BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034G18

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07384.1|  unnamed protein product                                242   2e-71   Coffea canephora [robusta coffee]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     235   5e-69   
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                234   2e-68   Erythranthe guttata [common monkey flower]
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                232   8e-68   Erythranthe guttata [common monkey flower]
ref|XP_009596271.1|  PREDICTED: endoplasmin homolog                     228   2e-67   Nicotiana tomentosiformis
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     229   7e-67   Nicotiana tomentosiformis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     229   9e-67   Nicotiana sylvestris
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    229   9e-67   Catharanthus roseus [chatas]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     229   1e-66   Solanum lycopersicum
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     228   1e-66   Solanum tuberosum [potatoes]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     229   1e-66   Vitis vinifera
dbj|BAL42333.1|  Heat shock protein 90                                  228   2e-66   Nicotiana tabacum [American tobacco]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     228   1e-65   Vitis vinifera
dbj|BAL42332.1|  Heat shock protein 90                                  225   2e-65   Nicotiana tabacum [American tobacco]
ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     225   2e-65   Nicotiana sylvestris
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     221   8e-64   Sesamum indicum [beniseed]
ref|XP_010109992.1|  Endoplasmin-like protein                           221   2e-63   
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          220   2e-63   Cicer arietinum [garbanzo]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          220   2e-63   Cicer arietinum [garbanzo]
gb|KDO84888.1|  hypothetical protein CISIN_1g003458mg                   215   2e-63   Citrus sinensis [apfelsine]
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     220   2e-63   Tarenaya hassleriana [spider flower]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         220   2e-63   Jatropha curcas
ref|XP_003589505.1|  Endoplasmin-like protein                           218   6e-63   Medicago truncatula
gb|KDO84887.1|  hypothetical protein CISIN_1g003458mg                   215   7e-63   Citrus sinensis [apfelsine]
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     218   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             218   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     217   2e-62   Populus euphratica
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   216   4e-62   Citrus sinensis [apfelsine]
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   216   4e-62   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             216   5e-62   Citrus clementina [clementine]
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     216   5e-62   Citrus sinensis [apfelsine]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     215   8e-62   
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    214   2e-61   
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     214   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          214   2e-61   Glycine max [soybeans]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          214   2e-61   
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          213   3e-61   Glycine max [soybeans]
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     213   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          213   4e-61   Glycine max [soybeans]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     213   5e-61   Fragaria vesca subsp. vesca
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     213   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510550.1|  endoplasmin, putative                              212   1e-60   Ricinus communis
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     212   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     211   3e-60   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAD94659.1|  HSP90-like protein                                     201   5e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     210   7e-60   Eucalyptus grandis [rose gum]
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     209   1e-59   Elaeis guineensis
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             209   1e-59   Prunus persica
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     209   2e-59   Prunus mume [ume]
gb|AIZ68158.1|  heat shock protein 90                                   209   2e-59   Ornithogalum longebracteatum [sea-onion]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             208   2e-59   Phaseolus vulgaris [French bean]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     207   4e-59   Cucumis melo [Oriental melon]
gb|AAX19870.1|  unknown                                                 196   1e-58   Doryanthes excelsa
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     206   1e-58   Elaeis guineensis
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     204   6e-58   Phoenix dactylifera
gb|EPS69355.1|  hypothetical protein M569_05408                         204   1e-57   Genlisea aurea
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          202   2e-57   
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     202   3e-57   Setaria italica
ref|NP_001151475.1|  endoplasmin precursor                              202   4e-57   
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               202   4e-57   
gb|AAN34791.1|  Grp94                                                   202   4e-57   Xerophyta viscosa
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     202   5e-57   Oryza brachyantha
gb|AFW75766.1|  hypothetical protein ZEAMMB73_790349                    201   7e-57   
ref|NP_194150.1|  HSP90-like protein GRP94                              201   8e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AFW75767.1|  endoplasmin                                             201   8e-57   
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     201   9e-57   Camelina sativa [gold-of-pleasure]
dbj|BAB86368.1|  SHEPHERD                                               201   9e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KJB63270.1|  hypothetical protein B456_010G0030002                   191   9e-57   Gossypium raimondii
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     201   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             201   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             201   1e-56   Capsella rubella
gb|KJB63271.1|  hypothetical protein B456_010G0030002                   191   1e-56   Gossypium raimondii
dbj|BAA90487.1|  heat shock protein 90                                  200   2e-56   Oryza sativa [red rice]
ref|NP_001058590.1|  Os06g0716700                                       200   2e-56   
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     199   3e-56   Phoenix dactylifera
gb|AAL79732.1|AC091774_23  heat shock protein 90                        199   4e-56   Oryza sativa Japonica Group [Japonica rice]
gb|KJB63272.1|  hypothetical protein B456_010G0030002                   190   4e-56   Gossypium raimondii
ref|NP_974606.1|  HSP90-like protein GRP94                              198   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             197   1e-55   Eutrema salsugineum [saltwater cress]
emb|CDY10992.1|  BnaA03g46510D                                          198   2e-55   Brassica napus [oilseed rape]
gb|KJB14398.1|  hypothetical protein B456_002G122800                    197   2e-55   Gossypium raimondii
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    197   2e-55   Arabis alpina [alpine rockcress]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    197   2e-55   Gossypium raimondii
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    197   3e-55   Hordeum vulgare [barley]
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     196   5e-55   Camelina sativa [gold-of-pleasure]
emb|CDY24830.1|  BnaA08g14800D                                          196   5e-55   Brassica napus [oilseed rape]
emb|CDY34264.1|  BnaA01g13670D                                          196   5e-55   Brassica napus [oilseed rape]
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     196   6e-55   Brassica rapa
tpg|DAA46734.1|  TPA: hypothetical protein ZEAMMB73_851694              189   8e-55   
gb|KHG17445.1|  Endoplasmin                                             195   1e-54   Gossypium arboreum [tree cotton]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          195   1e-54   Amborella trichopoda
tpg|DAA46735.1|  TPA: hypothetical protein ZEAMMB73_851694              189   2e-54   
gb|EAZ02369.1|  hypothetical protein OsI_24473                          194   2e-54   Oryza sativa Indica Group [Indian rice]
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          194   2e-54   Oryza sativa Japonica Group [Japonica rice]
emb|CDY03477.1|  BnaC01g16050D                                          194   2e-54   
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   193   4e-54   Gossypium raimondii
emb|CDX92620.1|  BnaC07g38780D                                          193   5e-54   
emb|CDY08910.1|  BnaC08g11400D                                          192   1e-53   Brassica napus [oilseed rape]
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     192   1e-53   Brachypodium distachyon [annual false brome]
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     192   1e-53   Cucumis sativus [cucumbers]
gb|ABV82432.1|  Hsp90-like protein                                      191   2e-53   Dactylis glomerata [cocksfoot]
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    193   2e-53   
gb|AFW81541.1|  hypothetical protein ZEAMMB73_624427                    184   1e-52   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    188   4e-52   
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    188   4e-52   
gb|EMT19498.1|  Endoplasmin-like protein                                189   1e-51   
gb|ABV21762.1|  GRP94                                                   186   3e-51   Pinus taeda
gb|EMS56078.1|  Endoplasmin-like protein                                183   3e-50   Triticum urartu
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    177   2e-48   
ref|XP_008660989.1|  PREDICTED: endoplasmin homolog                     167   5e-48   
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   176   8e-48   Gossypium raimondii
gb|KHN44921.1|  Endoplasmin like                                        158   7e-44   Glycine soja [wild soybean]
ref|XP_008646956.1|  PREDICTED: endoplasmin homolog                     155   2e-43   
gb|ACR38010.1|  unknown                                                 150   4e-43   Zea mays [maize]
gb|AFW81490.1|  hypothetical protein ZEAMMB73_031063                    149   1e-42   
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             160   7e-42   Selaginella moellendorffii
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             160   7e-42   Selaginella moellendorffii
ref|XP_001770511.1|  predicted protein                                  157   5e-41   
ref|XP_002949693.1|  hypothetical protein VOLCADRAFT_80696              132   4e-32   Volvox carteri f. nagariensis
ref|XP_001701885.1|  heat shock protein 90B                             132   6e-32   Chlamydomonas reinhardtii
ref|XP_002157524.1|  PREDICTED: endoplasmin-like                        114   7e-26   Hydra vulgaris
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        114   1e-25   
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       113   2e-25   Ostreococcus lucimarinus CCE9901
ref|XP_006914764.1|  PREDICTED: endoplasmin-like                        106   2e-25   
dbj|BAG61085.1|  unnamed protein product                                106   4e-25   Homo sapiens [man]
ref|XP_002508627.1|  predicted protein                                  112   4e-25   Micromonas commoda
gb|EFA78289.1|  heat shock protein Hsp90 family protein                 112   6e-25   Heterostelium album PN500
dbj|GAM27457.1|  hypothetical protein SAMD00019534_106330               112   6e-25   Acytostelium subglobosum LB1
tpg|DAA34121.1|  TPA: endoplasmic reticulum glucose-regulated pro...    106   7e-25   Amblyomma variegatum
ref|XP_007512535.1|  predicted protein                                  111   2e-24   Bathycoccus prasinos
ref|XP_011311739.1|  PREDICTED: endoplasmin                             110   3e-24   Fopius arisanus
gb|ADR79285.1|  Hsp90 beta                                              109   4e-24   Brachionus ibericus
ref|XP_003063917.1|  predicted protein                                  109   4e-24   Micromonas pusilla CCMP1545
gb|AIC62039.1|  HSP90B1                                                 105   7e-24   synthetic construct
gb|AAH09195.1|  HSP90B1 protein                                         105   8e-24   Homo sapiens [man]
gb|ADY39524.1|  putative heat shock protein gp-96                       102   8e-24   Hottentotta judaicus
gb|EAW97723.1|  heat shock protein 90kDa beta (Grp94), member 1, ...    105   1e-23   Homo sapiens [man]
gb|AAT97075.1|  tumor rejection antigen-like protein                    101   1e-23   Lymnaea stagnalis
ref|XP_005823214.1|  hypothetical protein GUITHDRAFT_160160             107   2e-23   Guillardia theta CCMP2712
ref|XP_001753222.1|  predicted protein                                  107   3e-23   
ref|XP_006657349.1|  PREDICTED: endoplasmin homolog                     107   3e-23   
gb|AGX25162.1|  heat shock protein                                      103   3e-23   Leptinotarsa decemlineata
ref|XP_004994487.1|  heat shock protein gp96                            107   3e-23   Salpingoeca rosetta
ref|XP_003907109.1|  PREDICTED: endoplasmin                             106   5e-23   
ref|XP_004373828.1|  PREDICTED: endoplasmin                             106   7e-23   Trichechus manatus latirostris
ref|XP_011494775.1|  PREDICTED: endoplasmin                             105   9e-23   Ceratosolen solmsi marchali
ref|XP_007096540.1|  PREDICTED: endoplasmin                             105   1e-22   Panthera tigris altaica
ref|XP_007109922.1|  PREDICTED: endoplasmin                             105   1e-22   Physeter catodon
ref|XP_004326676.1|  PREDICTED: endoplasmin                             105   1e-22   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004269495.1|  PREDICTED: endoplasmin                             105   1e-22   
ref|XP_007165840.1|  PREDICTED: endoplasmin                             105   1e-22   Balaenoptera acutorostrata scammoni
dbj|BAP28370.1|  heat shock protein 90 kDa beta member 1                105   1e-22   Canis lupus familiaris [dogs]
ref|XP_004414318.1|  PREDICTED: endoplasmin                             105   1e-22   Odobenus rosmarus divergens
gb|AAH81917.1|  Tra1 protein                                            105   1e-22   Rattus norvegicus [brown rat]
gb|ELU00023.1|  hypothetical protein CAPTEDRAFT_159587                  105   1e-22   Capitella teleta
ref|XP_006740281.1|  PREDICTED: endoplasmin isoform X2                  105   1e-22   
dbj|BAD92771.1|  tumor rejection antigen (gp96) 1 variant               104   1e-22   Homo sapiens [man]
ref|XP_007619353.1|  PREDICTED: endoplasmin                             105   1e-22   
ref|XP_005068020.1|  PREDICTED: endoplasmin                             105   1e-22   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003505898.1|  PREDICTED: endoplasmin                             105   1e-22   Cricetulus griseus [Chinese hamsters]
ref|XP_395614.3|  PREDICTED: endoplasmin-like isoform 1                 105   1e-22   Apis mellifera [bee]
ref|XP_003405348.1|  PREDICTED: endoplasmin                             105   1e-22   Loxodonta africana [African bush elephant]
gb|ELK10318.1|  Endoplasmin                                             105   1e-22   Pteropus alecto
ref|NP_035761.1|  endoplasmin precursor                                 105   1e-22   Mus musculus [mouse]
ref|XP_005358282.1|  PREDICTED: endoplasmin                             105   1e-22   Microtus ochrogaster [prairie voles]
gb|ELR54024.1|  Endoplasmin                                             105   1e-22   Bos mutus
ref|NP_777125.1|  endoplasmin precursor                                 105   1e-22   Bos taurus [bovine]
gb|AAH10445.1|  Heat shock protein 90, beta (Grp94), member 1           105   1e-22   Mus musculus [mouse]
dbj|BAE29874.1|  unnamed protein product                                105   1e-22   Mus musculus [mouse]
ref|NP_001012197.2|  endoplasmin precursor                              105   1e-22   Rattus norvegicus [brown rat]
ref|XP_004743081.1|  PREDICTED: endoplasmin                             105   1e-22   
ref|XP_003401925.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin-...    105   1e-22   Bombus terrestris [large earth bumblebee]
ref|XP_004006728.1|  PREDICTED: endoplasmin                             105   1e-22   
gb|AFK46854.1|  unknown                                               98.2    1e-22   Medicago truncatula
ref|XP_006979926.1|  PREDICTED: endoplasmin                             105   1e-22   Peromyscus maniculatus bairdii
gb|EFB13451.1|  hypothetical protein PANDA_003512                       105   2e-22   Ailuropoda melanoleuca
ref|XP_008703910.1|  PREDICTED: endoplasmin                             105   2e-22   Ursus maritimus [white bear]
ref|XP_006769416.1|  PREDICTED: endoplasmin                             105   2e-22   Myotis davidii
ref|XP_003269991.2|  PREDICTED: endoplasmin                             105   2e-22   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001182453.1|  heat shock protein 90kDa beta (Grp94), membe...    105   2e-22   Macaca mulatta [rhesus macaque]
ref|XP_007893493.1|  PREDICTED: endoplasmin                             105   2e-22   Callorhinchus milii [Australian ghost shark]
ref|XP_008568503.1|  PREDICTED: endoplasmin                             105   2e-22   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001233416.1|  endoplasmin precursor                              105   2e-22   Pan troglodytes
ref|XP_008002644.1|  PREDICTED: endoplasmin                             105   2e-22   Chlorocebus sabaeus
gb|EHH21126.1|  hypothetical protein EGK_04124                          105   2e-22   Macaca mulatta [rhesus macaque]
ref|NP_001003327.1|  endoplasmin precursor                              105   2e-22   Canis lupus familiaris [dogs]
ref|XP_006934044.1|  PREDICTED: endoplasmin                             105   2e-22   
ref|XP_006888611.1|  PREDICTED: endoplasmin                             105   2e-22   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005865309.1|  PREDICTED: endoplasmin                             105   2e-22   Myotis brandtii
ref|XP_006740280.1|  PREDICTED: endoplasmin isoform X1                  105   2e-22   Leptonychotes weddellii
ref|NP_003290.1|  endoplasmin precursor                                 105   2e-22   Homo sapiens [man]
ref|NP_001127573.1|  endoplasmin precursor                              105   2e-22   Pongo abelii [orang utan]
ref|XP_003929672.1|  PREDICTED: endoplasmin                             105   2e-22   Saimiri boliviensis boliviensis
ref|XP_004053833.1|  PREDICTED: endoplasmin                             105   2e-22   
ref|XP_006084129.1|  PREDICTED: endoplasmin                             105   2e-22   Myotis lucifugus
ref|XP_011218345.1|  PREDICTED: endoplasmin isoform X2                  105   2e-22   
ref|XP_006141474.1|  PREDICTED: endoplasmin                             105   2e-22   Tupaia chinensis
gb|EHA99498.1|  Endoplasmin                                             105   2e-22   Heterocephalus glaber [naked mole rat]
ref|XP_008142964.1|  PREDICTED: endoplasmin                             105   2e-22   Eptesicus fuscus
ref|XP_002915502.1|  PREDICTED: endoplasmin isoform X1                  105   2e-22   Ailuropoda melanoleuca
emb|CAI64497.1|  tumor rejection antigen (gp96) 1                       105   2e-22   Homo sapiens [man]
ref|XP_011385167.1|  PREDICTED: endoplasmin                             105   2e-22   
gb|EPY74066.1|  endoplasmin precursor                                   104   2e-22   Camelus ferus
ref|XP_005322404.1|  PREDICTED: endoplasmin                             105   2e-22   Ictidomys tridecemlineatus
ref|XP_004879102.1|  PREDICTED: endoplasmin                             105   2e-22   
ref|XP_003783342.1|  PREDICTED: endoplasmin-like                        105   2e-22   Otolemur garnettii
ref|XP_004418096.1|  PREDICTED: endoplasmin                             105   2e-22   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AAQ02595.1|  tumor rejection antigen 1gp96                           105   2e-22   synthetic construct
ref|XP_003493872.1|  PREDICTED: endoplasmin-like                        105   2e-22   Bombus impatiens
ref|XP_003694125.1|  PREDICTED: endoplasmin-like                        105   2e-22   Apis florea [dwarf honeybee]
ref|NP_001157345.1|  glucose-regulated protein precursor                104   2e-22   Equus caballus [domestic horse]
ref|XP_004844893.1|  PREDICTED: endoplasmin isoform X1                  105   2e-22   
gb|EHH66650.1|  hypothetical protein EGM_03684                          104   2e-22   Macaca fascicularis [crab eating macaque]
ref|XP_010629639.1|  PREDICTED: endoplasmin                             104   2e-22   Fukomys damarensis [Damara mole rat]
gb|EPQ07146.1|  Endoplasmin                                             104   2e-22   Myotis brandtii
emb|CAA62352.1|  protein kinase                                         104   2e-22   Sus scrofa [pigs]
ref|XP_006193753.1|  PREDICTED: endoplasmin                             104   2e-22   Camelus ferus
ref|XP_006205953.1|  PREDICTED: endoplasmin                             104   2e-22   Vicugna pacos
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       104   2e-22   Ostreococcus tauri
sp|Q29092.3|ENPL_PIG  RecName: Full=Endoplasmin; AltName: Full=94...    104   3e-22   Sus scrofa [pigs]
ref|XP_004623907.1|  PREDICTED: endoplasmin                             104   3e-22   Octodon degus
ref|XP_008666260.1|  PREDICTED: endoplasmin homolog                   96.7    3e-22   Zea mays [maize]
gb|KHN71590.1|  Endoplasmin                                             104   3e-22   Toxocara canis
ref|XP_004589651.1|  PREDICTED: endoplasmin                             104   3e-22   Ochotona princeps [southern American pika]
ref|XP_005374635.1|  PREDICTED: endoplasmin                             104   3e-22   Chinchilla lanigera
ref|XP_005680600.1|  PREDICTED: endoplasmin                             104   3e-22   
ref|XP_009019107.1|  hypothetical protein HELRODRAFT_157169             104   3e-22   Helobdella robusta
ref|XP_006619420.1|  PREDICTED: endoplasmin-like                        104   3e-22   Apis dorsata [rock honeybee]
ref|XP_007454336.1|  PREDICTED: endoplasmin                             104   3e-22   Lipotes vexillifer [baiji]
ref|XP_005984835.1|  PREDICTED: endoplasmin                             104   3e-22   
ref|XP_004602837.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        103   4e-22   Sorex araneus [Eurasian shrew]
ref|XP_007950582.1|  PREDICTED: endoplasmin                             103   4e-22   Orycteropus afer afer
ref|NP_999268.1|  endoplasmin precursor                                 103   4e-22   Sus scrofa [pigs]
gb|ELK25961.1|  Endoplasmin                                             104   4e-22   Myotis davidii
ref|XP_008062311.1|  PREDICTED: endoplasmin isoform X1                  103   4e-22   
ref|XP_002428463.1|  Hsp90 protein, putative                            103   4e-22   Pediculus humanus corporis [human body lice]
ref|XP_001365625.1|  PREDICTED: endoplasmin                             103   5e-22   Monodelphis domestica
ref|XP_002117847.1|  hypothetical protein TRIADDRAFT_64388              103   5e-22   Trichoplax adhaerens
ref|XP_004675798.1|  PREDICTED: endoplasmin                             103   5e-22   
ref|XP_003202424.1|  PREDICTED: endoplasmin                             103   5e-22   Meleagris gallopavo [common turkey]
ref|XP_008841379.1|  PREDICTED: endoplasmin                             103   5e-22   Nannospalax galili
gb|KFM57735.1|  Endoplasmin                                             103   6e-22   Stegodyphus mimosarum
ref|XP_008255217.1|  PREDICTED: endoplasmin                             103   6e-22   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003461118.1|  PREDICTED: endoplasmin isoform X1                  103   7e-22   Cavia porcellus [guinea pig]
ref|XP_006871146.1|  PREDICTED: endoplasmin                             103   8e-22   Chrysochloris asiatica
gb|AAA48827.1|  108K heat shock protein                                 102   9e-22   Gallus gallus [bantam]
ref|XP_971540.1|  PREDICTED: endoplasmin                                102   9e-22   Tribolium castaneum [rust-red flour beetle]
ref|XP_009065664.1|  hypothetical protein LOTGIDRAFT_197084             102   9e-22   Lottia gigantea
ref|XP_001899398.1|  Endoplasmin precursor                              102   9e-22   Brugia malayi [agent of lymphatic filariasis]
gb|AAK74072.1|  heat shock protein gp96 precursor                       102   1e-21   Homo sapiens [man]
emb|CAA28629.1|  hsp 108                                                102   1e-21   Gallus gallus [bantam]
ref|XP_007527982.1|  PREDICTED: endoplasmin                             102   1e-21   Erinaceus europaeus [common hedgehog]
gb|ACF35012.1|  heat shock protein 108                                  102   1e-21   Gallus gallus [bantam]
ref|XP_002752963.1|  PREDICTED: endoplasmin                             102   1e-21   Callithrix jacchus [common marmoset]
ref|NP_989620.1|  endoplasmin precursor                                 102   1e-21   Gallus gallus [bantam]
dbj|BAI23208.1|  heat shock protein 90kDa beta (Grp94), member 1        102   1e-21   Coturnix japonica
ref|XP_004999393.1|  PREDICTED: endoplasmin isoform X2                  102   1e-21   
ref|XP_009861771.1|  PREDICTED: endoplasmin-like                        102   1e-21   Ciona intestinalis [sea vase]
ref|XP_004700402.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin        102   1e-21   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004446859.1|  PREDICTED: endoplasmin isoform 1                   102   1e-21   
ref|XP_004349108.2|  glucose-regulated protein 94                       102   1e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_010219153.1|  PREDICTED: endoplasmin-like                      99.4    1e-21   Tinamus guttatus
ref|XP_004650619.1|  PREDICTED: endoplasmin                             102   1e-21   
ref|XP_007438500.1|  PREDICTED: endoplasmin                             102   1e-21   Python bivittatus
ref|XP_004446860.1|  PREDICTED: endoplasmin isoform 2                   102   1e-21   
emb|CAG08708.1|  unnamed protein product                                102   1e-21   Tetraodon nigroviridis
emb|CBN74418.1|  Heat shock protein 90                                  102   2e-21   Ectocarpus siliculosus
ref|XP_006039346.1|  PREDICTED: endoplasmin-like                      99.4    2e-21   
gb|KJB63273.1|  hypothetical protein B456_010G0030002                 97.1    2e-21   Gossypium raimondii
ref|NP_001083114.1|  uncharacterized protein LOC398753 precursor        102   2e-21   Xenopus laevis [clawed frog]
ref|NP_001039228.1|  heat shock protein 90kDa beta (Grp94), membe...    102   2e-21   Xenopus tropicalis [western clawed frog]
gb|KDR24512.1|  Endoplasmin                                             101   2e-21   Zootermopsis nevadensis
ref|XP_003701264.1|  PREDICTED: endoplasmin-like                        101   2e-21   Megachile rotundata
gb|KFB42185.1|  AGAP001424-PA-like protein                              101   2e-21   Anopheles sinensis
ref|XP_005782556.1|  hypothetical protein EMIHUDRAFT_449776             101   2e-21   Emiliania huxleyi CCMP1516
gb|AEE63339.1|  unknown                                                 101   3e-21   Dendroctonus ponderosae
gb|ERL91651.1|  hypothetical protein D910_08979                         101   3e-21   Dendroctonus ponderosae
gb|ENN73291.1|  hypothetical protein YQE_10055                          101   3e-21   Dendroctonus ponderosae
ref|XP_005100278.1|  PREDICTED: mesocentin-like                         102   3e-21   
gb|KFP71026.1|  Endoplasmin                                             100   3e-21   
ref|XP_001599282.1|  PREDICTED: endoplasmin                             101   3e-21   
ref|XP_006782653.1|  PREDICTED: endoplasmin-like                        101   3e-21   
ref|XP_321706.5|  AGAP001424-PA                                         101   3e-21   
ref|XP_003772640.1|  PREDICTED: endoplasmin-like                        101   4e-21   
ref|XP_003745792.1|  PREDICTED: endoplasmin-like                        101   4e-21   
gb|EFX71215.1|  hypothetical protein DAPPUDRAFT_309186                  101   4e-21   
ref|NP_937853.1|  endoplasmin precursor                                 100   4e-21   
ref|NP_001084280.1|  heat shock protein 90kDa beta (Grp94), membe...    100   4e-21   
gb|ETE69540.1|  Endoplasmin                                             101   4e-21   
ref|XP_641313.1|  heat shock protein Hsp90 family protein               100   4e-21   
ref|XP_005651682.1|  heat shock protein Hsp90                           100   4e-21   
ref|XP_001637407.1|  predicted protein                                  100   4e-21   
dbj|BAA94290.2|  glucose-regulated protein 94                           100   5e-21   
sp|Q9NKX1.2|ENPL_DICDI  RecName: Full=Endoplasmin homolog; AltNam...    100   5e-21   
gb|KFP55508.1|  Endoplasmin                                             100   5e-21   
ref|XP_009700867.1|  PREDICTED: endoplasmin                             100   5e-21   
ref|XP_001662951.1|  AAEL012827-PA                                      100   6e-21   
ref|XP_011402246.1|  Endoplasmin-like protein                           100   6e-21   
ref|XP_011474862.1|  PREDICTED: endoplasmin                             100   7e-21   
gb|KFP21894.1|  Endoplasmin                                             100   7e-21   
gb|KFP37272.1|  Endoplasmin                                             100   8e-21   
ref|XP_003220951.1|  PREDICTED: endoplasmin                             100   9e-21   
gb|KFQ43502.1|  Endoplasmin                                             100   9e-21   
gb|ETN62729.1|  endoplasmin                                             100   1e-20   
ref|XP_002413149.1|  tumor rejection antigen (gp96), putative           100   1e-20   
gb|AAI29529.1|  Unknown (protein for MGC:160189)                      99.8    1e-20   
gb|AAW25122.1|  SJCHGC06677 protein                                   99.8    1e-20   
ref|XP_005310776.1|  PREDICTED: endoplasmin                           99.8    1e-20   
ref|XP_001844128.1|  endoplasmin                                      99.8    1e-20   
ref|XP_008310403.1|  PREDICTED: endoplasmin                           99.8    1e-20   
ref|XP_011330408.1|  PREDICTED: endoplasmin                           99.4    1e-20   
gb|KFP29919.1|  Endoplasmin                                           99.4    1e-20   
dbj|BAF63637.1|  glucose-regulated protein 94                         99.4    2e-20   
gb|KFQ97565.1|  Endoplasmin                                           99.4    2e-20   
ref|XP_005527932.1|  PREDICTED: endoplasmin                           99.4    2e-20   
ref|XP_002199813.1|  PREDICTED: endoplasmin                           99.4    2e-20   
gb|KFV06212.1|  Endoplasmin                                           99.4    2e-20   
ref|XP_009464118.1|  PREDICTED: endoplasmin                           99.4    2e-20   
gb|KFQ54644.1|  Endoplasmin                                           99.4    2e-20   
gb|KFU95780.1|  Endoplasmin                                           99.4    2e-20   
ref|XP_009560285.1|  PREDICTED: endoplasmin                           99.4    2e-20   
gb|EMC80264.1|  Endoplasmin                                           99.4    2e-20   
gb|KFV83935.1|  Endoplasmin                                           99.4    2e-20   
gb|KFM13671.1|  Endoplasmin                                           99.4    2e-20   
gb|KFO76957.1|  Endoplasmin                                           99.4    2e-20   
gb|KFV41897.1|  Endoplasmin                                           99.4    2e-20   
gb|KFQ78325.1|  Endoplasmin                                           99.4    2e-20   
gb|KFO61201.1|  Endoplasmin                                           99.4    2e-20   
gb|KFZ45999.1|  Endoplasmin                                           99.4    2e-20   
gb|KFQ37930.1|  Endoplasmin                                           99.4    2e-20   
gb|KFV74906.1|  Endoplasmin                                           99.4    2e-20   
ref|XP_009906642.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin      99.4    2e-20   
ref|XP_006588134.1|  PREDICTED: endoplasmin homolog                   93.2    2e-20   
gb|KFQ80494.1|  Endoplasmin                                           99.4    2e-20   
gb|KFW73460.1|  Endoplasmin                                           99.0    2e-20   
ref|NP_001146348.1|  shepherd-like1                                   99.0    2e-20   
gb|KFQ04275.1|  Endoplasmin                                           99.0    2e-20   
gb|KFV91223.1|  Endoplasmin                                           99.0    2e-20   
ref|XP_010564611.1|  PREDICTED: endoplasmin                           99.0    2e-20   
ref|XP_003443932.1|  PREDICTED: endoplasmin-like                      99.0    2e-20   
gb|KFW84338.1|  Endoplasmin                                           99.0    2e-20   
ref|XP_009917591.1|  PREDICTED: endoplasmin                           99.0    2e-20   
gb|KFP75492.1|  Endoplasmin                                           99.0    2e-20   
ref|XP_005494809.1|  PREDICTED: endoplasmin                           99.0    2e-20   
ref|XP_010195758.1|  PREDICTED: endoplasmin                           99.0    2e-20   
ref|XP_003140246.1|  endoplasmin                                      99.0    2e-20   
ref|XP_005929149.1|  PREDICTED: endoplasmin-like                      99.0    2e-20   
gb|KFO95435.1|  Endoplasmin                                           99.0    2e-20   
ref|XP_008559868.1|  PREDICTED: endoplasmin                           99.0    2e-20   
gb|AAK69350.1|AF387865_1  heat shock protein 108                      99.0    2e-20   
ref|XP_009286695.1|  PREDICTED: endoplasmin                           99.0    2e-20   
ref|XP_005728136.1|  PREDICTED: endoplasmin-like                      99.0    2e-20   
ref|XP_005040044.1|  PREDICTED: endoplasmin isoform X2                99.0    2e-20   
gb|KFP99533.1|  Endoplasmin                                           99.0    2e-20   
ref|XP_006633152.1|  PREDICTED: endoplasmin-like                      99.0    2e-20   
ref|XP_010409181.1|  PREDICTED: endoplasmin                           99.0    2e-20   
ref|XP_005022616.1|  PREDICTED: endoplasmin                           98.6    3e-20   
ref|XP_005500402.1|  PREDICTED: endoplasmin                           99.0    3e-20   
ref|XP_004567801.1|  PREDICTED: endoplasmin-like                      98.6    3e-20   
gb|KFO89906.1|  Endoplasmin                                           98.6    3e-20   
gb|KFU98338.1|  Endoplasmin                                           98.6    3e-20   
ref|XP_005150492.1|  PREDICTED: endoplasmin                           98.6    3e-20   
ref|XP_005040043.1|  PREDICTED: endoplasmin isoform X1                98.6    3e-20   
ref|XP_010073947.1|  PREDICTED: endoplasmin                           98.6    3e-20   
ref|XP_005796337.1|  PREDICTED: endoplasmin-like                      98.6    3e-20   
ref|XP_006138079.1|  PREDICTED: endoplasmin                           98.6    3e-20   
ref|NP_001274194.1|  heat shock protein 90kDa beta (Grp94), membe...  98.6    3e-20   
gb|KGL95273.1|  Endoplasmin                                           98.6    3e-20   
gb|ACS75351.1|  endoplasmin                                           98.2    4e-20   
gb|KFO04912.1|  Endoplasmin                                           98.2    4e-20   
ref|XP_008281449.1|  PREDICTED: endoplasmin                           98.2    4e-20   
ref|XP_001507634.2|  PREDICTED: endoplasmin                           98.2    4e-20   
ref|XP_009942600.1|  PREDICTED: endoplasmin                           98.2    4e-20   
ref|XP_007541888.1|  PREDICTED: endoplasmin                           98.2    4e-20   
gb|KHG15193.1|  Endoplasmin                                           97.8    4e-20   
gb|KFR02424.1|  Endoplasmin                                           98.2    5e-20   
gb|ABG56395.1|  glucose-regulated protein 94                          97.8    5e-20   
ref|XP_011444480.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.6    5e-20   
ref|XP_011085393.1|  PREDICTED: heat shock protein 83                 97.8    5e-20   
gb|EPS70213.1|  hypothetical protein M569_04546                       96.3    6e-20   
gb|KFQ16767.1|  Endoplasmin                                           97.8    6e-20   
ref|NP_001181938.1|  94 kD glucose-regulated protein precursor        97.8    6e-20   
ref|XP_008934413.1|  PREDICTED: endoplasmin                           97.8    6e-20   
emb|CDG41617.1|  GRP94a protein                                       97.8    6e-20   
ref|XP_011212529.1|  PREDICTED: endoplasmin                           97.4    7e-20   
ref|XP_005180198.1|  PREDICTED: endoplasmin                           97.4    7e-20   
gb|ADA70351.1|  heat shock protein                                    97.4    7e-20   
emb|CDQ84254.1|  unnamed protein product                              97.4    8e-20   
gb|EYU43186.1|  hypothetical protein MIMGU_mgv1a001565mg              97.4    8e-20   
ref|XP_011061023.1|  PREDICTED: endoplasmin                           97.4    8e-20   
ref|XP_008788962.1|  PREDICTED: heat shock protein 83-like            97.1    9e-20   
gb|KFK33530.1|  hypothetical protein AALP_AA5G025000                  97.1    9e-20   
ref|XP_002072044.1|  GK22636                                          97.1    9e-20   
ref|XP_003967565.1|  PREDICTED: endoplasmin-like                      97.1    1e-19   
gb|KFZ55452.1|  Endoplasmin                                           97.1    1e-19   
gb|ADQ86002.1|  90 kDa heat shock protein                             91.3    1e-19   
gb|ADQ86000.1|  90 kDa heat shock protein                             91.3    1e-19   
gb|AGZ62517.1|  90 kDa heat shock protein                             91.3    1e-19   
gb|ADQ86003.1|  90 kDa heat shock protein                             90.9    1e-19   
gb|AFD53629.1|  90 kDa heat shock protein                             91.3    1e-19   
dbj|BAF01546.1|  heat shock like protein                              94.0    1e-19   
gb|ADQ86001.1|  90 kDa heat shock protein                             91.3    1e-19   
ref|XP_008671461.1|  PREDICTED: endoplasmin homolog                   91.3    1e-19   
ref|XP_002999135.1|  heat shock protein 90, putative                  96.7    1e-19   
gb|AHG52035.1|  90 kDa heat shock protein                             91.3    1e-19   
gb|ADQ85999.1|  90 kDa heat shock protein                             91.3    1e-19   
ref|XP_004293459.1|  PREDICTED: heat shock protein 90-1               96.7    1e-19   
gb|AFD53634.1|  90 kDa heat shock protein                             90.9    2e-19   
ref|XP_003288550.1|  hypothetical protein DICPUDRAFT_98061            96.3    2e-19   
gb|ADQ85998.1|  90 kDa heat shock protein                             90.9    2e-19   
gb|AHK14392.1|  90 kDa heat shock protein                             90.9    2e-19   
gb|AAF66929.1|AF217404_1  endoplasmin                                 96.3    2e-19   
gb|AFD53632.1|  90 kDa heat shock protein                             90.9    2e-19   
ref|XP_008656190.1|  PREDICTED: endoplasmin homolog                   89.4    2e-19   
gb|KDO70251.1|  hypothetical protein CISIN_1g0038271mg                94.0    2e-19   
emb|CEF70962.1|  Glycoprotein 93                                      96.3    2e-19   
gb|AFI80882.1|  SR00034                                               95.9    2e-19   
ref|XP_004358722.1|  heat shock protein Hsp90 family protein          95.9    2e-19   
ref|XP_002012968.1|  GL23644                                          95.9    2e-19   
gb|KDO70248.1|  hypothetical protein CISIN_1g0038271mg                94.0    2e-19   
gb|AAG21337.1|AF273735_1  hypothetical esophageal gland cell secr...  90.9    2e-19   
ref|XP_001358252.1|  GA18946                                          95.9    2e-19   
ref|XP_011155603.1|  PREDICTED: endoplasmin                           95.9    2e-19   
ref|XP_006004184.1|  PREDICTED: endoplasmin isoform X2                95.9    2e-19   
ref|XP_006004183.1|  PREDICTED: endoplasmin isoform X1                95.9    2e-19   
ref|XP_003617951.1|  Heat-shock protein                               95.9    3e-19   
ref|XP_010901527.1|  PREDICTED: endoplasmin-like                      95.9    3e-19   
emb|CDY33122.1|  BnaC09g22180D                                        95.5    4e-19   
ref|XP_010943343.1|  PREDICTED: heat shock protein 83-like            95.5    4e-19   
ref|XP_008229890.1|  PREDICTED: heat shock protein 90-1               95.5    4e-19   
ref|XP_010755578.1|  PREDICTED: endoplasmin isoform X1                95.5    4e-19   
ref|XP_007214966.1|  hypothetical protein PRUPE_ppa001503mg           95.5    4e-19   
ref|NP_999808.1|  heat shock protein gp96 precursor                   95.5    4e-19   
gb|EKC38233.1|  Endoplasmin                                           95.5    4e-19   
ref|XP_003575983.1|  PREDICTED: heat shock protein 83                 95.5    4e-19   
ref|XP_007252443.1|  PREDICTED: endoplasmin-like isoform X1           95.1    4e-19   
ref|XP_001746031.1|  hypothetical protein                             95.1    4e-19   
ref|XP_011152996.1|  PREDICTED: endoplasmin                           95.1    4e-19   
ref|XP_007252444.1|  PREDICTED: endoplasmin-like isoform X2           95.1    4e-19   
ref|XP_004523400.1|  PREDICTED: endoplasmin-like                      95.1    4e-19   
emb|CCD78748.1|  putative endoplasmin                                 95.9    4e-19   
ref|XP_006299404.1|  hypothetical protein CARUB_v10015564mg           95.1    4e-19   
gb|EMS64316.1|  Heat shock protein 83                                 95.1    4e-19   
ref|XP_011260972.1|  PREDICTED: endoplasmin                           95.1    4e-19   
dbj|BAK01596.1|  predicted protein                                    95.1    5e-19   
gb|EMT31740.1|  Heat shock protein 83                                 95.1    5e-19   
ref|XP_006395659.1|  hypothetical protein EUTSA_v10003676mg           95.1    5e-19   
ref|XP_011186065.1|  PREDICTED: endoplasmin                           94.7    5e-19   
ref|XP_010457327.1|  PREDICTED: heat shock protein 90-1-like          94.7    6e-19   
gb|ADQ85997.1|  90 kDa heat shock protein                             89.7    6e-19   
ref|XP_010528013.1|  PREDICTED: heat shock protein 90-1-like isof...  94.7    6e-19   
ref|XP_008620345.1|  heat shock protein 90kDa beta                    94.7    6e-19   
gb|ADQ85996.1|  90 kDa heat shock protein                             89.7    6e-19   
ref|XP_010528014.1|  PREDICTED: heat shock protein 90-1-like isof...  94.7    6e-19   
ref|XP_010464416.1|  PREDICTED: heat shock protein 90-1-like          94.7    6e-19   
ref|XP_010486347.1|  PREDICTED: heat shock protein 90-1-like          94.7    6e-19   
emb|CCD78746.1|  putative endoplasmin                                 95.1    7e-19   
ref|XP_010657448.1|  PREDICTED: heat shock protein 83 isoform X3      94.7    7e-19   
pdb|2ESA|A  Chain A, Grp94 N-Terminal Domain Bound To Geldanamyci...  90.9    7e-19   
ref|XP_004140007.1|  PREDICTED: endoplasmin homolog                   94.4    7e-19   
ref|XP_010657447.1|  PREDICTED: heat shock protein 83 isoform X1      94.7    7e-19   
ref|XP_002270014.3|  PREDICTED: heat shock protein 83 isoform X2      94.7    8e-19   
pdb|1U2O|A  Chain A, Crystal Structure Of The N-Domain Of Grp94 L...  90.9    8e-19   
ref|XP_004169550.1|  PREDICTED: endoplasmin homolog                   94.4    8e-19   
ref|XP_009605137.1|  PREDICTED: heat shock protein 83                 94.4    8e-19   
ref|XP_010885352.1|  PREDICTED: endoplasmin                           94.4    9e-19   
ref|XP_009418533.1|  PREDICTED: heat shock protein 83-like            94.4    9e-19   
emb|CDQ78594.1|  unnamed protein product                              94.4    9e-19   
ref|XP_010681165.1|  PREDICTED: heat shock protein 90-1 isoform X2    94.4    9e-19   
ref|XP_010681164.1|  PREDICTED: heat shock protein 90-1 isoform X1    94.4    9e-19   
ref|XP_002056124.1|  GJ10398                                          94.4    9e-19   
gb|KDO21013.1|  hypothetical protein SPRG_13941                       94.4    1e-18   
emb|CDW52501.1|  endoplasmin                                          94.4    1e-18   
ref|XP_010927989.1|  PREDICTED: heat shock protein 83-like isofor...  94.0    1e-18   
ref|XP_008464175.1|  PREDICTED: heat shock protein 81-1               94.0    1e-18   
ref|XP_002535115.1|  heat shock protein, putative                     90.1    1e-18   
gb|EGT36283.1|  hypothetical protein CAEBREN_28043                    94.0    1e-18   
ref|XP_010684690.1|  PREDICTED: heat shock protein 83-like            94.0    1e-18   
ref|XP_007045726.1|  Chaperone protein htpG family protein isoform 1  94.0    1e-18   
gb|KGB37387.1|  Endoplasmin                                           94.0    1e-18   
ref|XP_006484274.1|  PREDICTED: heat shock protein 83-like            94.0    1e-18   
ref|XP_010665948.1|  PREDICTED: heat shock protein 83                 94.0    1e-18   
ref|XP_007045727.1|  Chaperone protein htpG family protein isoform 2  94.0    1e-18   
dbj|BAJ98551.1|  predicted protein                                    94.0    1e-18   
ref|XP_011048941.1|  PREDICTED: heat shock protein 83 isoform X3      94.0    1e-18   
ref|XP_006437833.1|  hypothetical protein CICLE_v10030743mg           94.0    1e-18   
ref|XP_011048939.1|  PREDICTED: heat shock protein 83 isoform X2      94.0    1e-18   
ref|XP_011048938.1|  PREDICTED: heat shock protein 83 isoform X1      94.0    1e-18   
ref|XP_002321183.2|  hypothetical protein POPTR_0014s16280g           94.0    1e-18   
pdb|4NH9|A  Chain A, Correlation Between Chemotype-dependent Bind...  90.9    1e-18   
pdb|1QY5|A  Chain A, Crystal Structure Of The N-Domain Of The Er ...  90.5    1e-18   
pdb|1U0Y|A  Chain A, N-Domain Of Grp94, With The Charged Domain, ...  90.5    1e-18   
ref|XP_010554255.1|  PREDICTED: heat shock protein 90-1               93.6    1e-18   
ref|NP_849932.1|  chloroplast heat shock protein 90                   93.6    1e-18   
ref|NP_178487.1|  chloroplast heat shock protein 90                   93.6    1e-18   
gb|AFM30925.1|  chloroplast heat shock protein 90                     87.8    1e-18   
gb|KGL81577.1|  Endoplasmin                                           89.7    1e-18   
gb|AAM19795.1|  At2g04030/F3C11.14                                    93.6    1e-18   
ref|XP_004957103.1|  PREDICTED: endoplasmin homolog                   93.6    2e-18   
ref|XP_009394558.1|  PREDICTED: heat shock protein 83-like            93.6    2e-18   



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW VPAVLFLLCLLFLLPDQGRKIHANAEVD+DAPVDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTVPAVLFLLCLLFLLPDQGRKIHANAEVDADAPVDPPKVEEKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRATAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDAP+DPPKVEEKIGGVP+GLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAPLDPPKVEEKIGGVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAESMS+RTLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRRTLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +2

Query  62   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  241
            TMRKW +P+VLFLLCLLFLLPDQGRKI ANAEVDSDA VDPPKVEEK+G VPHGLSTD D
Sbjct  70   TMRKWTIPSVLFLLCLLFLLPDQGRKIQANAEVDSDAAVDPPKVEEKLGAVPHGLSTDSD  129

Query  242  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
            V KREAESMS+R LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  130  VVKREAESMSRRNLRTNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  189

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFLSLTDK+ILGEGD AKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  190  RFLSLTDKEILGEGDDAKLEIQIKLDKEKKILSIRDRGIGMT  231



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGRKIHANAE DSD P+DPPKVEEKIG VPHGLSTD +V
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRKIHANAEADSDVPLDPPKVEEKIGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAESMS++TLRA A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESMSRKTLRASAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+ KILSIRDRG+GMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKENKILSIRDRGVGMT  161



>ref|XP_009596271.1| PREDICTED: endoplasmin homolog, partial [Nicotiana tomentosiformis]
Length=644

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKLGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  +LEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTELEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SDAPVDPPKVEEK G VPHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDAPVDPPKVEEKFGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW VP+VLFLLC       QGRKIHANAE DSDAPVDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTVPSVLFLLCPSLSSSCQGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAESMS R LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSMRNLRSDAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLALTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P VLFLLCL++L+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWKIPFVLFLLCLIYLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD  KLEIQIKLDK+KKILSIRDRG+GMT
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGVGMT  161



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P VLFLLCL+FL+PDQGRKI ANAE DSDAPVDPPKVEEK G VP+GLSTD DV
Sbjct  1    MRKWTIPFVLFLLCLIFLVPDQGRKIQANAEADSDAPVDPPKVEEKFGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAESMS++TLRA AEKFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSRKTLRASAEKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD  KLEIQIKLDK+KKIL IRDRG+GMT
Sbjct  121  FLALTDKEVLGEGDNTKLEIQIKLDKEKKILFIRDRGVGMT  161



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMT  161



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD AKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMT  161



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL LLPDQGRKIHANAE DS+  V+PPKVEEKIG VP+GLSTD DV
Sbjct  266  MRKWTIPSALLLLCLLCLLPDQGRKIHANAEADSEELVNPPKVEEKIGAVPNGLSTDSDV  325

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR LRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  326  AKREAESISKRNLRANAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  385

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGDTAKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  386  FLSLTDKEILGEGDTAKLDIQIKLDKEKKILSIRDRGIGMT  426



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLFLLCLLFLLPDQGR+I ANAE +SD PVDPPKVEEK G +PHGLSTD DV
Sbjct  1    MRKWTIPSVLFLLCLLFLLPDQGRRIQANAEAESDVPVDPPKVEEKFGAIPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMS++TLRA AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSRKTLRADAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEG+  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGENTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 151/161 (94%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW + +VLFLLCLLFL PDQGRKIH NA+ DSDA VDPPKVEEKIG VP+GLSTD +V
Sbjct  1    MRKWTI-SVLFLLCLLFLFPDQGRKIHVNAKGDSDASVDPPKVEEKIGAVPNGLSTDSNV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAESMS+RTLRA AE+FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESMSRRTLRANAERFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD AKLE+QIKLDK+KKILSIRDRGIGMT
Sbjct  120  FLSLTDKEVLGEGDDAKLEMQIKLDKEKKILSIRDRGIGMT  160



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ LFLLCLLFLLPDQGRK+ ANAE  SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALFLLCLLFLLPDQGRKLQANAEGSSDDLVDPPKVEEKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDA+DKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAIDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEILGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LL LL L  DQG+K+ ANAE +SD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTIPSALLLLSLLLLFADQGQKLKANAEDNSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKDILGEGD AKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDILGEGDNAKLDIQIKLDKEKKILSIRDRGIGMT  161



>gb|KDO84888.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=507

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VLF +CL+FLLPDQGRK+HANA+  SD  VDPPKVEEK+GG+  GLSTD DV
Sbjct  1    MRKWTIPSVLFFVCLIFLLPDQGRKLHANADGSSDEVVDPPKVEEKVGGIHGGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
              RE+ESMSKRTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VHRESESMSKRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKD+LGEGD AKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDVLGEGDNAKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL ++ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSVISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LL LL LL DQG+K  ANAE +SD  VDPPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWTIPSTLLLLSLLLLLADQGQKFQANAEGNSDEIVDPPKVEEKLGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKDILGEGD AKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDILGEGDNAKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|KDO84887.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=584

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  238
            MRKWA+P+ L LL LL  +PD+GRK+HANAE   DSD  VDPPKVE+K+G VPHGLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTIPDRGRKLHANAEDSGDSDELVDPPKVEDKLGAVPHGLSTDS  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            +VAKREAES+S+RTLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRRTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFLSLTDK++LGEGD  KL+I IKLDK+KKILSIRDRGIGMT
Sbjct  121  IRFLSLTDKEVLGEGDNTKLDILIKLDKEKKILSIRDRGIGMT  163



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW VP+VL LLCLL L+ DQG+K+HA AE DSD+ VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTVPSVLLLLCLLSLISDQGQKLHAKAEDDSDSLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKRTLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRTLRNTAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD AKL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNAKLDIQIKLDKEKKILSIRDRGIGMT  161



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL L+ L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLVALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P++L LL LL L+PDQGR I A AE +SD  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSILLLLFLLALIPDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE DSD  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEADSDELVDPPKVEEKIGAVPSGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGD   LEIQIKLDK+K+I+SIRDRGIGMT
Sbjct  121  FLALTDKDVLGEGDDTNLEIQIKLDKEKRIISIRDRGIGMT  161



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMT
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMT  161



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GL+TD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLTTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+ R+ A+ FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSQRSNAQHFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGD  KLEIQIKLDK+K+ILSIRDRGIGMT
Sbjct  121  FLALTDKDVLGEGDNTKLEIQIKLDKEKRILSIRDRGIGMT  161



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDKD+LGEGD  KL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKDVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LL LL LLPDQG K+HA+AE +S+  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLLLLSLLPDQGHKLHASAE-ESEELVDPPKVEEKIGAVPNGLSTDSDV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   AKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGD  KLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  120  FLSLTDKEILGEGDNTKLEIQIKLDKEKKILSIRDRGIGMT  160



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V + L LL LLFL  DQGRK  ANAE DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASALLLLSLLFLFADQGRKFQANAEGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KL+IQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLDIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+VL LLCLL LLPDQGRK+ ANAE +SD  VDPPKVEEKIG VP+GLSTD DV
Sbjct  1    MRKWTIPSVLLLLCLLSLLPDQGRKLQANAEANSDELVDPPKVEEKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAESMSKR  R  A++FEFQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESMSKR--RGNAQQFEFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  118

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGD  KLEIQIKLDK+K+ILSIRDRGIGMT
Sbjct  119  FLSLTDKEILGEGDNTKLEIQIKLDKEKRILSIRDRGIGMT  159



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  238
            MRKWA+P+ L LL LL  +PD+GR +HANAE   DSD  VDPPKVEEK+G VP+GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSTVPDRGRNLHANAEDSGDSDELVDPPKVEEKLGAVPNGLSTDA  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            +VAKREAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   EVAKREAESISRKTLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFL+LTDKD+LGEGD  KL+I IKLDK+KKILSIRDRGIGMT
Sbjct  121  IRFLALTDKDVLGEGDDTKLDILIKLDKEKKILSIRDRGIGMT  163



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL L+ DQGR +HANAE DS  PVDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLISDQGRNLHANAEADSQNPVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSDAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEG+  KL+IQIKLDK+KKILSIRD+GIGMT
Sbjct  121  FLALTDKEVLGEGENTKLDIQIKLDKEKKILSIRDKGIGMT  161



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LL LL LLPDQG KIHANAE +S+  VDPPKVEEKIG VP GLSTD DV
Sbjct  1    MRKWMIPSALLLLLLLSLLPDQGHKIHANAE-ESEDLVDPPKVEEKIGAVPKGLSTDSDV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+SKR+LR+ AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   ARREAESISKRSLRSNAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLT+K+ILGEGD  KLEIQI LDK+KK+LSIRDRGIGMT
Sbjct  120  FLSLTNKEILGEGDNTKLEIQINLDKEKKVLSIRDRGIGMT  160



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            M+KW + + +FLLC+LFL PDQGR+IHANAE DSD   +PPKVEEK+G VP+GLSTD DV
Sbjct  1    MKKWTLTSAIFLLCILFLFPDQGRRIHANAEGDSDEIANPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ESMSK+TLR  A+KFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESMSKKTLRNSAQKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD AKLEI IKLDK+KKILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDNAKLEILIKLDKEKKILSIRDRGIGMT  161



>dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana]
Length=328

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            M KW +P+VL +LCLL  LPDQGRK+ ANAE DS+  VDPPKVEEK+G VP+GLSTD DV
Sbjct  1    MGKWTIPSVLLVLCLLCALPDQGRKLRANAEGDSEELVDPPKVEEKLGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR  AEKFEFQAEVSRLMDI++NSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRNSAEKFEFQAEVSRLMDILVNSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKDILGEGD  KLEIQ+K+DK+K+I+++RDRGIGMT
Sbjct  121  FLALTDKDILGEGDDTKLEIQMKVDKEKRIVTLRDRGIGMT  161



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 147/163 (90%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  238
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTDP
Sbjct  1    MRKWALPSALLLLLLLSFLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDP  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            DVAKREAES+S++TLR+ AEKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFLSLT+KDILGEGD  KLEI +KLDK+KKILSIRDRGIGMT
Sbjct  121  IRFLSLTNKDILGEGDNTKLEILMKLDKEKKILSIRDRGIGMT  163



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEDSSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD   LEIQIKLDK+K+ILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDDTNLEIQIKLDKEKRILSIRDRGIGMT  161



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW +P+ L LLCLL LLPDQGRK+ ANAE  S+  VDPPKVE+KIG VP+GLSTD DV
Sbjct  1    MRKWTIPSALLLLCLLSLLPDQGRKLQANAEGGSEELVDPPKVEDKIGAVPNGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKREAES+SKR+LR+ AE+F+FQAEVSRLMDIII+SLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AKREAESISKRSLRSNAEQFQFQAEVSRLMDIIIHSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGD   L+IQIKLDK+K+ILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDDTNLQIQIKLDKEKRILSIRDRGIGMT  161



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 144/162 (89%), Gaps = 1/162 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE-VDSDAPVDPPKVEEKIGGVPHGLSTDPD  241
            MRKWA+P+VL LL LL  LPDQGRKIHANAE  D D  VDPPKVEEKIG VP GLSTD D
Sbjct  1    MRKWALPSVLLLLVLLSTLPDQGRKIHANAEESDGDELVDPPKVEEKIGAVPSGLSTDSD  60

Query  242  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
            VAKREAES+S+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VAKREAESISRKSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFLSLTDK+ILGEGD  KLEI IKLDK+ K+LSIRDRGIGMT
Sbjct  121  RFLSLTDKEILGEGDNTKLEIMIKLDKENKVLSIRDRGIGMT  162



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V +VL LL LLFL  DQGRK  ANA  DSD  VDPPKVE+KIG VPHGLSTD DV
Sbjct  1    MRKWTVASVLLLLSLLFLFADQGRKFQANAAGDSDELVDPPKVEDKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAES+SKR+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISKRSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGD  KL+I+IKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDNTKLDIRIKLDKEKKILSIRDRGIGMT  161



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW + + L LLC+L L+PD+G + HA A+ D+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADGDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+SKR+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISKRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMT
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMT  161



>gb|AAX19870.1| unknown, partial [Doryanthes excelsa]
Length=289

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 1/141 (1%)
 Frame = +2

Query  125  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  304
            DQGRK+ ANAE +S+  VDPPKVEEK+G VP GLSTD DVAKREAES+S++TLR+ AEKF
Sbjct  23   DQGRKLQANAE-ESEELVDPPKVEEKLGAVPGGLSTDSDVAKREAESISRKTLRSSAEKF  81

Query  305  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  484
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+ILGEGD  KLEI
Sbjct  82   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEILGEGDNTKLEI  141

Query  485  qikldkdkkilsirdRGIGMT  547
             IKLDK+KKIL+IRDRGIGMT
Sbjct  142  LIKLDKEKKILTIRDRGIGMT  162



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/165 (81%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  59   VTMRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLST  232
            + MRKWA+P+ L LL LL   PDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLST
Sbjct  20   IAMRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLST  79

Query  233  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  412
            D DVAKREAES+S++TL + AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  80   DSDVAKREAESISRKTLGSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  139

Query  413  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            DKIRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMT
Sbjct  140  DKIRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMT  184



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  238
            MRKWA+P+ L LL LL   PDQGRK+HANAE   D+D   DPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSFPDQGRKLHANAEDSGDADELADPPKVEEKLGAVPGGLSTDS  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            DVAKREAES+S++TLR+ AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKTLRSNAEKFDFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMT
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMT  163



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW V ++L LLC+L +LPDQGRK   NAE + DA   PPKVEEKIGG+P GLSTD +V
Sbjct  1    MRKWTVTSILLLLCILLVLPDQGRKARVNAESEKDAATGPPKVEEKIGGIPSGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KREAES+S R LRA AEKF+FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKREAESISGRNLRAEAEKFQFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEG+ AKL+IQIKLDKDKKILS+RDRGIGMT
Sbjct  121  FLSLTDKEVLGEGENAKLDIQIKLDKDKKILSLRDRGIGMT  161



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD DV
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDI+LRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIYLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDAEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSSALLLLFLLTTLPDPAKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 141/165 (85%), Gaps = 4/165 (2%)
 Frame = +2

Query  65   MRKWAVP--AVlfllcllfllPDQGRKIHANAEV--DSDAPVDPPKVEEKIGGVPHGLST  232
            MR W++P   VL LL  L  +PD GRK+HANAE   D+D  VDPPKVEEKI GV  GLST
Sbjct  1    MRNWSIPPALVLLLLISLSAIPDGGRKLHANAEESRDADELVDPPKVEEKIAGVHGGLST  60

Query  233  DPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  412
            D DVAKREAESMS++ LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL
Sbjct  61   DADVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDAL  120

Query  413  DKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            DKIRFLSLTDK++LGEGD  KLEI IKLDK+KKILSIRDRGIGMT
Sbjct  121  DKIRFLSLTDKEVLGEGDNTKLEIMIKLDKEKKILSIRDRGIGMT  165



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NA+  +D  VDPPKVEE+IG VPHGLSTD +V
Sbjct  1    MRKWALASALLLLFLLTTLPDPAKKLQVNADDSADELVDPPKVEERIGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>gb|AFW75766.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=710

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ + L LL LL  LPD  +K+  NAE  S    +PPKVEEK G VPHGLSTD +V
Sbjct  1    MRKWALSSTLLLLFLLTTLPDPAKKLQVNAEESSHDLANPPKVEEKFGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            A+REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   AQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  161



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>gb|KJB63270.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=260

 Score =   191 bits (484),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMT  158



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSSAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>gb|KJB63271.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=264

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMT  158



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  160



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+ +   LL LL  LPD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V
Sbjct  1    MRKWAL-SSALLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  120  FLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  160



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAE--VDSDAPVDPPKVEEKIGGVPHGLSTDP  238
            MRKWA+P+ L LL LL  LPDQGRK+HANAE   DSD  VDPPKVEEK+G VP GLSTD 
Sbjct  1    MRKWALPSALLLLLLLSSLPDQGRKLHANAEDSGDSDELVDPPKVEEKLGAVPGGLSTDS  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            DVAKREAES+S++++R+  EKFEFQAEVSRL+DIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESISRKSMRSDGEKFEFQAEVSRLLDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFLSLT+K+ILGEGD  KLEI IKLDK+KKILSIRDRGIGMT
Sbjct  121  IRFLSLTNKEILGEGDNTKLEILIKLDKEKKILSIRDRGIGMT  163



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfll-PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  241
            MRKWA+ + L LL LL    PD  +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +
Sbjct  1    MRKWALSSALLLLLLLLTTLPDPAKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSE  60

Query  242  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
            V +REAES+S++TLR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVQREAESISRKTLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFL+LTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  121  RFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  162



>gb|KJB63272.1| hypothetical protein B456_010G0030002, partial [Gossypium raimondii]
Length=303

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 143/161 (89%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+P+ L LLCLL LL D GRK+  NAE   +  VDPPKVEEKIG VPHGL TD DV
Sbjct  1    MRKWAIPSALVLLCLLSLLSDHGRKVQVNAE---EGAVDPPKVEEKIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
            AKRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   AKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMT  158



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQG K+HANAE  SD   DPPKVEEKIGG   GLSTD DV  RE+ESMSK+TLR+ AEK
Sbjct  20   PDQGTKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRK  + +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKRTIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HGGLSTDSDV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
              RE+ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VHRESESISKKSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMT
Sbjct  120  FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMT  160



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEKLGG-HSGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKI+SIRDRGIGMT
Sbjct  139  IQIKLDKAKKIISIRDRGIGMT  160



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMT  158



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRK  + +VLFL+CL+FLLPDQGRK+HANAE  ++   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVLFLVCLVFLLPDQGRKLHANAEGSTEEYSDPPKVEEKLGG-HGGLSTDSDV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
              RE+ESMSKR+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VHRESESMSKRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMT
Sbjct  120  FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMT  160



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            M KW +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGKWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMT  158



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+   L L+ LL  LPD  +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDK+++GEGDTAKLEIQIKLDK+ KILSIRDRG+GMT
Sbjct  121  FLALTDKEVMGEGDTAKLEIQIKLDKENKILSIRDRGVGMT  161



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEE IGG   GLSTD DV  RE+ES+SK+TLR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVTDPPKVEEPIGG-HGGLSTDSDVVHRESESISKKTLRSSAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRK  + +V+FL  LLFLLP+QGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV
Sbjct  1    MRKKTIVSVMFLFSLLFLLPEQGRKLHANAEESSDDVTDPPKVEEKLGG-HGGLSTDSDV  59

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
              R +ES+SK++LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  60   VHRSSESISKKSLRSSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  119

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMT
Sbjct  120  FLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMT  160



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>tpg|DAA46734.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=377

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  134  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  313
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  493
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  494  ldkdkkilsirdRGIGMT  547
            LDK+KKILSIRDRGIGMT
Sbjct  258  LDKEKKILSIRDRGIGMT  275



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            M  W +P+ L LLCLL LL DQGRK+ ANA+   +  VDPPKVE+ IG VPHGL TD DV
Sbjct  1    MGNWTIPSALILLCLLSLLSDQGRKLQANAK---EGAVDPPKVEDNIGAVPHGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE++S+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESDSISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDT+KLEIQIKLDK+KK+LS+RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTSKLEIQIKLDKEKKMLSLRDRGIGMT  158



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAP--VDPPKVEEKIGGVPHGLSTDP  238
            MRK A+ + +FL+ LL LLP QGR + ANAE ++ A   VDPPKVEEKIG +P  LSTD 
Sbjct  1    MRKGAMTSAIFLVFLLALLPYQGRHLQANAEENNGAEGLVDPPKVEEKIGAIPDALSTDS  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            DVAKREAESMS+++LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAKREAESMSRKSLRGNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRFLSLTDK+ILGEGD  KLEI IKLDK+KK+LSIRDRGIGMT
Sbjct  121  IRFLSLTDKEILGEGDNTKLEILIKLDKEKKVLSIRDRGIGMT  163



>tpg|DAA46735.1| TPA: hypothetical protein ZEAMMB73_851694 [Zea mays]
Length=411

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  134  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  313
            +K+  NAE  SD   +PPKVEEK+G +PHGLSTD  VA+ EAES+S++TLR+ AEKFEFQ
Sbjct  138  KKLQVNAEESSDDLANPPKVEEKLGAIPHGLSTDSKVAQSEAESISRKTLRSSAEKFEFQ  197

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  493
            AEVSRLMDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIK
Sbjct  198  AEVSRLMDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIK  257

Query  494  ldkdkkilsirdRGIGMT  547
            LDK+KKILSIRDRGIGMT
Sbjct  258  LDKEKKILSIRDRGIGMT  275



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +2

Query  131  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  310
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  49   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  108

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  490
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  109  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  168

Query  491  kldkdkkilsirdRGIGMT  547
            KLDK+KKILSIRDRGIGMT
Sbjct  169  KLDKEKKILSIRDRGIGMT  187



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +2

Query  131  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  310
             +K+  NA+  +D  VDPPKVEEKIGGVPHGLSTD +V +REAES+S++TLR+ AEKFEF
Sbjct  50   AKKLQVNADDSTDELVDPPKVEEKIGGVPHGLSTDSEVVQREAESISRKTLRSSAEKFEF  109

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  490
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK++LGEGDTAKLEIQI
Sbjct  110  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQI  169

Query  491  kldkdkkilsirdRGIGMT  547
            KLDK+KKILSIRDRGIGMT
Sbjct  170  KLDKEKKILSIRDRGIGMT  188



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HANAE  SD   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHANAEDSSDEVSDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGD AKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDNAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKILSIRDRGIGMT
Sbjct  139  IQIKLDKAKKILSIRDRGIGMT  160



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 144/162 (89%), Gaps = 3/162 (2%)
 Frame = +2

Query  62   TMRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  241
            TMRKWA+P+ L LLCLL LL D GRK+ ANAE   +  VDPPKVEEKIG VPHGL TD D
Sbjct  19   TMRKWAIPSALVLLCLLSLLSDHGRKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSD  75

Query  242  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
            V KRE+ES+S R+LR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  76   VVKRESESISSRSLRNNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  135

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFLSLTDK++LGEGDT+KL+IQIKLDK+KKILS+RDRGIGMT
Sbjct  136  RFLSLTDKEVLGEGDTSKLDIQIKLDKEKKILSLRDRGIGMT  177



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEK  301
            PDQGRK+HA+AE  +D   DPPKVEEK+GG   GLSTD DV  RE+ES+SK++LR+ AEK
Sbjct  20   PDQGRKLHASAEDSTDEVTDPPKVEEKLGG-HGGLSTDSDVVHRESESISKKSLRSNAEK  78

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkle  481
            FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDKD+LGEGDTAKLE
Sbjct  79   FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKDVLGEGDTAKLE  138

Query  482  iqikldkdkkilsirdRGIGMT  547
            IQIKLDK KKIL IRDRGIGMT
Sbjct  139  IQIKLDKAKKILCIRDRGIGMT  160



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/162 (81%), Positives = 144/162 (89%), Gaps = 2/162 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRK A+ +VLFL  LLFLLPDQGRK+HANAE  SD   DPPKVE+K+GG   GLSTD DV
Sbjct  1    MRKRAIVSVLFLFSLLFLLPDQGRKLHANAEDSSDEVTDPPKVEKKLGG-HGGLSTDSDV  59

Query  245  AKR-EAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
             +R E+ES+SK++LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  60   VRRLESESISKKSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  119

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFL+LTDKD+LGEGDTAKLEIQIKLDK KKILSIRDRGIGMT
Sbjct  120  RFLALTDKDVLGEGDTAKLEIQIKLDKAKKILSIRDRGIGMT  161



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 137/162 (85%), Gaps = 1/162 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfl-lPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPD  241
            MRKWA+ + L L+ LL    PD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +
Sbjct  1    MRKWALSSALLLVFLLATLSPDPAKRLQVNAEESSDELADLPKVEEKLGAVPHGLSTDSE  60

Query  242  VAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  421
            V KRE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI
Sbjct  61   VVKRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKI  120

Query  422  RFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            RFL LTDK++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMT
Sbjct  121  RFLGLTDKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMT  162



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKW + + L LLC+L L+PD+G + HA A+VD+D  VDPPKVEEKIG VPHGLSTD DV
Sbjct  1    MRKWTIASALLLLCILSLVPDEGPRFHAKADVDADEVVDPPKVEEKIGAVPHGLSTDSDV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+S+R+LR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VKRESESISRRSLRSSGEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK+ILGEGD +KLEIQIKLDK  KILSIRDRGIGMT
Sbjct  121  FLSLTDKEILGEGDNSKLEIQIKLDKANKILSIRDRGIGMT  161



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MR+WA+ + L L+ LL  LPD  +++  NAE  SD   D PKVEEK+G VPHGLSTD +V
Sbjct  1    MRRWALSSALLLVLLLTTLPDPAKRLQVNAEESSDELTDLPKVEEKLGAVPHGLSTDSEV  60

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  61   VQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  120

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FL+LT+K++LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMT
Sbjct  121  FLALTEKEVLGEGDTAKLEIQIKLDKENKILSIRDRGVGMT  161



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +2

Query  131  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  310
             +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEF
Sbjct  216  AKKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEF  275

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  490
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQI
Sbjct  276  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQI  335

Query  491  kldkdkkilsirdRGIGMT  547
            KLDK+KKILSIRDRGIGMT
Sbjct  336  KLDKEKKILSIRDRGIGMT  354



>gb|AFW81541.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
 gb|AFW81542.1| hypothetical protein ZEAMMB73_624427 [Zea mays]
Length=411

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +2

Query  128  QGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFE  307
            Q  K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+ EAES+S++TLR+ AEKFE
Sbjct  244  QANKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQSEAESISRKTLRSSAEKFE  303

Query  308  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiq  487
            FQAEVSRLMDIIINSLY+NKDIF RELISNASDALDKIRFLSLTDK++LGE DTAKLEIQ
Sbjct  304  FQAEVSRLMDIIINSLYNNKDIFPRELISNASDALDKIRFLSLTDKEVLGERDTAKLEIQ  363

Query  488  ikldkdkkilsirdRGIGMT  547
            IKLDK+KKILSI DRGIGMT
Sbjct  364  IKLDKEKKILSIWDRGIGMT  383



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMT  158



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 3/161 (2%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDV  244
            MRKWA+P+ L LLCLL LL DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV
Sbjct  1    MRKWAIPSALILLCLLSLLSDQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDV  57

Query  245  AKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  424
             KRE+ES+S R+LR+ AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR
Sbjct  58   VKRESESISSRSLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIR  117

Query  425  FLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            FLSLTDK++LGEGDTAKLEIQIKLDK+KKIL++RDRGIGMT
Sbjct  118  FLSLTDKEVLGEGDTAKLEIQIKLDKEKKILTLRDRGIGMT  158



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 138/171 (81%), Gaps = 10/171 (6%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGR----------KIHANAEVDSDAPVDPPKVEEKIGGV  214
            MRKWA+   L L+ LL  LPD G+          K+  NAE  SD   D PKVEEK+G V
Sbjct  1    MRKWALSCALLLVLLLTTLPDPGKPPQSLPLNTKKLQVNAEESSDEVGDFPKVEEKLGAV  60

Query  215  PHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  394
            PHGLSTD +V +RE+ES+S++TLR  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS
Sbjct  61   PHGLSTDSEVVQRESESISRKTLRNSAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELIS  120

Query  395  NASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            NASDALDKIRFL+LTDK+ LGEGDTAKLEIQIKLDK+ KILSIRDRG+GMT
Sbjct  121  NASDALDKIRFLTLTDKEALGEGDTAKLEIQIKLDKENKILSIRDRGVGMT  171



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +2

Query  65   MRKWAVPAVlfllcllfllPDQGRKIHANAEVD-SDAPVDPPKVEEKIGG-VPHGLSTDP  238
            MRKWAVP  LFLL +L  +P Q   + ANAE   +D    PPKVEE IGG +P  LSTD 
Sbjct  1    MRKWAVPTALFLLIILTFVPHQSPHLRANAEASPADENASPPKVEEGIGGAIPDALSTDA  60

Query  239  DVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDK  418
            DVA+RE+ES+S++TLRA A+KFEFQAEVSRLMDI+INSLYSNKDIFLRELISNASDALDK
Sbjct  61   DVAQRESESISRKTLRANAQKFEFQAEVSRLMDILINSLYSNKDIFLRELISNASDALDK  120

Query  419  IRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            IRF++LTDK++LGEGD  +L+I+IKLDK+ KILSIRDRGIGMT
Sbjct  121  IRFMALTDKNVLGEGDNTRLDIKIKLDKENKILSIRDRGIGMT  163



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +2

Query  131  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  310
             +K+  NAE  SD   D PKVEEK+G VPHGLSTD +V +RE+ES+S++TLR  AEKFEF
Sbjct  92   AKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSAEKFEF  151

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  490
            QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL+LTDK+++GEGDTAKLEIQI
Sbjct  152  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVMGEGDTAKLEIQI  211

Query  491  kldkdkkilsirdRGIGMT  547
            KLDK+ KILSIRDRG+GMT
Sbjct  212  KLDKENKILSIRDRGVGMT  230



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 130/141 (92%), Gaps = 3/141 (2%)
 Frame = +2

Query  125  DQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKF  304
            DQGRK+HANA+   +  VDPPKVEEKIG VP+GL TD DV KRE+ES+S R+LR+ AEKF
Sbjct  13   DQGRKVHANAD---EGAVDPPKVEEKIGAVPNGLQTDSDVVKRESESISSRSLRSNAEKF  69

Query  305  EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAklei  484
            EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEI
Sbjct  70   EFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEI  129

Query  485  qikldkdkkilsirdRGIGMT  547
            QIKLDK+KKIL++RDRGIGMT
Sbjct  130  QIKLDKEKKILTLRDRGIGMT  150



>ref|XP_008660989.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=209

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +2

Query  206  GGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  385
              VPHGLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLYSNKDIFLRE
Sbjct  13   NAVPHGLSTDSEVAQREAESISRKTLRSSIEKFEFQAEVSRLMDIIINSLYSNKDIFLRE  72

Query  386  LISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            LISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  73   LISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  126



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 3/138 (2%)
 Frame = +2

Query  134  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  313
            RK+ ANAE   +  VDPPKVEEKIG VPHGL TD DV KRE+ES+S R+LR  AEKFEFQ
Sbjct  1    RKVQANAE---EGAVDPPKVEEKIGAVPHGLQTDSDVVKRESESISSRSLRNNAEKFEFQ  57

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  493
            AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK++LGEGDT+KL+IQIK
Sbjct  58   AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTSKLDIQIK  117

Query  494  ldkdkkilsirdRGIGMT  547
            LDK+KKILS+RDRGIGMT
Sbjct  118  LDKEKKILSLRDRGIGMT  135



>gb|KHN44921.1| Endoplasmin like [Glycine soja]
Length=283

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 112/139 (81%), Gaps = 12/139 (9%)
 Frame = +2

Query  131  GRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEF  310
            GRK  ANAE DSD  VDPPKV++KI  VPHGL TD +V            +++  EKFEF
Sbjct  92   GRKFQANAEGDSDELVDPPKVKDKISDVPHGLLTDSNV------------IKSNVEKFEF  139

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqi  490
            QAEVS LMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK+++GEGD  KL+IQI
Sbjct  140  QAEVSWLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVVGEGDNTKLDIQI  199

Query  491  kldkdkkilsirdRGIGMT  547
            KLDK+KK LSIR+RGIGMT
Sbjct  200  KLDKEKKSLSIRERGIGMT  218



>ref|XP_008646956.1| PREDICTED: endoplasmin homolog [Zea mays]
Length=215

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +2

Query  185  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  364
            P+V  +   VP GLSTD +VA+REAES+S++TLR+  EKFEFQAEVSRLMDIIINSLY+ 
Sbjct  69   PRVTTQRSVVPRGLSTDSEVAQREAESISRKTLRSSTEKFEFQAEVSRLMDIIINSLYNK  128

Query  365  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  544
            KDIFLRE ISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGM
Sbjct  129  KDIFLREPISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGM  188

Query  545  T  547
            T
Sbjct  189  T  189



>gb|ACR38010.1| unknown [Zea mays]
Length=104

 Score =   150 bits (380),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  134  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  313
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDA  409
            AEVSRLMDIIINSLYSNKDIFLRELISNASDA
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASDA  103



>gb|AFW81490.1| hypothetical protein ZEAMMB73_031063, partial [Zea mays]
Length=102

 Score =   149 bits (377),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  134  RKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQ  313
            +K+  NAE  SD   +PPKVEEK+G VPHGLSTD +VA+REAES+S++TLR+ AEKFEFQ
Sbjct  12   KKLQVNAEESSDDLANPPKVEEKLGAVPHGLSTDSEVAQREAESISRKTLRSSAEKFEFQ  71

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASD  406
            AEVSRLMDIIINSLYSNKDIFLRELISNASD
Sbjct  72   AEVSRLMDIIINSLYSNKDIFLRELISNASD  102



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  289
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  290  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  469
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  470  AkleiqikldkdkkilsirdRGIGMT  547
            +KLEI+IKLDK+KK+LSIRDRGIGMT
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMT  165



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = +2

Query  122  PDQG---RKIHANAEVDSDAPVDPPKVEEKIGG-VPHGLSTDPDVAKREAESMSKRTLRA  289
            PDQG    K+HA     ++    PPK+EE IGG +P  LSTD  V +RE+ES+ ++TLRA
Sbjct  20   PDQGPIRSKVHAEDTGVTEENASPPKIEEPIGGAIPDALSTDSQVVERESESVGQKTLRA  79

Query  290  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  469
             A++F FQAEVSRLMDII+NSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEGD 
Sbjct  80   HAQRFTFQAEVSRLMDIIVNSLYSNKDIFLRELISNASDALDKIRFLSLTDKSQLGEGDE  139

Query  470  AkleiqikldkdkkilsirdRGIGMT  547
            +KLEI+IKLDK+KK+LSIRDRGIGMT
Sbjct  140  SKLEIRIKLDKEKKLLSIRDRGIGMT  165



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = +2

Query  185  PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSN  364
            PK+EE +G VP G +TD +V KRE+ESM+ + LR+ AEKFEFQAEVSRLMDIII+SLYSN
Sbjct  51   PKLEENLGAVPAGSTTDSEVVKRESESMTSKNLRSNAEKFEFQAEVSRLMDIIIHSLYSN  110

Query  365  KDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGM  544
            KDIFLRELISNASDALDKIRFLSLTD  +LGEGD AKL+I IKLDK+KK+L+IRDRGIGM
Sbjct  111  KDIFLRELISNASDALDKIRFLSLTDSSVLGEGDDAKLDIHIKLDKEKKVLTIRDRGIGM  170

Query  545  T  547
            T
Sbjct  171  T  171



>ref|XP_002949693.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
 gb|EFJ49245.1| hypothetical protein VOLCADRAFT_80696 [Volvox carteri f. nagariensis]
Length=808

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 100/138 (72%), Gaps = 6/138 (4%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSKRT--LRAGAEKFEFQ  313
              A+  +D+ A    PKV+  +    H  +TD     RE ESMS     LR+GAE+F FQ
Sbjct  22   CFADTSIDATAA---PKVDNGVSS-GHATTTDATSIHREKESMSNTANRLRSGAEQFAFQ  77

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqik  493
            AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDK  LGEG+ A L+I+I 
Sbjct  78   AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKAQLGEGEAANLDIKIW  137

Query  494  ldkdkkilsirdRGIGMT  547
            LD   + L+IRDRGIGMT
Sbjct  138  LDAASRTLNIRDRGIGMT  155



>ref|XP_001701885.1| heat shock protein 90B [Chlamydomonas reinhardtii]
 gb|EDP06860.1| heat shock protein 90B, partial [Chlamydomonas reinhardtii]
Length=768

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +2

Query  167  DAPVDP---PKVEEKIGGVPHGLSTDPDVAKREAESMSKRTLRAGAEKFEFQAEVSRLMD  337
            D+ VD    PKV+  +    H  +TD     RE E+MSK+ +R   E+F FQAEV+RLMD
Sbjct  1    DSAVDATAAPKVDNGVSS-GHATATDATSIHREKEAMSKQRVRDSGEQFAFQAEVTRLMD  59

Query  338  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  517
            III+SLYSNKDIFLRELISNASDALDKIRFLSLTDK ILG+GDT+ LEI+I LD + K+L
Sbjct  60   IIIHSLYSNKDIFLRELISNASDALDKIRFLSLTDKSILGDGDTSNLEIKIWLDPESKVL  119

Query  518  sirdRGIGMT  547
             IRDRGIGMT
Sbjct  120  YIRDRGIGMT  129



>ref|XP_002157524.1| PREDICTED: endoplasmin-like [Hydra vulgaris]
Length=825

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = +2

Query  164  SDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAE  319
            S+  VD PKV + IG    G  TD +V KRE E+++         + LR  AEK  FQAE
Sbjct  28   SEDEVDTPKVTDDIGKSRDGSKTDDEVVKREEEAINIDGLSVAEVKQLRESAEKHAFQAE  87

Query  320  VSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD  466
            VSR+M +IINSLY NK+IFLRELISNASDALDKIRFLSLTDK +L   D
Sbjct  88   VSRMMKLIINSLYKNKEIFLRELISNASDALDKIRFLSLTDKSVLSATD  136



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  469
            G+EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  51   GSEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  110

Query  470  AkleiqikldkdkkilsirdRGIGMT  547
            A L+I+IK DK++K+L+IRDRG+GMT
Sbjct  111  ANLDIRIKADKERKVLTIRDRGVGMT  136



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  469
            GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRF+SLTDK+ LG G+ 
Sbjct  53   GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFMSLTDKEQLGGGEN  112

Query  470  AkleiqikldkdkkilsirdRGIGMT  547
            A L+I+IK DK++K+L+IRDRGIGMT
Sbjct  113  ADLDIRIKADKERKVLTIRDRGIGMT  138



>ref|XP_006914764.1| PREDICTED: endoplasmin-like [Pteropus alecto]
Length=140

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 13/113 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>dbj|BAG61085.1| unnamed protein product [Homo sapiens]
Length=163

 Score =   106 bits (264),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  275  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            +T ++GAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFLSLTD+ +L
Sbjct  33   KTFKSGAEVSEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLSLTDESVL  92

Query  455  GEGDTAkleiqikldkdkkilsirdRGIGMT  547
            G GD A L+I+IK+DK+  +LSIRDRG+GMT
Sbjct  93   GAGDDANLDIRIKVDKENGVLSIRDRGVGMT  123



>gb|EFA78289.1| heat shock protein Hsp90 family protein [Polysphondylium pallidum 
PN500]
Length=822

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +2

Query  167  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEV  322
            DA  +  KV+  + G    L TD +V +RE E++         ++ +   +EKF+FQAEV
Sbjct  30   DAARETLKVDLDMKGPKVPLQTDSEVVQRENEAIKSEGFSVAEQQFIEEQSEKFKFQAEV  89

Query  323  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldk  502
            ++LM+IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LGEGD A L+I+I +DK
Sbjct  90   NKLMNIIINSLYSKKEIFLRELISNASDALDKIRFLALTNPSLLGEGDQANLDIRIMIDK  149

Query  503  dkkilsirdRGIGMT  547
              K + I DRG+GMT
Sbjct  150  VNKYIHIIDRGVGMT  164



>dbj|GAM27457.1| hypothetical protein SAMD00019534_106330 [Acytostelium subglobosum 
LB1]
Length=821

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = +2

Query  182  PPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMD  337
            P +++  + G    L+TD +V +RE E++         ++ ++  AEKF FQAEV++LM+
Sbjct  35   PIELDLDLKGAKTPLTTDSEVVQRENEAIKSEGYSVAEQKLIQENAEKFTFQAEVNKLMN  94

Query  338  IIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkkil  517
            IIINSLYS K+IFLRELISNASDALDKIRFL+LT+  +LG+GD +KL+I+I +D   K+L
Sbjct  95   IIINSLYSKKEIFLRELISNASDALDKIRFLALTNPALLGDGDQSKLDIRIMIDNANKVL  154

Query  518  sirdRGIGMT  547
             I DRGIGMT
Sbjct  155  HIIDRGIGMT  164



>tpg|DAA34121.1| TPA_exp: endoplasmic reticulum glucose-regulated protein [Amblyomma 
variegatum]
Length=207

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 70/104 (67%), Gaps = 8/104 (8%)
 Frame = +2

Query  167  DAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEV  322
            DA    PKVE+ +G    G  TD  V +RE E++          + +R  AEK  FQAEV
Sbjct  23   DAESSTPKVEDDLGATREGSRTDDQVVEREEEAIKLDGLNVAQMKEMREKAEKHAFQAEV  82

Query  323  SRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            +R+M +IINSLY NK+IFLRELISNASDALDKIR LSLT+ D+L
Sbjct  83   TRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTNPDVL  126



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  278  TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            T +AGAE  EFQAEVSRLMDIIINSLYSNKDIFLRELISN SDALDKIRFLSLTD   LG
Sbjct  461  TFKAGAEVNEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDALDKIRFLSLTDASQLG  520

Query  458  EGDTAkleiqikldkdkkilsirdRGIGMT  547
            +GD A+L+I+IK+DKD+K++SIRD+G+GMT
Sbjct  521  DGDAAQLDIRIKIDKDQKLISIRDKGVGMT  550



>ref|XP_011311739.1| PREDICTED: endoplasmin [Fopius arisanus]
Length=794

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +2

Query  146  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  301
            A A+++ D   D P VE+ +G       TD +V +RE+E+++         + LR  AEK
Sbjct  18   ARAQLEIDEADDVPSVEQNLGSSREASRTDDEVVQRESEAINIDGLNPSQIQELRNRAEK  77

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            F FQ EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK++L
Sbjct  78   FTFQTEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVL  128



>gb|ADR79285.1| Hsp90 beta [Brachionus ibericus]
Length=802

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 10/118 (8%)
 Frame = +2

Query  137  KIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAG  292
            ++HA  +++ D     PKV+E IG    G  TD +V +RE E +          + LR  
Sbjct  24   RVHAEDDIEVDES-SAPKVDEDIGKSREGSRTDDEVVQREEEQIKLDGLSVAEMKELRES  82

Query  293  AEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD  466
            +++ EF AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDKD+LGE +
Sbjct  83   SKQ-EFVAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFMSLTDKDVLGETE  139



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +2

Query  275  RTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            +  + GAE+ EFQAEVSRLMDIIINSLYSNKDIFLRELISN SD+LDKIRFL+LTD+ +L
Sbjct  41   KAFKEGAEQHEFQAEVSRLMDIIINSLYSNKDIFLRELISNGSDSLDKIRFLALTDESLL  100

Query  455  GEGDTAkleiqikldkdkkilsirdRGIGMT  547
            G GD A LEI+IK+D DKKIL+IRDRG+GMT
Sbjct  101  GVGDDANLEIRIKVDHDKKILTIRDRGVGMT  131



>gb|AIC62039.1| HSP90B1, partial [synthetic construct]
Length=315

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 13/113 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>gb|AAH09195.1| HSP90B1 protein [Homo sapiens]
Length=315

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 13/113 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>gb|ADY39524.1| putative heat shock protein gp-96 [Hottentotta judaicus]
Length=171

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 8/107 (7%)
 Frame = +2

Query  161  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAE-------SMSK-RTLRAGAEKFEFQA  316
            + D   +  KVE+ +G       TD +  KRE E       S+S+ + +R  AEKF FQA
Sbjct  22   EEDEAENEIKVEDDLGSSREASRTDDEAVKREEEAIKLDGLSVSQIKEMREKAEKFAFQA  81

Query  317  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTDK  L 
Sbjct  82   EVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRVLSLTDKAALA  128



>gb|EAW97723.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_a, 
partial [Homo sapiens]
Length=367

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 13/113 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  47   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  101

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  102  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  154



>gb|AAT97075.1| tumor rejection antigen-like protein [Lymnaea stagnalis]
Length=141

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = +2

Query  203  IGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMDIIINSLY  358
            IG    G  TD +  +RE E++S         + LR  +EKF+FQAEV+R+M +IINSLY
Sbjct  37   IGKSREGSRTDDEAVQREEEAISLDGLSVAQMKELRDKSEKFQFQAEVNRMMKLIINSLY  96

Query  359  SNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD  466
             NK+IFLRELISNASDALDKIRFLSLTD + L   D
Sbjct  97   KNKEIFLRELISNASDALDKIRFLSLTDPNALTATD  132



>ref|XP_005823214.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
 gb|EKX36234.1| hypothetical protein GUITHDRAFT_160160 [Guillardia theta CCMP2712]
Length=839

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  272  KRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDI  451
            K+ L  G +K EFQAEV RLMDIIINSLYS K+IFLRELISNASDALDKIRFLSLTD  +
Sbjct  63   KKALEQGGQKQEFQAEVGRLMDIIINSLYSKKEIFLRELISNASDALDKIRFLSLTDPKV  122

Query  452  LGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            LGEGD +KLEI+I+ DK+   +SI D GIGMT
Sbjct  123  LGEGDQSKLEIRIEADKEAGTISISDTGIGMT  154



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +2

Query  251  REAESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFL  430
            RE ++++ +  R G E FEFQAEVSRLMDIIINSLYSNKDIFLREL+SNASDALDKIRFL
Sbjct  4    RERDTLAPKERRNG-ESFEFQAEVSRLMDIIINSLYSNKDIFLRELVSNASDALDKIRFL  62

Query  431  SLTDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            SL DK +L +G  A+L+I IK+DK + +LSIRD G+GMT
Sbjct  63   SLMDKTLLSDGKDAELDIHIKVDKKENVLSIRDNGVGMT  101



>ref|XP_006657349.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=951

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  257  AESMSKRTLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSL  436
             E ++ + LR   E FEFQA ++ L+DIIINS Y N DIFLRELISNASDALDKIRFL+L
Sbjct  397  GEPIATKALRRSGEMFEFQAILTNLIDIIINSPYRNSDIFLRELISNASDALDKIRFLAL  456

Query  437  TDKDILGEGDTAkleiqikldkdkkilsirdRGIGMT  547
            TDK++LGEGDTAKLEIQIKLDK+KKILSIRDRGIGMT
Sbjct  457  TDKEVLGEGDTAKLEIQIKLDKEKKILSIRDRGIGMT  493



>gb|AGX25162.1| heat shock protein, partial [Leptinotarsa decemlineata]
Length=291

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 68/98 (69%), Gaps = 8/98 (8%)
 Frame = +2

Query  188  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  343
            +VE  +G    G  TD +V KRE E++          R LR  +EKF FQ EV+R+M +I
Sbjct  32   EVELDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLRELREKSEKFAFQTEVNRMMKLI  91

Query  344  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L 
Sbjct  92   INSLYRNKEIFLRELISNASDALDKIRMLSLTDKEVLN  129



>ref|XP_004994487.1| heat shock protein gp96 [Salpingoeca rosetta]
 gb|EGD72664.1| heat shock protein gp96 [Salpingoeca rosetta]
Length=850

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 8/108 (7%)
 Frame = +2

Query  161  DSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQA  316
            D+   VD P+  +          TD +V +RE +++          + LR  A+ FEFQA
Sbjct  34   DTAVNVDAPESVDADLSAHKSTGTDAEVVEREEQAIKLDGMSVAEAKLLREKADTFEFQA  93

Query  317  EVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGE  460
            EV+R+M +IINSLY NKDIFLRELISNASDALDKIRFLSLTDKD+LG+
Sbjct  94   EVNRMMKLIINSLYKNKDIFLRELISNASDALDKIRFLSLTDKDVLGD  141



>ref|XP_003907109.1| PREDICTED: endoplasmin [Papio anubis]
Length=800

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK----RTLRAGAEKFE  307
            + A+ EVD D  V     EE +G    G  TD +V +RE E++      R LR  +EKF 
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAILNASQIRELREKSEKFA  73

Query  308  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  123



>ref|XP_004373828.1| PREDICTED: endoplasmin [Trichechus manatus latirostris]
Length=803

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADGEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_011494775.1| PREDICTED: endoplasmin [Ceratosolen solmsi marchali]
Length=786

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = +2

Query  191  VEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLMDIII  346
            +++ +G     L TD  V +REAE+++         + LR  AEKF+FQ EV+R+M +II
Sbjct  31   IDDDLGASREALRTDEQVVQREAEAINIDGLNVSQVKELRDKAEKFQFQTEVNRMMKLII  90

Query  347  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            NSLY NK+IFLRELISNASDALDKIR LSLTDK+IL
Sbjct  91   NSLYRNKEIFLRELISNASDALDKIRLLSLTDKNIL  126



>ref|XP_007096540.1| PREDICTED: endoplasmin [Panthera tigris altaica]
Length=804

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_007109922.1| PREDICTED: endoplasmin [Physeter catodon]
Length=805

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_004326676.1| PREDICTED: endoplasmin [Tursiops truncatus]
Length=805

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_004269495.1| PREDICTED: endoplasmin [Orcinus orca]
Length=805

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_007165840.1| PREDICTED: endoplasmin [Balaenoptera acutorostrata scammoni]
Length=805

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>dbj|BAP28370.1| heat shock protein 90 kDa beta member 1, partial [Canis lupus 
familiaris]
Length=663

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  12   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  66

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  67   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  120



>ref|XP_004414318.1| PREDICTED: endoplasmin [Odobenus rosmarus divergens]
Length=804

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADNEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|AAH81917.1| Tra1 protein [Rattus norvegicus]
Length=643

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|ELU00023.1| hypothetical protein CAPTEDRAFT_159587 [Capitella teleta]
Length=761

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 69/104 (66%), Gaps = 8/104 (8%)
 Frame = +2

Query  179  DPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQAEVSRLM  334
            D P VEE IG    G  TD +V  RE E++          + +R  AEK  FQAEV R+M
Sbjct  29   DTPIVEEDIGKSRDGSRTDDEVVNREEEAIKLDGMSVSEMKEMRDKAEKHTFQAEVDRMM  88

Query  335  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD  466
             +IINSLY NK+IFLRELISNASDALDKIRF++LTDK+ L   D
Sbjct  89   KLIINSLYKNKEIFLRELISNASDALDKIRFMALTDKEALSATD  132



>ref|XP_006740281.1| PREDICTED: endoplasmin isoform X2 [Leptonychotes weddellii]
Length=748

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>dbj|BAD92771.1| tumor rejection antigen (gp96) 1 variant [Homo sapiens]
Length=576

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  45   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  99

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  100  EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  153



>ref|XP_007619353.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|ERE88868.1| endoplasmin [Cricetulus griseus]
Length=802

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_005068020.1| PREDICTED: endoplasmin [Mesocricetus auratus]
Length=802

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_003505898.1| PREDICTED: endoplasmin [Cricetulus griseus]
 gb|EGW09701.1| Endoplasmin [Cricetulus griseus]
Length=803

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_395614.3| PREDICTED: endoplasmin-like isoform 1 [Apis mellifera]
Length=798

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 15/103 (15%)
 Frame = +2

Query  191  VEEKIGGVPHGLS-------TDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVS  325
            VEE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  24   VEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  83

Query  326  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  84   RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_003405348.1| PREDICTED: endoplasmin [Loxodonta africana]
Length=801

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|ELK10318.1| Endoplasmin [Pteropus alecto]
Length=680

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_035761.1| endoplasmin precursor [Mus musculus]
 sp|P08113.2|ENPL_MOUSE RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Endoplasmic reticulum 
resident protein 99; Short=ERp99; AltName: Full=Heat shock 
protein 90 kDa beta member 1; AltName: Full=Polymorphic tumor 
rejection antigen 1; AltName: Full=Tumor rejection antigen 
gp96; Flags: Precursor [Mus musculus]
 gb|AAA37573.1| endoplasmic reticulum transmembrane protein precursor [Mus musculus]
 dbj|BAE38494.1| unnamed protein product [Mus musculus]
 dbj|BAE40874.1| unnamed protein product [Mus musculus]
 dbj|BAE27505.1| unnamed protein product [Mus musculus]
 dbj|BAE32087.1| unnamed protein product [Mus musculus]
 dbj|BAE30378.1| unnamed protein product [Mus musculus]
 dbj|BAE35526.1| unnamed protein product [Mus musculus]
 dbj|BAE40758.1| unnamed protein product [Mus musculus]
 gb|EDL21440.1| heat shock protein 90kDa beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_005358282.1| PREDICTED: endoplasmin [Microtus ochrogaster]
Length=805

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|ELR54024.1| Endoplasmin, partial [Bos mutus]
Length=795

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|NP_777125.1| endoplasmin precursor [Bos taurus]
 ref|XP_005899141.1| PREDICTED: endoplasmin [Bos mutus]
 ref|XP_006077264.1| PREDICTED: endoplasmin [Bubalus bubalis]
 ref|XP_010851722.1| PREDICTED: endoplasmin [Bison bison bison]
 sp|Q95M18.1|ENPL_BOVIN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Bos taurus]
 dbj|BAB69766.1| glucose-regulated protein GRP94 precursor [Bos taurus]
 gb|AAI04550.1| Tumor rejection antigen (gp96) 1 [Bos taurus]
 tpg|DAA29741.1| TPA: endoplasmin precursor [Bos taurus]
Length=804

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|AAH10445.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
 gb|AAH11439.1| Heat shock protein 90, beta (Grp94), member 1 [Mus musculus]
Length=802

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>dbj|BAE29874.1| unnamed protein product [Mus musculus]
Length=802

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|NP_001012197.2| endoplasmin precursor [Rattus norvegicus]
 sp|Q66HD0.2|ENPL_RAT RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Rattus norvegicus]
 gb|EDM17052.1| rCG49111 [Rattus norvegicus]
Length=804

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_004743081.1| PREDICTED: endoplasmin [Mustela putorius furo]
 ref|XP_004787181.1| PREDICTED: endoplasmin [Mustela putorius furo]
Length=803

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_003401925.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin-like [Bombus terrestris]
Length=798

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 8/100 (8%)
 Frame = +2

Query  179  DPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRLM  334
            D   VE  +G    G  TD +V +RE E++          + LR  AEKF FQ EV+R+M
Sbjct  27   DVGTVENDLGASREGSRTDNEVVQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVNRMM  86

Query  335  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
             +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  87   KLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_004006728.1| PREDICTED: endoplasmin [Ovis aries]
Length=804

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|AFK46854.1| unknown [Medicago truncatula]
Length=121

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +2

Query  332  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  511
            MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD AKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDNAKLEIQIKLDKEKK  60

Query  512  ilsirdRGIGMT  547
            ILSIRDRGIGMT
Sbjct  61   ILSIRDRGIGMT  72



>ref|XP_006979926.1| PREDICTED: endoplasmin [Peromyscus maniculatus bairdii]
Length=802

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|EFB13451.1| hypothetical protein PANDA_003512 [Ailuropoda melanoleuca]
Length=778

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  3    VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  57

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  58   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  111



>ref|XP_008703910.1| PREDICTED: endoplasmin [Ursus maritimus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006769416.1| PREDICTED: endoplasmin [Myotis davidii]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_003269991.2| PREDICTED: endoplasmin [Nomascus leucogenys]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_001182453.1| heat shock protein 90kDa beta (Grp94), member 1 precursor [Macaca 
mulatta]
 ref|NP_001270655.1| endoplasmin precursor [Macaca fascicularis]
 ref|XP_010355583.1| PREDICTED: endoplasmin [Rhinopithecus roxellana]
 sp|Q4R520.1|ENPL_MACFA RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Macaca fascicularis]
 dbj|BAE01805.1| unnamed protein product [Macaca fascicularis]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_007893493.1| PREDICTED: endoplasmin [Callorhinchus milii]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 8/110 (7%)
 Frame = +2

Query  152  AEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFE  307
            A   +D P+    VEE +G    G  TD +V KRE E++          + LR  +EKF 
Sbjct  17   ASARADEPLADETVEEDLGKSRDGSKTDDEVTKREEEAIQLDGLNPAQIKELRDKSEKFV  76

Query  308  FQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD   LG
Sbjct  77   FQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDDSALG  126



>ref|XP_008568503.1| PREDICTED: endoplasmin [Galeopterus variegatus]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_001233416.1| endoplasmin precursor [Pan troglodytes]
 dbj|BAK62934.1| endoplasmin precursor [Pan troglodytes]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_008002644.1| PREDICTED: endoplasmin [Chlorocebus sabaeus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|EHH21126.1| hypothetical protein EGK_04124 [Macaca mulatta]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_001003327.1| endoplasmin precursor [Canis lupus familiaris]
 sp|P41148.1|ENPL_CANFA RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; Flags: Precursor [Canis lupus familiaris]
 gb|AAA17708.1| GRP94 [Canis lupus familiaris]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006934044.1| PREDICTED: endoplasmin [Felis catus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006888611.1| PREDICTED: endoplasmin [Elephantulus edwardii]
Length=801

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_005865309.1| PREDICTED: endoplasmin [Myotis brandtii]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_006740280.1| PREDICTED: endoplasmin isoform X1 [Leptonychotes weddellii]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|NP_003290.1| endoplasmin precursor [Homo sapiens]
 ref|XP_003832615.1| PREDICTED: endoplasmin [Pan paniscus]
 sp|P14625.1|ENPL_HUMAN RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=Tumor rejection antigen 
1; AltName: Full=gp96 homolog; Flags: Precursor [Homo sapiens]
 emb|CAA33261.1| precursor polypeptide (AA-21 to 782) [Homo sapiens]
 gb|AAH66656.1| Heat shock protein 90kDa beta (Grp94), member 1 [Homo sapiens]
 gb|EAW97724.1| heat shock protein 90kDa beta (Grp94), member 1, isoform CRA_b 
[Homo sapiens]
 gb|ACJ13662.1| epididymis luminal protein 35 [Homo sapiens]
 gb|ACS44652.1| epididymis secretory sperm binding protein Li 125m [Homo sapiens]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_001127573.1| endoplasmin precursor [Pongo abelii]
 sp|Q5R6F7.1|ENPL_PONAB RecName: Full=Endoplasmin; AltName: Full=Heat shock protein 90 
kDa beta member 1; Flags: Precursor [Pongo abelii]
 emb|CAH92659.1| hypothetical protein [Pongo abelii]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_003929672.1| PREDICTED: endoplasmin [Saimiri boliviensis boliviensis]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+AEVD D  V     E  +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADAEVDVDGTV-----EADLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_004053833.1| PREDICTED: endoplasmin [Gorilla gorilla gorilla]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_006084129.1| PREDICTED: endoplasmin [Myotis lucifugus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_011218345.1| PREDICTED: endoplasmin isoform X2 [Ailuropoda melanoleuca]
Length=799

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006141474.1| PREDICTED: endoplasmin [Tupaia chinensis]
 gb|ELW71596.1| Endoplasmin [Tupaia chinensis]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|EHA99498.1| Endoplasmin, partial [Heterocephalus glaber]
Length=792

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_008142964.1| PREDICTED: endoplasmin [Eptesicus fuscus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_002915502.1| PREDICTED: endoplasmin isoform X1 [Ailuropoda melanoleuca]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>emb|CAI64497.1| tumor rejection antigen (gp96) 1 [Homo sapiens]
Length=802

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_011385167.1| PREDICTED: endoplasmin [Pteropus vampyrus]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|EPY74066.1| endoplasmin precursor [Camelus ferus]
Length=723

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_005322404.1| PREDICTED: endoplasmin [Ictidomys tridecemlineatus]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_004879102.1| PREDICTED: endoplasmin [Heterocephalus glaber]
 ref|XP_004844894.1| PREDICTED: endoplasmin isoform X2 [Heterocephalus glaber]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_003783342.1| PREDICTED: endoplasmin-like [Otolemur garnettii]
Length=804

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_004418096.1| PREDICTED: endoplasmin [Ceratotherium simum simum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|AAQ02595.1| tumor rejection antigen 1gp96, partial [synthetic construct]
Length=803

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_003493872.1| PREDICTED: endoplasmin-like [Bombus impatiens]
Length=798

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 8/100 (8%)
 Frame = +2

Query  179  DPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRLM  334
            D   VE  +G    G  TD +V +RE E++          + LR  AEKF FQ EV+R+M
Sbjct  27   DVGTVENDLGASREGSRTDNEVVQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVNRMM  86

Query  335  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
             +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  87   RLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_003694125.1| PREDICTED: endoplasmin-like [Apis florea]
Length=831

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 71/103 (69%), Gaps = 15/103 (15%)
 Frame = +2

Query  191  VEEKIGGVPHGLS-------TDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVS  325
            VEE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  57   VEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  116

Query  326  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  117  RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  159



>ref|NP_001157345.1| glucose-regulated protein precursor [Equus caballus]
 ref|XP_008535120.1| PREDICTED: endoplasmin [Equus przewalskii]
Length=804

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_004844893.1| PREDICTED: endoplasmin isoform X1 [Heterocephalus glaber]
Length=844

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|EHH66650.1| hypothetical protein EGM_03684 [Macaca fascicularis]
Length=804

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_010629639.1| PREDICTED: endoplasmin [Fukomys damarensis]
 gb|KFO30279.1| Endoplasmin [Fukomys damarensis]
Length=806

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDLDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|EPQ07146.1| Endoplasmin [Myotis brandtii]
Length=825

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>emb|CAA62352.1| protein kinase [Sus scrofa]
Length=808

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006193753.1| PREDICTED: endoplasmin [Camelus ferus]
 ref|XP_010968744.1| PREDICTED: endoplasmin [Camelus bactrianus]
 ref|XP_010988330.1| PREDICTED: endoplasmin [Camelus dromedarius]
Length=804

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_006205953.1| PREDICTED: endoplasmin [Vicugna pacos]
Length=804

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 2/86 (2%)
 Frame = +2

Query  290  GAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDT  469
            G+EKFEFQAEVSRL  IIINSLYSNKDIFLRELISN SDALDKIRF+SLTDK+ LG G+ 
Sbjct  54   GSEKFEFQAEVSRL--IIINSLYSNKDIFLRELISNGSDALDKIRFMSLTDKEQLGSGEN  111

Query  470  AkleiqikldkdkkilsirdRGIGMT  547
            A L+I+IK DK++K+L+IRDRG+GMT
Sbjct  112  ANLDIRIKADKERKVLTIRDRGVGMT  137



>sp|Q29092.3|ENPL_PIG RecName: Full=Endoplasmin; AltName: Full=94 kDa glucose-regulated 
protein; Short=GRP-94; AltName: Full=98 kDa protein kinase; 
Short=PPK 98; Short=ppk98; AltName: Full=Heat shock protein 
90 kDa beta member 1; AltName: Full=gp96 homolog; Flags: 
Precursor [Sus scrofa]
 emb|CAA53948.1| Ppk 98; a protein kinase [Sus scrofa]
Length=804

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_004623907.1| PREDICTED: endoplasmin [Octodon degus]
Length=806

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALS  127



>ref|XP_008666260.1| PREDICTED: endoplasmin homolog, partial [Zea mays]
Length=95

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 72/72 (100%), Gaps = 0/72 (0%)
 Frame = +2

Query  332  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGDTAkleiqikldkdkk  511
            MDIIINSLY+NKDIFLRELISNASDALDKIRFLSLTDK++LGEGDTAKLEIQIKLDK+KK
Sbjct  1    MDIIINSLYNNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDTAKLEIQIKLDKEKK  60

Query  512  ilsirdRGIGMT  547
            ILSIRDRGIGMT
Sbjct  61   ILSIRDRGIGMT  72



>gb|KHN71590.1| Endoplasmin [Toxocara canis]
Length=786

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 8/108 (7%)
 Frame = +2

Query  158  VDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KRTLRAGAEKFEFQ  313
            V+++  ++ P V+E IG       TD +V +RE E++          + +RA AEK+EFQ
Sbjct  27   VEAEDDIEEPTVKENIGKAQDASKTDDEVVQREEEAIKLDGMSVAEMKEMRARAEKYEFQ  86

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            AEV+R+M +IINSLY NK+IFLRELISN SDALDKIR +SLTD   L 
Sbjct  87   AEVNRMMKLIINSLYRNKEIFLRELISNGSDALDKIRLISLTDPQALS  134



>ref|XP_004589651.1| PREDICTED: endoplasmin [Ochotona princeps]
Length=803

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDEQALS  127



>ref|XP_005374635.1| PREDICTED: endoplasmin [Chinchilla lanigera]
Length=806

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALS  127



>ref|XP_005680600.1| PREDICTED: endoplasmin [Capra hircus]
Length=800

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  15   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  69

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  70   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDETALA  123



>ref|XP_009019107.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
 gb|ESO02893.1| hypothetical protein HELRODRAFT_157169 [Helobdella robusta]
Length=736

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 8/99 (8%)
 Frame = +2

Query  185  PKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDI  340
            PKV++ IG    G  TD +V +RE E++          + L+  AEK  FQAEV R+M +
Sbjct  12   PKVDDDIGKAQEGSKTDDEVVQREEEAIKLDGLSVAQMKELKDKAEKHVFQAEVDRMMKL  71

Query  341  IINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            IINSLY NK+IFLRELISNASDALDKIRFLSLTD   +G
Sbjct  72   IINSLYKNKEIFLRELISNASDALDKIRFLSLTDNTAMG  110



>ref|XP_006619420.1| PREDICTED: endoplasmin-like [Apis dorsata]
Length=798

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 15/103 (15%)
 Frame = +2

Query  191  VEEKIGGVPHGLS-------TDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVS  325
            +EE IG V + LS       TD +V +RE E++          + LR  AEKF FQ EV+
Sbjct  24   MEEDIGTVENDLSASREGSRTDNEVIQREEEAIKLDGLNVAQIKELREKAEKFTFQTEVN  83

Query  326  RLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            R+M +IINSLY NKDIFLRELISNASDALDKIR LSLTDK++L
Sbjct  84   RIMKLIINSLYRNKDIFLRELISNASDALDKIRLLSLTDKNVL  126



>ref|XP_007454336.1| PREDICTED: endoplasmin [Lipotes vexillifer]
Length=803

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_005984835.1| PREDICTED: endoplasmin [Pantholops hodgsonii]
Length=804

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 13/112 (12%)
 Frame = +2

Query  146  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  301
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>ref|XP_004602837.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin [Sorex araneus]
Length=759

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ E+D D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDELDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_007950582.1| PREDICTED: endoplasmin [Orycteropus afer afer]
Length=804

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD +  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VQADDEVDVEGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|NP_999268.1| endoplasmin precursor [Sus scrofa]
 emb|CAA70347.1| gp96/GRP94 [Sus scrofa]
Length=804

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 74/114 (65%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A  EVD D  V     EE +G    G  TD ++ +RE E++          R LR  +
Sbjct  19   VRAEDEVDVDGTV-----EEDLGKSREGSRTDDEIVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  127



>gb|ELK25961.1| Endoplasmin [Myotis davidii]
Length=1226

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 75/113 (66%), Gaps = 13/113 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENAL  126



>ref|XP_008062311.1| PREDICTED: endoplasmin isoform X1 [Tarsius syrichta]
Length=804

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 74/112 (66%), Gaps = 13/112 (12%)
 Frame = +2

Query  146  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  301
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>ref|XP_002428463.1| Hsp90 protein, putative [Pediculus humanus corporis]
 gb|EEB15725.1| Hsp90 protein, putative [Pediculus humanus corporis]
Length=778

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 8/101 (8%)
 Frame = +2

Query  176  VDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEFQAEVSRL  331
            V+   VE  +G     L TD +V +RE E++          + LR  AEKF FQAEV+R+
Sbjct  31   VETVTVEPDLGASREALRTDDNVVQREEEAIKLDGLNVAQIKELREKAEKFHFQAEVNRM  90

Query  332  MDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            M +IINSLY NK+IFLRELISNA+DALDKIR LSLTDK +L
Sbjct  91   MKLIINSLYRNKEIFLRELISNAADALDKIRLLSLTDKSVL  131



>ref|XP_001365625.1| PREDICTED: endoplasmin [Monodelphis domestica]
Length=804

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 9/109 (8%)
 Frame = +2

Query  158  VDSDAPVD-PPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  310
            V +D PVD    VEE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  20   VKADDPVDVEATVEEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  79

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  80   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  128



>ref|XP_002117847.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
 gb|EDV19690.1| hypothetical protein TRIADDRAFT_64388 [Trichoplax adhaerens]
Length=669

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 8/97 (8%)
 Frame = +2

Query  191  VEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDIII  346
            VEE IG       TD +   RE E++          + LR   EK EFQAEVSR+M +II
Sbjct  15   VEEDIGKSRDASKTDDEAVAREEEAIKIDGLNVAQMKELREKGEKSEFQAEVSRMMKLII  74

Query  347  NSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            NSLY NK+IFLRELISN+SDALDKIRF+SLTDK++LG
Sbjct  75   NSLYRNKEIFLRELISNSSDALDKIRFMSLTDKEVLG  111



>ref|XP_004675798.1| PREDICTED: endoplasmin [Condylura cristata]
Length=803

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 14/114 (12%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + AN EVD D  V     EE +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRAN-EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQLRELREKS  72

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  73   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  126



>ref|XP_003202424.1| PREDICTED: endoplasmin [Meleagris gallopavo]
Length=795

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = +2

Query  155  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  310
            EVD+DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDADATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  126



>ref|XP_008841379.1| PREDICTED: endoplasmin [Nannospalax galili]
Length=804

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 13/114 (11%)
 Frame = +2

Query  140  IHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGA  295
            + A+ EVD D  V     E+ +G    G  TD +V +RE E++          R LR  +
Sbjct  19   VRADDEVDVDGTV-----EDDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKS  73

Query  296  EKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            EKF FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  74   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  127



>gb|KFM57735.1| Endoplasmin, partial [Stegodyphus mimosarum]
Length=785

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 68/101 (67%), Gaps = 8/101 (8%)
 Frame = +2

Query  179  DPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLM  334
            D P VE  IG    G  TD +V +RE E++          + LR  AEKF FQAEV+R+M
Sbjct  24   DEPTVEPDIGSSREGSRTDDEVVQREEEAIKIDGLNVAQIKELREKAEKFTFQAEVNRMM  83

Query  335  DIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
             +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  84   KLIINSLYRNKEIFLRELISNASDALDKIRVISLTDRAALS  124



>ref|XP_008255217.1| PREDICTED: endoplasmin [Oryctolagus cuniculus]
Length=802

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 73/112 (65%), Gaps = 13/112 (12%)
 Frame = +2

Query  146  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  301
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDEQALS  127



>ref|XP_003461118.1| PREDICTED: endoplasmin isoform X1 [Cavia porcellus]
Length=807

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 73/112 (65%), Gaps = 13/112 (12%)
 Frame = +2

Query  146  ANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEK  301
            A+ EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EK
Sbjct  21   ADDEVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEK  75

Query  302  FEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            F FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD+  L 
Sbjct  76   FAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDESALS  127



>ref|XP_006871146.1| PREDICTED: endoplasmin [Chrysochloris asiatica]
Length=794

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 13/109 (12%)
 Frame = +2

Query  155  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  310
            EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EKF F
Sbjct  23   EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAF  77

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  126



>gb|AAA48827.1| 108K heat shock protein [Gallus gallus]
Length=795

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 13/109 (12%)
 Frame = +2

Query  155  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  310
            EVD DA V     EE +G    G  TD +V +RE E++          + +R  +EKF F
Sbjct  23   EVDVDATV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIKEIREKSEKFAF  77

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  78   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA  126



>ref|XP_971540.1| PREDICTED: endoplasmin [Tribolium castaneum]
 gb|EFA10013.1| hypothetical protein TcasGA2_TC012185 [Tribolium castaneum]
 gb|AHF20221.1| heat shock protein 90 [Tribolium castaneum]
Length=782

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 8/97 (8%)
 Frame = +2

Query  188  KVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQAEVSRLMDII  343
            KV+  +G    G  TD +V KRE E++          + LR  AEKF FQ EV+R+M +I
Sbjct  31   KVDLDLGASREGSRTDDEVVKREEEAIKLDGLNVAQLKELRDKAEKFTFQTEVNRMMKLI  90

Query  344  INSLYSNKDIFLRELISNASDALDKIRFLSLTDKDIL  454
            INSLY NK+IFLRELISNASDALDKIR LSLTDK++L
Sbjct  91   INSLYRNKEIFLRELISNASDALDKIRLLSLTDKNVL  127



>ref|XP_009065664.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
 gb|ESO83635.1| hypothetical protein LOTGIDRAFT_197084 [Lottia gigantea]
Length=792

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 8/111 (7%)
 Frame = +2

Query  158  VDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESM--------SKRTLRAGAEKFEFQ  313
            V ++  V  P V E IG       TD +  +RE E++          + LR  AEKF F+
Sbjct  23   VQAEEVVTEPDVVEDIGKSREASRTDDEAVQREEEAIKLDGLNVAQMKELREKAEKFAFE  82

Query  314  AEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILGEGD  466
            AEV+R+M +IINSLY NK+IFLRELISNASDALDKIRF+SLTDK  +   D
Sbjct  83   AEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRFVSLTDKSAMAATD  133



>ref|XP_001899398.1| Endoplasmin precursor [Brugia malayi]
 emb|CDQ00792.1| Protein Bm5584, isoform b [Brugia malayi]
Length=789

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 78/123 (63%), Gaps = 15/123 (12%)
 Frame = +2

Query  122  PDQGRKIHANAEVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMS--------KR  277
            P+ G  ++A  E +S+A V     +E IG +     TD +V +RE E++          +
Sbjct  23   PNTG--VNAKVESNSEATV-----KENIGRIKTSSKTDEEVIQREEEAIKLDGLSVAEMK  75

Query  278  TLRAGAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
             LR  AEK  FQAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR LSLTD  +L 
Sbjct  76   ELRIRAEKHSFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLLSLTDPSVLS  135

Query  458  EGD  466
              D
Sbjct  136  ATD  138



>gb|AAK74072.1| heat shock protein gp96 precursor [Homo sapiens]
Length=782

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 13/109 (12%)
 Frame = +2

Query  155  EVDSDAPVDPPKVEEKIGGVPHGLSTDPDVAKREAESMSK--------RTLRAGAEKFEF  310
            EVD D  V     EE +G    G  TD +V +RE E++          R LR  +EKF F
Sbjct  3    EVDVDGTV-----EEDLGKSREGSRTDDEVVQREEEAIQLDGLNASQIRELREKSEKFAF  57

Query  311  QAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKDILG  457
            QAEV+R+M +IINSLY NK+IFLRELISNASDALDKIR +SLTD++ L 
Sbjct  58   QAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALS  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335