gb|EEE70043.1|  hypothetical protein OsJ_29997                          127   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84878.1|  hypothetical protein OsI_32028                          126   3e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001242428.1|  uncharacterized protein LOC100786056               125   5e-31   
ref|XP_006597006.1|  PREDICTED: uncharacterized protein LOC100786...    125   5e-31   Glycine max [soybeans]
gb|KHN33316.1|  Histidine protein methyltransferase 1 like              125   5e-31   Glycine soja [wild soybean]
ref|XP_008667701.1|  PREDICTED: uncharacterized protein LOC100277...    124   1e-30   Zea mays [maize]
gb|KHN30105.1|  Histidine protein methyltransferase 1 like              123   5e-30   Glycine soja [wild soybean]
ref|XP_003543558.1|  PREDICTED: uncharacterized protein LOC100810...    123   5e-30   Glycine max [soybeans]
ref|NP_001159150.1|  hypothetical protein                               123   5e-30   Zea mays [maize]
ref|XP_006397494.1|  hypothetical protein EUTSA_v10001523mg             122   7e-30   Eutrema salsugineum [saltwater cress]
ref|NP_565997.1|  S-adenosyl-L-methionine-dependent methyltransfe...    122   7e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16294.1|AF428364_1  At2g43320/T1O24.6                             122   8e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508446.1|  PREDICTED: histidine protein methyltransfera...    122   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010506201.1|  PREDICTED: histidine protein methyltransfera...    122   9e-30   Camelina sativa [gold-of-pleasure]
ref|NP_001144579.1|  uncharacterized protein LOC100277589               122   1e-29   Zea mays [maize]
ref|XP_010517889.1|  PREDICTED: histidine protein methyltransfera...    121   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006294500.1|  hypothetical protein CARUB_v10023531mg             121   2e-29   Capsella rubella
emb|CDY23358.1|  BnaC04g48860D                                          121   3e-29   Brassica napus [oilseed rape]
emb|CDY30401.1|  BnaA04g25020D                                          120   4e-29   Brassica napus [oilseed rape]
ref|XP_009142187.1|  PREDICTED: uncharacterized protein LOC103866064    119   1e-28   Brassica rapa
emb|CAN69477.1|  hypothetical protein VITISV_017347                     115   2e-27   Vitis vinifera
ref|XP_010238357.1|  PREDICTED: uncharacterized protein LOC100830260    115   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_007150422.1|  hypothetical protein PHAVU_005G152300g             114   1e-26   Phaseolus vulgaris [French bean]
ref|XP_009133591.1|  PREDICTED: histidine protein methyltransfera...    110   2e-25   Brassica rapa
ref|XP_004486926.1|  PREDICTED: uncharacterized protein LOC101511...    109   4e-25   Cicer arietinum [garbanzo]
ref|XP_003597493.1|  hypothetical protein MTR_2g098630                  109   4e-25   
emb|CDY44218.1|  BnaC03g24100D                                          109   4e-25   Brassica napus [oilseed rape]
ref|XP_002881896.1|  hypothetical protein ARALYDRAFT_483439             106   6e-24   
ref|XP_003597492.1|  hypothetical protein MTR_2g098630                  104   3e-23   Medicago truncatula
dbj|BAD34426.1|  hypothetical protein                                 87.0    3e-17   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04918.1|  predicted protein                                    73.6    6e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP20792.1|  unnamed protein product                              67.0    3e-10   Coffea canephora [robusta coffee]
gb|ABR16574.1|  unknown                                               66.6    7e-10   Picea sitchensis
ref|XP_009373561.1|  PREDICTED: histidine protein methyltransfera...  62.0    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_007163808.1|  hypothetical protein PHAVU_001G266000g           59.3    1e-07   Phaseolus vulgaris [French bean]
emb|CBI39376.3|  unnamed protein product                              57.8    1e-07   Vitis vinifera
ref|XP_009764705.1|  PREDICTED: histidine protein methyltransfera...  57.8    5e-07   Nicotiana sylvestris
ref|XP_002269192.1|  PREDICTED: histidine protein methyltransfera...  57.4    7e-07   Vitis vinifera
gb|KHN44473.1|  Histidine protein methyltransferase 1 like            57.0    9e-07   Glycine soja [wild soybean]
ref|XP_009625430.1|  PREDICTED: histidine protein methyltransfera...  57.4    9e-07   Nicotiana tomentosiformis
gb|ABK25033.1|  unknown                                               57.4    9e-07   Picea sitchensis
ref|XP_006841538.1|  hypothetical protein AMTR_s00003p00162530        57.0    1e-06   Amborella trichopoda
ref|XP_010068986.1|  PREDICTED: histidine protein methyltransfera...  56.6    1e-06   Eucalyptus grandis [rose gum]
ref|XP_010314745.1|  PREDICTED: histidine protein methyltransfera...  55.8    3e-06   
ref|XP_006349911.1|  PREDICTED: histidine protein methyltransfera...  55.8    3e-06   Solanum tuberosum [potatoes]
ref|XP_004252981.2|  PREDICTED: histidine protein methyltransfera...  55.5    4e-06   Solanum lycopersicum
ref|XP_004489175.1|  PREDICTED: histidine protein methyltransfera...  55.1    5e-06   Cicer arietinum [garbanzo]
ref|XP_004489174.1|  PREDICTED: histidine protein methyltransfera...  55.1    6e-06   Cicer arietinum [garbanzo]
ref|XP_011073784.1|  PREDICTED: histidine protein methyltransfera...  54.7    7e-06   Sesamum indicum [beniseed]
ref|XP_007222358.1|  hypothetical protein PRUPE_ppa009767mg           54.3    7e-06   
ref|XP_008222747.1|  PREDICTED: histidine protein methyltransfera...  54.3    8e-06   Prunus mume [ume]
ref|XP_008358052.1|  PREDICTED: histidine protein methyltransfera...  54.3    9e-06   Malus domestica [apple tree]
gb|KDO43480.1|  hypothetical protein CISIN_1g018716mg                 53.9    1e-05   Citrus sinensis [apfelsine]
ref|XP_010258579.1|  PREDICTED: histidine protein methyltransfera...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010258580.1|  PREDICTED: histidine protein methyltransfera...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010258577.1|  PREDICTED: histidine protein methyltransfera...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010673378.1|  PREDICTED: histidine protein methyltransfera...  53.1    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673377.1|  PREDICTED: histidine protein methyltransfera...  53.5    2e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB71877.1|  hypothetical protein B456_011G152100                  52.8    2e-05   Gossypium raimondii
ref|XP_003552281.1|  PREDICTED: histidine protein methyltransfera...  53.1    2e-05   Glycine max [soybeans]
gb|AFK36874.1|  unknown                                               53.1    2e-05   Medicago truncatula
ref|XP_006601885.1|  PREDICTED: histidine protein methyltransfera...  53.1    2e-05   Glycine max [soybeans]
gb|EPS60086.1|  hypothetical protein M569_14718                       53.1    3e-05   Genlisea aurea
gb|KHN00212.1|  hypothetical protein glysoja_047383                   51.2    4e-05   Glycine soja [wild soybean]
gb|KJB71879.1|  hypothetical protein B456_011G152100                  52.4    4e-05   Gossypium raimondii
gb|KDP32603.1|  hypothetical protein JCGZ_13153                       52.4    4e-05   Jatropha curcas
gb|KJB71878.1|  hypothetical protein B456_011G152100                  52.4    4e-05   Gossypium raimondii
gb|KJB71880.1|  hypothetical protein B456_011G152100                  52.4    4e-05   Gossypium raimondii
gb|KJB71876.1|  hypothetical protein B456_011G152100                  52.4    4e-05   Gossypium raimondii
gb|KHG01813.1|  Histidine protein methyltransferase 1                 52.4    4e-05   Gossypium arboreum [tree cotton]
ref|XP_007034208.1|  Methyltransferase family protein                 52.4    4e-05   
ref|XP_002300145.1|  hypothetical protein POPTR_0001s32830g           52.4    5e-05   Populus trichocarpa [western balsam poplar]
gb|KHG01812.1|  Histidine protein methyltransferase 1                 52.4    5e-05   Gossypium arboreum [tree cotton]
ref|NP_001063658.2|  Os09g0514300                                     52.0    6e-05   
ref|XP_004296995.1|  PREDICTED: histidine protein methyltransfera...  50.8    2e-04   Fragaria vesca subsp. vesca
gb|EYU32714.1|  hypothetical protein MIMGU_mgv1a010754mg              50.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_002532519.1|  conserved hypothetical protein                   49.3    5e-04   Ricinus communis
ref|XP_001760682.1|  predicted protein                                49.3    5e-04   



>ref|XP_009588400.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=349

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  +LLAQCLPG IS DRGCH SVISDRD HLPSPAVEIVPSK AHPY YA E +DLQG
Sbjct  1    MRTKALLAQCLPGFISQDRGCHMSVISDRDVHLPSPAVEIVPSKAAHPYKYAGETIDLQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            IN+ KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHE
Sbjct  61   INLFKGRVSVADIIGFTGSEAISSKSDGHLKSWDSSIDLVNVLKHE  106



>ref|XP_009781246.1| PREDICTED: uncharacterized protein LOC104230205 [Nicotiana sylvestris]
Length=349

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  +LLAQCLPG IS DRGCH SVISDRD HLPSPAVEIVPSK AHPY YA E VDLQG
Sbjct  1    MRTKALLAQCLPGFISQDRGCHMSVISDRDVHLPSPAVEIVPSKAAHPYKYAGEAVDLQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            IN  KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHE
Sbjct  61   INFFKGRVSVADIIGFTGSEAISSKSDGHLKSWDSSIDLVNVLKHE  106



>ref|XP_007034061.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007034062.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04987.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04988.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=350

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S +S+RD HLPSPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSVSTVSERDVHLPSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADIIGFTG+E+ISSKP+G+LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIGFTGSELISSKPEGFLKSWDSSIDLVNVLKHE  107



>gb|KJB27983.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=314

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGRISVADIIGFTG+E+ISSKP+G+LK WD S+DLVN+LKHE
Sbjct  61   GLNVFKGRISVADIIGFTGSELISSKPEGFLKSWDSSIDLVNILKHE  107



>ref|XP_002534114.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28265.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DR   + S +SDRD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPHDRASVSISSVSDRDVHLPSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADIIGFTG+EMISSKPDG LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIGFTGSEMISSKPDGSLKSWDSSIDLVNVLKHE  107



>gb|KJB27982.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=350

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGRISVADIIGFTG+E+ISSKP+G+LK WD S+DLVN+LKHE
Sbjct  61   GLNVFKGRISVADIIGFTGSELISSKPEGFLKSWDSSIDLVNILKHE  107



>ref|XP_009363653.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009363654.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSHSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV+DIIGF G+EMIS KPDG+LK WD S++LVN LKH+
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPDGHLKSWDSSIELVNGLKHD  107



>ref|XP_008453987.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453988.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453989.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453990.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
Length=350

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHAS-VISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+G H+S  IS+RD HLPSPAVEI+PSKTAHPY YA ENVDLQ
Sbjct  1    MRAPSLLSQCLPGLLPQDKGSHSSPSISERDVHLPSPAVEILPSKTAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADIIGF G+E  SSKP+G+LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIGFNGSESTSSKPEGHLKSWDSSIDLVNVLKHE  107



>ref|XP_008372076.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=348

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G  + S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSQSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV+DIIGF G+EMIS KP G+LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPYGHLKSWDSSIDLVNVLKHE  107



>ref|XP_009344374.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009344375.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSHSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV+DIIGF G+EMIS KPDG+LK WD S++LVN LKH+
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPDGHLKSWDSSIELVNGLKHD  107



>ref|XP_011037077.1| PREDICTED: uncharacterized protein LOC105134384 [Populus euphratica]
Length=356

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL   DRG H+ S +S+RD +LP+PAVEI+PSK  HPY YA ENV+ Q
Sbjct  7    MRAPSLLAQCLPGLAPQDRGSHSMSAVSERDMNLPTPAVEILPSKMVHPYKYAGENVEFQ  66

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR++VADIIGFTG+EMISSK DGYLK WD S+DLVNVLKHE
Sbjct  67   GLNVFKGRVNVADIIGFTGSEMISSKTDGYLKSWDSSIDLVNVLKHE  113



>ref|XP_004152105.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 ref|XP_004156936.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 gb|KGN53072.1| hypothetical protein Csa_4G015130 [Cucumis sativus]
Length=350

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHAS-VISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+G H+S  IS+RD HLPSPAVEI+PSKTAHPY YA ENVDLQ
Sbjct  1    MRAPSLLSQCLPGLLPQDKGSHSSPSISERDVHLPSPAVEILPSKTAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADII F G+E  SSKP+G+LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIAFNGSESTSSKPEGHLKSWDSSIDLVNVLKHE  107



>ref|XP_002264228.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
 emb|CBI36649.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+G H+ S IS+RD HL SPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVAHDKGSHSMSSISERDVHLCSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KGR+SVADIIGF G+EMISSKP+G LK WD S+DLVNVLKHE
Sbjct  61   GLHVFKGRVSVADIIGFNGSEMISSKPEGSLKSWDSSIDLVNVLKHE  107



>ref|XP_006443065.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006443066.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006494175.1| PREDICTED: uncharacterized protein LOC102618219 isoform X1 [Citrus 
sinensis]
 ref|XP_006494176.1| PREDICTED: uncharacterized protein LOC102618219 isoform X2 [Citrus 
sinensis]
 ref|XP_006494177.1| PREDICTED: uncharacterized protein LOC102618219 isoform X3 [Citrus 
sinensis]
 ref|XP_006494178.1| PREDICTED: uncharacterized protein LOC102618219 isoform X4 [Citrus 
sinensis]
 gb|ESR56305.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|ESR56306.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|KDO43478.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
 gb|KDO43479.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=351

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLPGL   DRG H+  S IS++D HLP PAVEI+PSK AH Y YA +NVDL
Sbjct  1    MRAPSLLAQCLPGLAPQDRGNHSMSSTISEKDAHLPCPAVEILPSKVAHLYKYAGDNVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Q I++ KG++SVADIIGFTG+EMISSKPDG+LKCW+ S+DLVNVLKHE
Sbjct  61   QAISMFKGKVSVADIIGFTGSEMISSKPDGFLKCWESSIDLVNVLKHE  108



>gb|KHG16096.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGRISVADIIGFTG+E I SKP+G+LK WD S+DLVN+LKHE
Sbjct  61   GLNVFKGRISVADIIGFTGSETILSKPEGFLKSWDSSIDLVNILKHE  107



>ref|XP_006372889.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
 gb|ERP50686.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
Length=356

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL   DRG H+ S +S+RD +LP+PAVEI+PSK  HPY Y+ ENV+ Q
Sbjct  7    MRAPSLLAQCLPGLAPQDRGSHSMSAVSERDVNLPTPAVEILPSKMVHPYKYSGENVEFQ  66

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR++VADIIGFTG+EMISSK DGYLK WD S+DLVNVLKHE
Sbjct  67   GLNVFKGRVNVADIIGFTGSEMISSKTDGYLKSWDSSIDLVNVLKHE  113



>gb|KDP42809.1| hypothetical protein JCGZ_23751 [Jatropha curcas]
Length=350

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+   + S +S+RD HLPSPAVEI+PSK AHPY YA ENV++Q
Sbjct  1    MRAPSLLAQCLPGLVPQDKTSQSISSVSERDAHLPSPAVEILPSKMAHPYKYAGENVEVQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KGR+SVADIIGFTG+EMISSKPDG LK WD S+DLVN+LKHE
Sbjct  61   GLHVFKGRVSVADIIGFTGSEMISSKPDGSLKSWDNSIDLVNILKHE  107



>ref|XP_010097465.1| hypothetical protein L484_024670 [Morus notabilis]
 gb|EXB68656.1| hypothetical protein L484_024670 [Morus notabilis]
Length=350

 Score =   165 bits (417),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ + IS RD HLPSPAVEI+PSK+ HPY YA ENVDL 
Sbjct  1    MRAPSLLAQCLPGLVPNDKGSHSLTSISGRDLHLPSPAVEILPSKSVHPYKYAGENVDLH  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADIIGF  +E ISSKP+GYLK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIGFNSSESISSKPEGYLKSWDSSIDLVNVLKHE  107



>ref|XP_008222628.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222629.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222630.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
Length=348

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 2/107 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  ++G H+ S IS+R+ HLPSPAVEIVPSKTAHPY YA EN++LQ
Sbjct  1    MRAPSLLAQCLPGLVPHEKGSHSVSSISEREPHLPSPAVEIVPSKTAHPYKYAGENIELQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV+DIIGF  +EMI SKPDG+LK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVSDIIGFNSSEMI-SKPDGHLKSWDSSIDLVNVLKHE  106



>gb|KJB71894.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
 gb|KJB71895.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
Length=350

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S +SDRD HLPS AVEI+PSKTAHP  YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVLYDRGSQSMSPVSDRDVHLPSLAVEILPSKTAHPCKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KGR+SVADIIGFT TEM+SSKPDG+LK W+ S DLVNVLKHE
Sbjct  61   GLDVFKGRVSVADIIGFTTTEMLSSKPDGFLKSWNSSFDLVNVLKHE  107



>ref|XP_006858675.1| hypothetical protein AMTR_s00066p00080930 [Amborella trichopoda]
 gb|ERN20142.1| hypothetical protein AMTR_s00066p00080930 [Amborella trichopoda]
Length=353

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG H+ + I+DRD HLPSPAVEI+PSK AHPY YA ENV+LQ
Sbjct  1    MRAPSLLAQCLPGLLPHDRGSHSLTSIADRDLHLPSPAVEIIPSKAAHPYKYAGENVNLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KGR+SVADIIGF+ ++M+SS+ DG +K W+GSLDLVN LKHE
Sbjct  61   GLHVFKGRVSVADIIGFSNSDMVSSRSDGGVKSWEGSLDLVNALKHE  107



>ref|XP_010912793.1| PREDICTED: uncharacterized protein LOC105038627 [Elaeis guineensis]
Length=350

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+  H  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLMTHDKNGHGISIVSERDLHLPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ I KGR+SVAD+IGF+  EMI SKPDG LK W+ S+DLVN LKHE
Sbjct  61   GLKIFKGRVSVADMIGFSSLEMILSKPDGSLKAWESSIDLVNTLKHE  107



>ref|XP_004309612.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
 ref|XP_011470941.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=349

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+   + S ISDR+ HL SPAVEI+PSK+AHPY +A EN+DLQ
Sbjct  1    MRAPSLLSQCLPGLVPHDKATSSLSSISDRESHLSSPAVEILPSKSAHPYKHAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N +KGR+SVADIIG  G+EMISSKPDGYLK WD S+DLVNVL HE
Sbjct  61   GLNALKGRVSVADIIGSNGSEMISSKPDGYLKSWDNSIDLVNVLNHE  107



>ref|XP_006347281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum tuberosum]
 ref|XP_006347282.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum tuberosum]
Length=346

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  SLLA CLPGLIS DRGCH SVISD+D HLPSPAVEIVPSK  HPY Y  E VDL  
Sbjct  1    MRTRSLLAHCLPGLISQDRGCHMSVISDKDVHLPSPAVEIVPSKATHPYKYVGETVDL--  58

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             ++ KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHE
Sbjct  59   -DVFKGRVSVADIIGFTGSETISSKSDGHLKSWDISIDLVNVLKHE  103



>ref|XP_010043656.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043732.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043813.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010059221.1| PREDICTED: uncharacterized protein LOC104447112 [Eucalyptus grandis]
 gb|KCW87686.1| hypothetical protein EUGRSUZ_A00073 [Eucalyptus grandis]
 gb|KCW87874.1| hypothetical protein EUGRSUZ_A00269 [Eucalyptus grandis]
Length=350

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPG    DRG  +   I +RD  LPSPAVEI+PSKT HPY YA E+VD+Q
Sbjct  1    MRAPSLLAQCLPGFTPHDRGSQNVPSIPERDLGLPSPAVEILPSKTTHPYKYAGESVDMQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ + KGR+SVADIIGFTG+EMISSKPDGYLK WD ++DLVNVLKHE
Sbjct  61   GLTMFKGRVSVADIIGFTGSEMISSKPDGYLKSWDNTIDLVNVLKHE  107



>ref|XP_008791776.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791777.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791778.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+  +  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLMTHDKNVYGISIVSERDLHLPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+NI KGR+SVAD+IGF+ +E++SS+PDG LK W+ S+DLV+ LKHE
Sbjct  61   GLNIFKGRVSVADMIGFSSSEVVSSRPDGSLKAWESSIDLVSTLKHE  107



>ref|XP_008799945.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799953.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGLI  D+  H  S++S+RD  LPSPAVEI+PSK AHPY YA ENVD+Q
Sbjct  1    MRAPSLLAQCFPGLIPHDKNGHGVSIVSERDLLLPSPAVEILPSKNAHPYKYAGENVDVQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+NI KGR+SVAD+IGF+ +EMISSK DG LK W+ S+DLVN+LKHE
Sbjct  61   GLNIFKGRVSVADMIGFSSSEMISSKHDGSLKSWESSMDLVNILKHE  107



>ref|XP_010930203.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
 ref|XP_010930204.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
Length=350

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSLLAQC PGL+  D+  H  S++S+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRTPSLLAQCFPGLMPHDKNGHGVSIVSERDLILPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+NI KGR+SVAD+IGF G+EMISSK DG LK W+GS+DLVN LKHE
Sbjct  61   GLNIFKGRVSVADMIGFPGSEMISSKHDGSLKYWEGSIDLVNTLKHE  107



>gb|KHG29074.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR+PSLLAQCLPGL+  DRG  + S +SDRD HLPS AVEI+PSKTAHP  YA +NV LQ
Sbjct  1    MRSPSLLAQCLPGLVLYDRGSQSMSPVSDRDVHLPSLAVEILPSKTAHPCKYAGDNVYLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KGR+ VADIIGFT TEM+SSKPDG+LK W+ S DLVNVLKHE
Sbjct  61   GLDVFKGRVGVADIIGFTTTEMLSSKPDGFLKSWNSSFDLVNVLKHE  107



>ref|XP_004241398.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322471.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322472.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
Length=346

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  SLLA CLPGLIS DRGCH SV+SD+D HLPSPAVEIVPSK  H Y YA E VDL  
Sbjct  1    MRTRSLLAHCLPGLISQDRGCHMSVVSDKDVHLPSPAVEIVPSKATHTYKYAGETVDL--  58

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             ++ KG +SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHE
Sbjct  59   -DVFKGSVSVADIIGFTGSETISSKSDGHLKSWDISIDLVNVLKHE  103



>ref|XP_009416014.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416015.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=351

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLP L+  D+   A  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDL
Sbjct  1    MRAPSLLAQCLPALVPHDKASQAGVSMVSERDLHLPSPAVEILPSKNAHPYKYAGENVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            QG+ I KGR+SV+D+IGF+ +EM SSK DG+LKCW+ S DLV++LK E
Sbjct  61   QGLKIFKGRVSVSDMIGFSNSEMASSKSDGFLKCWESSTDLVSILKLE  108



>ref|XP_002310441.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
 gb|EEE90891.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
Length=351

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSL AQCLPGL+  DRG ++ S + +RD  LP+PAVEI+PSK  HPY YA ENV+ Q
Sbjct  1    MRTPSLFAQCLPGLLPQDRGNNSVSTVLERDVVLPTPAVEILPSKMVHPYKYAGENVEFQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SVADII F G+E ISSK DGYLK WD S+DLVNVLKHE
Sbjct  61   GLNVFKGRVSVADIIAFVGSETISSKTDGYLKSWDSSIDLVNVLKHE  107



>ref|XP_011026390.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
 ref|XP_011026391.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
Length=349

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR PSLLAQCLPGL+  DRG + SV +  D  LP+PAVE++PSK  HP  YA ENV+ QG
Sbjct  1    MRTPSLLAQCLPGLVPQDRGSN-SVSTVLDVVLPTPAVEVLPSKMFHPSKYAGENVEFQG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +N+ KGR+SVADIIGF G+E ISSK DGYLK WD S+DLVNVLKHE
Sbjct  60   LNVFKGRVSVADIIGFVGSETISSKTDGYLKSWDNSIDLVNVLKHE  105



>ref|XP_010242753.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
 ref|XP_010242754.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
Length=351

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DR  H  S I +RD  L SPAVE++PSKT HPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLLPHDRSSHTISTIPERDVQLVSPAVEVLPSKTTHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGF-TGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+NI KGR+SV+DIIGF T ++MI SK +G LK W+ S+DLVN+LK+E
Sbjct  61   GLNIFKGRVSVSDIIGFTTNSDMIPSKSEGSLKSWESSIDLVNILKNE  108



>ref|XP_008798999.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799000.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=364

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A++I +RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDRESHGANLICERDIHLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHE
Sbjct  61   GLNVFKGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHE  107



>ref|XP_010525954.1| PREDICTED: uncharacterized protein LOC104803653 [Tarenaya hassleriana]
Length=349

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DR  + S +SDRD HLP+PAVEIVPSKTAHPY Y+ ENVD+ G
Sbjct  1    MRAPSLLAQCLPGLVPHDRD-NMSTLSDRDLHLPTPAVEIVPSKTAHPYKYSGENVDVHG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +NI KG++SVAD+IG +G+E+   K DG L+ W+ S+DLV++LK+E
Sbjct  60   LNIFKGKVSVADLIGLSGSEIAPLKHDGSLRSWESSIDLVSILKNE  105



>ref|XP_009401143.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401145.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=344

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLL QC  GL+  D+  HA  S+ S+RD HLPSPAVEIVPSK AHPY YA ENVDL
Sbjct  1    MRAPSLLVQCWLGLMPHDKDSHAGVSIASERDLHLPSPAVEIVPSKNAHPYKYAGENVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            QG+ I KGR+S+ADIIGF+ +EM+SSK DG LK W+ S DL++ LK E
Sbjct  61   QGLKIFKGRVSMADIIGFSNSEMLSSKFDGSLKSWESSADLLSALKLE  108



>ref|XP_010907676.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Elaeis guineensis]
Length=350

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A +IS+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDREGHGAHLISERDILLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ KGR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHE
Sbjct  61   GLNVFKGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHE  107



>ref|XP_009405561.1| PREDICTED: uncharacterized protein LOC103988679 [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 3/109 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG---CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVD  403
            MR+PSLLAQCLP L+  D+       S++S+RD HLPSPA+EI+PSK AHPY YA ENVD
Sbjct  1    MRSPSLLAQCLPALVPRDKASLKADVSLVSERDLHLPSPAIEILPSKNAHPYKYAGENVD  60

Query  404  LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            LQG+ I KGR+ ++D+IGF+ +EM SSK DG LK W+ S DLVN +K E
Sbjct  61   LQGLKIFKGRVRLSDVIGFSNSEMASSKSDGSLKSWESSTDLVNSVKLE  109



>ref|XP_010520847.1| PREDICTED: uncharacterized protein LOC104799618 [Tarenaya hassleriana]
Length=349

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +SDRD  LP+PAVEIVPSKTAHPY Y+ EN+D+QG
Sbjct  1    MRAPSLLAQCLPGLVPCDRGS-MSTLSDRDLQLPTPAVEIVPSKTAHPYKYSGENMDVQG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVADIIG +  E+   K D  L+ W+ S+DL++VLK+E
Sbjct  60   LHIFKGKVSVADIIGLSVAEITPLKHDASLRSWESSIDLLSVLKNE  105



>ref|XP_010907675.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Elaeis guineensis]
Length=355

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 85/112 (76%), Gaps = 6/112 (5%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A +IS+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDREGHGAHLISERDILLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVK-----GRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+N+ K     GR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHE
Sbjct  61   GLNVFKLNVFQGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHE  112



>ref|XP_003580042.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
 ref|XP_010240064.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
Length=344

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+         V+S+RD HLPSPAVEI+PSK+AHPY YA E VD QG
Sbjct  1    MKAPSLLVQCFPGLLPTKATSCVPVVSERDLHLPSPAVEIIPSKSAHPYKYAGEKVDFQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F   E+ SSK DG LK W+ S+ LVN+LK+E
Sbjct  61   LDIFKGKVSVADMIAFPPCEVASSKHDGTLKYWESSITLVNILKNE  106



>ref|XP_004957334.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Setaria italica]
 ref|XP_004957335.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Setaria italica]
Length=351

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADR-GCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PSLL+QCL GL+S DR   H  +++ +R+ HLPS AVEIVPSK  HPY YA EN++L
Sbjct  1    MRSPSLLSQCLAGLLSHDRTAAHCVNIVPEREPHLPSLAVEIVPSKNVHPYKYAGENIEL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             G+NI KG+ISV DIIG + +++++SK +G LKCW+ S+DLVNVLK E
Sbjct  61   HGMNIFKGKISVVDIIGLSKSDIVTSKGEGPLKCWESSIDLVNVLKDE  108



>gb|EMT24897.1| hypothetical protein F775_32531 [Aegilops tauschii]
Length=362

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS+RD HLPSPAVE++PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISERDLHLPSPAVELIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +++ KG++SVAD+I F+ +E+ SSK DG LK W+ S+ +VN++K+E
Sbjct  61   LDVFKGKVSVADMIAFSPSEVASSKHDGSLKYWESSITIVNIIKNE  106



>ref|XP_002446718.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
 gb|EES11046.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
Length=346

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS++D  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISEKDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F+ +E+ SSK DG LK W+ S+ LVN+LK+E
Sbjct  61   LDIFKGKVSVADMIAFSPSEVASSKYDGTLKYWESSITLVNILKNE  106



>gb|EMS59379.1| hypothetical protein TRIUR3_33843 [Triticum urartu]
Length=463

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS+RD HLPSPAVE++PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISERDLHLPSPAVELIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +++ KG++SVAD+I F+ +E+ SSK DG LK W+ S+ +VN++K+E
Sbjct  61   LDVFKGKVSVADMIAFSPSEVASSKHDGSLKYWESSITIVNIIKNE  106



>gb|KDO43477.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=330

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 23/108 (21%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLPGL   DRG H+  S IS++D HLP PAVEI+PSK              
Sbjct  1    MRAPSLLAQCLPGLAPQDRGNHSMSSTISEKDAHLPCPAVEILPSK--------------  46

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                   G++SVADIIGFTG+EMISSKPDG+LKCW+ S+DLVNVLKHE
Sbjct  47   -------GKVSVADIIGFTGSEMISSKPDGFLKCWESSIDLVNVLKHE  87



>emb|CAH67536.1| H0425E08.4 [Oryza sativa Indica Group]
 gb|EAY94660.1| hypothetical protein OsI_16438 [Oryza sativa Indica Group]
Length=346

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S+RD  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSERDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+E
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNE  106



>ref|NP_001053176.1| Os04g0492400 [Oryza sativa Japonica Group]
 emb|CAE02046.2| OJ990528_30.4 [Oryza sativa Japonica Group]
 dbj|BAF15090.1| Os04g0492400 [Oryza sativa Japonica Group]
 gb|EAZ31199.1| hypothetical protein OsJ_15298 [Oryza sativa Japonica Group]
 dbj|BAG93017.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S+RD  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSERDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+E
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNE  106



>ref|XP_004976058.1| PREDICTED: uncharacterized protein LOC101755614 [Setaria italica]
Length=346

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F+ +E+ S+K DG LK W+ S+ LVN+LK+E
Sbjct  61   LDIFKGKVSVADMIAFSPSEVASAKYDGTLKYWESSITLVNILKNE  106



>ref|XP_006652451.1| PREDICTED: uncharacterized protein LOC102711251 [Oryza brachyantha]
Length=346

 Score =   128 bits (321),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S++D HL SPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSEKDLHLSSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+E
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNE  106



>ref|XP_010671826.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671827.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSLLAQCLPGL+  D+G H+ S +SDRD H   PAVEI+PSK         +N D Q
Sbjct  1    MRTPSLLAQCLPGLLPRDQGSHSISAVSDRDAHFTPPAVEILPSKVVQTSKSEGDNADGQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ KG+I+VADI+GF+G E I SK D  LK WD ++DLVNVLKHE
Sbjct  61   GLHVFKGKINVADIVGFSGLETICSKTDVSLKSWDSAIDLVNVLKHE  107



>ref|XP_006660841.1| PREDICTED: uncharacterized protein LOC102708742 [Oryza brachyantha]
Length=351

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ HLPSPAVEIVPSK  HPY YA +N+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERETHLPSPAVEIVPSKNVHPYKYAGDNIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             G+NI KG++SV DI+G +G+E+++ K +G LKC + S+DLVNVLK+E
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVVTPKGEGPLKCCESSIDLVNVLKNE  108



>gb|EEE70043.1| hypothetical protein OsJ_29997 [Oryza sativa Japonica Group]
Length=351

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK  HPY YA EN+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSKNVHPYKYAGENIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             G+NI KG++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+E
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNE  108



>gb|EEC84878.1| hypothetical protein OsI_32028 [Oryza sativa Indica Group]
Length=366

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 83/108 (77%), Gaps = 2/108 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK  HPY YA EN+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSKNVHPYKYAGENIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             G+NI KG++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+E
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNE  108



>ref|NP_001242428.1| uncharacterized protein LOC100786056 [Glycine max]
 gb|ACU18508.1| unknown [Glycine max]
Length=330

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHE
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHE  102



>ref|XP_006597006.1| PREDICTED: uncharacterized protein LOC100786056 isoform X1 [Glycine 
max]
 ref|XP_006597007.1| PREDICTED: uncharacterized protein LOC100786056 isoform X2 [Glycine 
max]
 ref|XP_006597008.1| PREDICTED: uncharacterized protein LOC100786056 isoform X3 [Glycine 
max]
 ref|XP_006597009.1| PREDICTED: uncharacterized protein LOC100786056 isoform X4 [Glycine 
max]
 ref|XP_006597010.1| PREDICTED: uncharacterized protein LOC100786056 isoform X5 [Glycine 
max]
 ref|XP_006597011.1| PREDICTED: uncharacterized protein LOC100786056 isoform X6 [Glycine 
max]
Length=346

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHE
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHE  102



>gb|KHN33316.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHE
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHE  102



>ref|XP_008667701.1| PREDICTED: uncharacterized protein LOC100277589 isoform X1 [Zea 
mays]
 gb|ACN34078.1| unknown [Zea mays]
 tpg|DAA37175.1| TPA: hypothetical protein ZEAMMB73_004311 [Zea mays]
Length=346

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+ HPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSVHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +NI KG++SVAD+I  + +E+ SSK DG LK W+ S+ LV++LK+E
Sbjct  61   LNIFKGKVSVADMIVISPSEVASSKYDGTLKYWESSITLVDILKNE  106



>gb|KHN30105.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSK  H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSMSSVPEKDFHLPSPAVEILPSKAVHTDKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG ISVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHE
Sbjct  60   ----FKGLISVADIVGFSGSETISLKPDGYLKYWTSSIDLVSVLKHE  102



>ref|XP_003543558.1| PREDICTED: uncharacterized protein LOC100810964 isoform X1 [Glycine 
max]
 ref|XP_006595055.1| PREDICTED: uncharacterized protein LOC100810964 isoform X2 [Glycine 
max]
 ref|XP_006595056.1| PREDICTED: uncharacterized protein LOC100810964 isoform X3 [Glycine 
max]
Length=346

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSK  H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSMSSVPEKDFHLPSPAVEILPSKAVHTDKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG ISVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHE
Sbjct  60   ----FKGLISVADIVGFSGSETISLKPDGYLKYWTSSIDLVSVLKHE  102



>ref|NP_001159150.1| hypothetical protein [Zea mays]
 ref|XP_008662080.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25233.1| unknown [Zea mays]
 gb|AFW58696.1| hypothetical protein ZEAMMB73_692053 [Zea mays]
Length=352

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLI-SADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            M+APSLL +C PGL+ S D  C   ++S++D  LPS AVEI+PSK+AHPY YA E VD+Q
Sbjct  1    MKAPSLLVRCFPGLLPSKDTSC-VPIVSEKDLQLPSLAVEIIPSKSAHPYKYAGEKVDVQ  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G +I KG++SVAD+I F+ +E+ SSK DG LK W+ S+ LVN++++E
Sbjct  60   GFDIFKGKVSVADMISFSPSEVASSKYDGALKSWENSITLVNIIRNE  106



>ref|XP_006397494.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
 gb|ESQ38947.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
Length=351

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG  A+ +SD+D  LP+PAVEI+PSKTA  + Y+ ENVD+ G
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVAA-LSDKDLQLPTPAVEIIPSKTAAHHRYSGENVDMLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVAD IG +G+E    K +G LK W+ ++ LV+VLK+E
Sbjct  60   LQVFKGKVSVADFIGLSGSETAPLKYEGSLKSWESAIVLVDVLKNE  105



>ref|NP_565997.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 ref|NP_001078045.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK62628.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AAB64311.2| expressed protein [Arabidopsis thaliana]
 gb|AAM14937.1| expressed protein [Arabidopsis thaliana]
 gb|AAM91070.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AEC10250.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEC10251.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=351

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT   + Y+ EN+D  G
Sbjct  1    MRAPSLLAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTVAHHRYSGENLDALG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVADIIG +G+E    K +G LK W+ S+ LVNVLK+E
Sbjct  60   LQVFKGKVSVADIIGLSGSETAPLKNEGSLKSWESSVVLVNVLKNE  105



>gb|AAL16294.1|AF428364_1 At2g43320/T1O24.6 [Arabidopsis thaliana]
Length=351

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT   + Y+ EN+D  G
Sbjct  1    MRAPSLLAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTVAHHRYSGENLDALG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVADIIG +G+E    K +G LK W+ S+ LVNVLK+E
Sbjct  60   LQVFKGKVSVADIIGLSGSETAPLKNEGSLKSWESSVVLVNVLKNE  105



>ref|XP_010508446.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+E
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNE  107



>ref|XP_010506201.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+E
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNE  107



>ref|NP_001144579.1| uncharacterized protein LOC100277589 [Zea mays]
 gb|ACG41515.1| hypothetical protein [Zea mays]
Length=346

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+ HPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSVHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +NI KG++SVAD+I  + +E+ SSK DG  K W+ S+ LV++LK+E
Sbjct  61   LNIFKGKVSVADMIVISPSEVASSKYDGTPKYWESSITLVDILKNE  106



>ref|XP_010517889.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPHDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+E
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNE  107



>ref|XP_006294500.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
 gb|EOA27398.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
Length=351

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  +RG   S +S++D  LP+PAVEI+PSKTA  + Y+ EN+D+ G
Sbjct  1    MRAPSLLAQCLPGLLPQERG-GVSALSEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SV+D+IG +G+E    K +G LK W+ S+ LVNVLK+E
Sbjct  60   LQVFKGKVSVSDMIGLSGSESAPLKNEGSLKSWESSIVLVNVLKNE  105



>emb|CDY23358.1| BnaC04g48860D [Brassica napus]
Length=350

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDMQLPTPAVEIIPSKTSAHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+E
Sbjct  60   LPVFKGKVSVADIIGLSGSETAPSKYEGSLKSWDSSIVLVDVLKNE  105



>emb|CDY30401.1| BnaA04g25020D [Brassica napus]
Length=351

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTSSHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+E
Sbjct  60   LPVFKGKVSVADIIGISGSETAPSKYEGSLKSWDSSIVLVDVLKNE  105



>ref|XP_009142187.1| PREDICTED: uncharacterized protein LOC103866064 [Brassica rapa]
Length=351

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  +P+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDLQVPTPAVEIIPSKTSAHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+E
Sbjct  60   LPVFKGKVSVADIIGLSGSETAPSKYEGSLKSWDSSIVLVDVLKNE  105



>emb|CAN69477.1| hypothetical protein VITISV_017347 [Vitis vinifera]
Length=328

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 23/107 (21%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+G H+ S IS+RD HL SPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVAHDKGSHSMSSISERDVHLCSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+++ +G                       LK WD S+DLVNVLKHE
Sbjct  61   GLHVFQGS----------------------LKSWDSSIDLVNVLKHE  85



>ref|XP_010238357.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
 ref|XP_010238358.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
Length=353

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRD-GHLPSPAVEIVPSKTAHPYTYASENVD  403
            MR PSLL+QCL G +S D+      +V+ +RD  HLPSPAVEIVPSK  HPY YA +N++
Sbjct  1    MRPPSLLSQCLAGFMSNDKAAAHCINVVPERDQSHLPSPAVEIVPSKIVHPYKYAGDNIE  60

Query  404  LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            + G+NI KG+ SV DI+G + +++ + K +G LKC + SL+L+N LK+E
Sbjct  61   MHGMNIFKGKFSVVDIVGLSRSDIATPKGEGPLKCCESSLELINALKNE  109



>ref|XP_007150422.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
 gb|ESW22416.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
Length=346

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSK         EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDLHLPSPAVEILPSKAVLHDKDNGENMDY-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +S+ADI+GF+G+E IS KPDG LK W  S+DLV+VLKHE
Sbjct  60   ----FKGLVSIADIVGFSGSEAISLKPDGSLKSWTSSIDLVSVLKHE  102



>ref|XP_009133591.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 ref|XP_009133592.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 emb|CDY69980.1| BnaA03g56760D [Brassica napus]
Length=351

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGL+  D  C   S +S++D  LPSPAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCWPGLMPQD--CSGVSALSEKDLQLPSPAVEILPSKTAAQHRYSGENLDVL  58

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ I KG++SVAD+IG + +E    K +G +K W+ ++ LV+VLK+E
Sbjct  59   GLPIFKGKVSVADMIGLSSSETAPFKYEGSMKSWESAIVLVDVLKNE  105



>ref|XP_004486926.1| PREDICTED: uncharacterized protein LOC101511699 isoform X1 [Cicer 
arietinum]
 ref|XP_004486927.1| PREDICTED: uncharacterized protein LOC101511699 isoform X2 [Cicer 
arietinum]
Length=346

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP++LAQCLPGL+  DRG  + S I ++D HLPS AVEI+PSK       A ENVD  
Sbjct  1    MRAPAILAQCLPGLVPYDRGSLNLSSIPEKDIHLPSLAVEILPSKAFLTDKEAGENVDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +SVAD+IG +G+E ISS+ DGYLK W  S+DLV+VLK+E
Sbjct  60   ----FKGIVSVADMIGLSGSETISSRADGYLKSWASSVDLVSVLKNE  102



>ref|XP_003597493.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67744.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=362

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  215  ILVPVIMRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYAS  391
             LVP  MRAP++L+QCLPGL+  D G  + S + ++  HL SPAVEI+PSK  H    A 
Sbjct  11   FLVPTAMRAPAILSQCLPGLVPRDHGSLSISSVPEKAIHLASPAVEILPSKAFHTDKEAG  70

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            EN D       KG +SVADIIGF G+E ISS+ DGY K W  S+DLV+VLK+E
Sbjct  71   ENSDH-----FKGIVSVADIIGFGGSETISSRLDGYPKSWSSSIDLVSVLKNE  118



>emb|CDY44218.1| BnaC03g24100D [Brassica napus]
Length=351

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (73%), Gaps = 3/107 (3%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGL+  D  C   S +S++D  LPSPAVEI+PSKT+  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCWPGLMPQD--CSGVSALSEKDLQLPSPAVEILPSKTSAQHRYSGENLDVP  58

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G+ I KG++SVAD+IG + +E    K +G +K W+ ++ LV+VLK+E
Sbjct  59   GLPIFKGKVSVADMIGLSSSETAPFKYEGSMKSWESAIVLVDVLKNE  105



>ref|XP_002881896.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58155.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 80/117 (68%), Gaps = 13/117 (11%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVD---  403
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKTA  + Y+ EN+D   
Sbjct  1    MRAPSLLAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTAAHHRYSGENLDDAR  59

Query  404  --------LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                     + + +  G++SVADI+G +G+E  + K +G LK W+ S+ LVNVLK+E
Sbjct  60   FTSFQESREETLLVKHGKVSVADIMGLSGSE-TALKNEGSLKSWESSIVLVNVLKNE  115



>ref|XP_003597492.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67743.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=346

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP++L+QCLPGL+  D G  + S + ++  HL SPAVEI+PSK  H    A EN D  
Sbjct  1    MRAPAILSQCLPGLVPRDHGSLSISSVPEKAIHLASPAVEILPSKAFHTDKEAGENSDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                 KG +SVADIIGF G+E ISS+ DGY K W  S+DLV+VLK+E
Sbjct  60   ----FKGIVSVADIIGFGGSETISSRLDGYPKSWSSSIDLVSVLKNE  102



>dbj|BAD34426.1| hypothetical protein [Oryza sativa Japonica Group]
Length=315

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 23/108 (21%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK              
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSK--------------  46

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
                   G++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+E
Sbjct  47   -------GKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNE  87



>dbj|BAK04918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 28/102 (27%)
 Frame = +2

Query  329  LPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGY---  499
            LPSPA E+VPS+  H Y YAS N+++ G+NI KG++SV DI+G + +++ ++K  G    
Sbjct  38   LPSPAAEMVPSQDVHLYKYASNNIEMHGMNIFKGKLSVVDIVGLSRSDLAATKGQGKSNS  97

Query  500  -------------------------LKCWDGSLDLVNVLKHE  550
                                     LKC   SL+LVNVLK+E
Sbjct  98   PTSYIIVLTSTWKGEDLDLSFALGPLKCCQSSLELVNVLKNE  139



>emb|CDP20792.1| unnamed protein product [Coffea canephora]
Length=310

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            P+VE++PS+ +    Y  E+VD+ GI ++KGR++  ++  F+  +++  K +G LK W+G
Sbjct  42   PSVEVLPSQVSSNVKYTVESVDIDGITLIKGRVNSKEVFAFSNLDLVPGKYEGGLKLWEG  101

Query  518  SLDLVNVLKHE  550
            S+DLV  L+ E
Sbjct  102  SVDLVKTLQSE  112



>gb|ABR16574.1| unknown [Picea sitchensis]
Length=368

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +2

Query  236  RAPSLLAQCLPGLI-SADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL-Q  409
            RAPSL A    GL  S D        S+     P P  E++PS+      Y +E V+L  
Sbjct  4    RAPSLFAGLPQGLFQSMDMLQSVCGFSENPPPHPPPCEEVLPSQVVQLEKYVAEPVNLPG  63

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G++++KGR++ AD+ G + ++++  K +G LK W+ S DLVN LKHE
Sbjct  64   GLSLLKGRVNTADVFGVSNSDLVPGKYEGGLKLWESSTDLVNALKHE  110



>ref|XP_009373561.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=301

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            +V++ PS+ +    Y  E V+L G+ ++KGR+S  D+   + ++++  K +G LK W+GS
Sbjct  35   SVQVFPSEVSSSVKYTVEPVELGGLTLLKGRVSTQDVFTLSNSDLVPGKYEGGLKLWEGS  94

Query  521  LDLVNVLKHE  550
            LDLV  L+ E
Sbjct  95   LDLVKALRSE  104



>ref|XP_007163808.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
 gb|ESW35802.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
Length=289

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            P VE++ S+      +  E+V+L G+ ++KGR+S   + G + ++++  K +G LK W+G
Sbjct  31   PCVEVLASEAPSSANHNLESVNLDGLTLLKGRVSTQQVFGLSNSDLVPGKYEGGLKLWEG  90

Query  518  SLDLVNVLKHE  550
            SLDL+  L+ +
Sbjct  91   SLDLIKALRSD  101



>emb|CBI39376.3| unnamed protein product [Vitis vinifera]
Length=173

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR++  D+  F+ ++++  + +G LK W+GSLDLV  L+ E
Sbjct  62   YTVERVNLNGLTLLKGRVNTQDVFAFSNSDLVPGQYEGGLKLWEGSLDLVKALRSE  117



>ref|XP_009764705.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
sylvestris]
Length=305

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+ +    +  E +++ G+ ++KGR+S  ++ G + ++++  K +G LK W+GSL
Sbjct  44   VEVLSSQVSSNVEFNVEPINMDGLTLLKGRVSTKEVFGLSNSDLVPGKYEGGLKLWEGSL  103

Query  524  DLVNVLKHE  550
            DLV  L  E
Sbjct  104  DLVKTLNSE  112



>ref|XP_002269192.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
Length=308

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR++  D+  F+ ++++  + +G LK W+GSLDLV  L+ E
Sbjct  62   YTVERVNLNGLTLLKGRVNTQDVFAFSNSDLVPGQYEGGLKLWEGSLDLVKALRSE  117



>gb|KHN44473.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=279

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCW  511
            P P VE++ S+      +  ++V+L G+ ++KGR++   + G + + ++  K +G LK W
Sbjct  43   PPPCVEVLASEVPSSIKHNVDSVNLDGVTLLKGRVNTQQVFGLSNSNLVPWKYEGGLKLW  102

Query  512  DGSLDLVNVLKHE  550
            +GSLDL+  L+ +
Sbjct  103  EGSLDLIKALRSD  115



>ref|XP_009625430.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=304

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            +VE++ S+      +  E ++L G+ ++KGR+S  ++ G + ++++  K +G LK W+GS
Sbjct  43   SVEVLSSQVISNVEFNVEPINLDGLALLKGRVSTKEVFGLSNSDLVPGKYEGGLKLWEGS  102

Query  521  LDLVNVLKHE  550
            LDLV  L  E
Sbjct  103  LDLVKTLNSE  112



>gb|ABK25033.1| unknown [Picea sitchensis]
 gb|ACN39918.1| unknown [Picea sitchensis]
Length=370

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = +2

Query  233  MRAPSLLAQCLPGL------ISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASE  394
            MR PSL A CLPGL       SAD+      + ++    P P+VE++PSK A    Y +E
Sbjct  1    MRVPSLFA-CLPGLSPQSLFQSADKPHSLLGVPEKPLPPPPPSVEVLPSKDAQSDKYVAE  59

Query  395  NVDLQG-INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
             V+L+G + ++K R++  DI G    +++  K +G LK W+ SLDLVN LK E
Sbjct  60   PVNLRGGLTLLKSRVNTMDIFGVPYLDLVPGKYEGGLKLWESSLDLVNTLKRE  112



>ref|XP_006841538.1| hypothetical protein AMTR_s00003p00162530 [Amborella trichopoda]
 gb|ERN03213.1| hypothetical protein AMTR_s00003p00162530 [Amborella trichopoda]
Length=318

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWD  514
            P  E++ ++ A    YA+E V+L +GI ++KGR+S +D+ G + +++I  K +G LK W+
Sbjct  44   PCTEVIFTEVAPSVKYATEPVNLNEGITLLKGRVSTSDVFGASNSDLIPGKYEGGLKLWE  103

Query  515  GSLDLVNVLKHE  550
             SLDL+  L  E
Sbjct  104  CSLDLIKSLALE  115



>ref|XP_010068986.1| PREDICTED: histidine protein methyltransferase 1 homolog [Eucalyptus 
grandis]
 gb|KCW57204.1| hypothetical protein EUGRSUZ_H00019 [Eucalyptus grandis]
Length=299

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++PS+ +    + +E V L  + ++KGR+S  ++   + ++++  K +G LK W+GS+
Sbjct  39   VEVLPSEVSENVKFTAEPVHLGELTLLKGRVSTQEVFSLSNSDLVPGKYEGGLKLWEGSM  98

Query  524  DLVNVLKHE  550
            DLV  L+ E
Sbjct  99   DLVKALQSE  107



>ref|XP_010314745.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum lycopersicum]
Length=326

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHE  550
            L  E
Sbjct  113  LSSE  116



>ref|XP_006349911.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
tuberosum]
Length=309

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHE  550
            L  E
Sbjct  113  LSSE  116



>ref|XP_004252981.2| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum lycopersicum]
Length=327

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHE  550
            L  E
Sbjct  113  LSSE  116



>ref|XP_004489175.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Cicer arietinum]
Length=311

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  PSPAVEIVPS--KTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S  + A       E+VD  G+ + KGR++   + G + ++++  K +G LK
Sbjct  48   PPPCVEVLASDSEVASCNKLNVESVDFDGVTLFKGRVNTQQVFGLSNSDLVPGKYEGGLK  107

Query  506  CWDGSLDLVNVLKHE  550
             W+GSLDL+  L+ +
Sbjct  108  LWEGSLDLIKALRSD  122



>ref|XP_004489174.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Cicer arietinum]
Length=312

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  PSPAVEIVPS--KTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S  + A       E+VD  G+ + KGR++   + G + ++++  K +G LK
Sbjct  49   PPPCVEVLASDSEVASCNKLNVESVDFDGVTLFKGRVNTQQVFGLSNSDLVPGKYEGGLK  108

Query  506  CWDGSLDLVNVLKHE  550
             W+GSLDL+  L+ +
Sbjct  109  LWEGSLDLIKALRSD  123



>ref|XP_011073784.1| PREDICTED: histidine protein methyltransferase 1 homolog [Sesamum 
indicum]
Length=308

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            +E++ S+ +    Y  E V++ G+ + KGR+S  ++   T ++++  K +G LK W+GSL
Sbjct  42   LEVLASEVSPSAKYTVEPVNIGGLTLFKGRVSTQEVFTLTNSDLVPGKYEGGLKLWEGSL  101

Query  524  DLVNVLKHE  550
            DL+  L  E
Sbjct  102  DLITTLSSE  110



>ref|XP_007222358.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
 gb|EMJ23557.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
Length=278

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 41/68 (60%), Gaps = 5/68 (7%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            EI+PS       YA E V L G+ ++KGR+S  ++   + ++++  K +G LK W+GSLD
Sbjct  42   EILPS-----VKYAVEPVQLGGLTLLKGRVSTQEVFTLSNSDLVPGKYEGGLKLWEGSLD  96

Query  527  LVNVLKHE  550
            LV  L  E
Sbjct  97   LVKALSSE  104



>ref|XP_008222747.1| PREDICTED: histidine protein methyltransferase 1 homolog [Prunus 
mume]
Length=301

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++PS+      Y  E V+L G+ ++KG +S  ++   + ++++  K +G LK W+GSL
Sbjct  36   VEVLPSEILPSVKYTVEPVELGGLTLLKGCVSTQEVFTLSNSDLVPGKYEGGLKLWEGSL  95

Query  524  DLVNVLKHE  550
            DLV  L  E
Sbjct  96   DLVKALSSE  104



>ref|XP_008358052.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=301

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 39/64 (61%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    Y  E V+L G+ ++KGR+S  D+   + ++++  K +G LK W+GSLDLV  
Sbjct  41   SEVSSSVKYTVEPVELGGLTLLKGRVSTQDVFTLSNSDLVPGKYEGGLKLWEGSLDLVKA  100

Query  539  LKHE  550
            L  E
Sbjct  101  LSSE  104



>gb|KDO43480.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=269

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  473  MISSKPDGYLKCWDGSLDLVNVLKHE  550
            MISSKPDG+LKCW+ S+DLVNVLKHE
Sbjct  1    MISSKPDGFLKCWESSIDLVNVLKHE  26



>ref|XP_010258579.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Nelumbo nucifera]
Length=335

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  64   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  123

Query  518  SLDLVNVLKHE  550
            SLDLV  L  E
Sbjct  124  SLDLVKALHSE  134



>ref|XP_010258580.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X3 [Nelumbo nucifera]
Length=320

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  44   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  103

Query  518  SLDLVNVLKHE  550
            SLDLV  L  E
Sbjct  104  SLDLVKALHSE  114



>ref|XP_010258577.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Nelumbo nucifera]
Length=340

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  64   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  123

Query  518  SLDLVNVLKHE  550
            SLDLV  L  E
Sbjct  124  SLDLVKALHSE  134



>ref|XP_010673378.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=284

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            YA E VDL  + ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  E
Sbjct  73   YAVEQVDLGDVTLLKGRVSTREVFALSNSDLVPGKYEGGLKLWEGSLDLVKALHSE  128



>ref|XP_010673377.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=317

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            YA E VDL  + ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  E
Sbjct  73   YAVEQVDLGDVTLLKGRVSTREVFALSNSDLVPGKYEGGLKLWEGSLDLVKALHSE  128



>gb|KJB71877.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=251

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>ref|XP_003552281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Glycine max]
 gb|KHN24030.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=306

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+      +  ++V+L G+ ++KGR++   + G + ++++  K +G LK W+GSL
Sbjct  48   VEVLASEVPSSLKHNVDSVNLDGVILLKGRVNTQQVFGLSNSDLVPGKYEGGLKLWEGSL  107

Query  524  DLVNVLKHE  550
            DL+  L+ +
Sbjct  108  DLIKALRSD  116



>gb|AFK36874.1| unknown [Medicago truncatula]
 gb|KEH21595.1| methyltransferase family protein [Medicago truncatula]
Length=311

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPY--TYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S++  P    + +E V+  G+ + KGR++   + G +  +++  K +G LK
Sbjct  48   PPPCVEVLVSESEVPLFVKHNAEEVNFDGVTLFKGRVNTQQVFGLSNFDLVPGKYEGGLK  107

Query  506  CWDGSLDLVNVLKHE  550
             W+GS DL+  L+ +
Sbjct  108  LWEGSNDLIKALRSD  122



>ref|XP_006601885.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Glycine max]
Length=302

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+      +  ++V+L G+ ++KGR++   + G + ++++  K +G LK W+GSL
Sbjct  44   VEVLASEVPSSLKHNVDSVNLDGVILLKGRVNTQQVFGLSNSDLVPGKYEGGLKLWEGSL  103

Query  524  DLVNVLKHE  550
            DL+  L+ +
Sbjct  104  DLIKALRSD  112



>gb|EPS60086.1| hypothetical protein M569_14718, partial [Genlisea aurea]
Length=281

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  326  HLPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            H P    EI  S+ +    Y  E VD+ G+ ++KGR++  D+   + ++++  K +G LK
Sbjct  23   HPPPHCSEISVSEVSRDVNYTLEPVDVGGLTLLKGRVNTRDVFALSNSDLVPGKYEGGLK  82

Query  506  CWDGSLDLVNVLKHE  550
             W+ SLDL+  L  E
Sbjct  83   LWECSLDLIAALNSE  97



>gb|KHN00212.1| hypothetical protein glysoja_047383, partial [Glycine soja]
Length=178

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCW  511
            P P VE++ S+      +  ++V+L G+ ++KG ++   + G   + ++  K +G LK W
Sbjct  37   PPPCVEVLASEVPSYIKHNVDSVNLDGVTLLKGWVNTQQVFGLPNSNLVPGKYEGGLKLW  96

Query  512  DGSLDLVNVL  541
            +GSLDL+  L
Sbjct  97   EGSLDLIKAL  106



>gb|KJB71879.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=277

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>gb|KDP32603.1| hypothetical protein JCGZ_13153 [Jatropha curcas]
Length=301

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
             E++ S+ +    ++ E V L G+ + KGR+S  ++ G   ++++    +G LK W+GS+
Sbjct  36   TEVLSSEVSSTLKFSVEPVTLDGLTLFKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSV  95

Query  524  DLVNVLKHE  550
            DLV  L+ E
Sbjct  96   DLVKALRSE  104



>gb|KJB71878.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=291

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>gb|KJB71880.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=286

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +2

Query  386  ASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +SE V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  42   SSEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  96



>gb|KJB71876.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=296

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>gb|KHG01813.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=296

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>ref|XP_007034208.1| Methyltransferase family protein [Theobroma cacao]
 gb|EOY05134.1| Methyltransferase family protein [Theobroma cacao]
Length=303

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            E V+L G  ++KGR+S  ++ G   ++++  K +G LK W+GSLDLV  L+ E
Sbjct  54   EPVNLDGFTLLKGRVSTKEVFGLPNSDLVPGKYEGGLKLWEGSLDLVKALRSE  106



>ref|XP_002300145.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
 gb|EEE84950.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
Length=301

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQ-GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            VE++ S+ +     + E+V+L+ G+ ++KGR+S  ++ G   ++++    +G LK W+GS
Sbjct  35   VEVLSSEVSLNVKCSVESVNLEDGLTLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGS  94

Query  521  LDLVNVLKHE  550
            LDL+N L+ E
Sbjct  95   LDLINALQAE  104



>gb|KHG01812.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=330

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSE  106



>ref|NP_001063658.2| Os09g0514300 [Oryza sativa Japonica Group]
 dbj|BAF25572.2| Os09g0514300 [Oryza sativa Japonica Group]
Length=285

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  428  GRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            G++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+E
Sbjct  2    GKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNE  42



>ref|XP_004296995.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=301

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            +  E V+L G+ ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  E
Sbjct  49   FTVEPVELGGLTLLKGRVSTQEVFTLSNSDLVPGKYEGGLKLWEGSLDLVKALSSE  104



>gb|EYU32714.1| hypothetical protein MIMGU_mgv1a010754mg [Erythranthe guttata]
Length=302

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            E++ S+ +    Y  E V++ G+ + KGR+S  ++     ++++  K +G LK W+GS D
Sbjct  42   EVLSSEVSPNAQYTVEPVNVGGLTLFKGRVSTEEVFSLANSDLVPGKYEGGLKLWEGSFD  101

Query  527  LVNVLKHE  550
            L+  L  E
Sbjct  102  LIAALSSE  109



>ref|XP_002532519.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29871.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHE  550
            E V L G+ ++KGR+S  ++ G   ++++    +G LK W+GSLDLV  L+ E
Sbjct  53   EPVHLDGLTLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSLDLVKTLRRE  105



>ref|XP_001760682.1| predicted protein [Physcomitrella patens]
 gb|EDQ74421.1| predicted protein [Physcomitrella patens]
Length=302

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPYTYASENVDLQG-INIVKGRISVADIIGFTGTEMISSKPDGYLKC  508
            P+P  E+ PS+     +   E V LQG + ++KGR++   ++    +++I  K +G LK 
Sbjct  43   PTPPEEVFPSEDEESASCVMEPVVLQGGLTLLKGRVNSQSVLKVANSDLIPGKYEGGLKL  102

Query  509  WDGSLDLVNVLKHE  550
            W+ ++DLV +L+ E
Sbjct  103  WECTIDLVEMLRRE  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720