BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034F10

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA  75.9    8e-13   Nicotiana tomentosiformis
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA  74.7    2e-12   Nicotiana sylvestris
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...  72.4    1e-11   
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA  71.6    2e-11   Solanum lycopersicum
ref|XP_009140101.1|  PREDICTED: probable receptor-like protein ki...  65.5    2e-09   Brassica rapa
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA  64.7    4e-09   Populus euphratica
gb|KJB10568.1|  hypothetical protein B456_001G207900                  64.7    4e-09   Gossypium raimondii
ref|XP_011009252.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  61.6    4e-08   Populus euphratica
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg              61.6    4e-08   Erythranthe guttata [common monkey flower]
dbj|BAK00988.1|  predicted protein                                    61.2    4e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g           61.6    4e-08   
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g           61.6    5e-08   
emb|CDO98765.1|  unnamed protein product                              61.6    5e-08   Coffea canephora [robusta coffee]
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...  61.2    6e-08   
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERO...  61.2    7e-08   Cucumis sativus [cucumbers]
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1   60.8    9e-08   Nelumbo nucifera [Indian lotus]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                  60.8    9e-08   Glycine soja [wild soybean]
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor           60.8    9e-08   Glycine max [soybeans]
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg           60.5    1e-07   Citrus clementina [clementine]
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA  60.5    1e-07   Nelumbo nucifera [Indian lotus]
gb|KDO53394.1|  hypothetical protein CISIN_1g002533mg                 60.5    1e-07   Citrus sinensis [apfelsine]
emb|CDP15786.1|  unnamed protein product                              60.1    1e-07   Coffea canephora [robusta coffee]
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...  60.1    2e-07   Cicer arietinum [garbanzo]
gb|KEH32083.1|  feronia receptor-like kinase                          59.7    2e-07   Medicago truncatula
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1   60.1    2e-07   Sesamum indicum [beniseed]
gb|KEH23293.1|  feronia receptor-like kinase                          59.7    2e-07   Medicago truncatula
ref|XP_003609098.1|  FERONIA receptor-like kinase                     59.7    2e-07   
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA  59.3    2e-07   Nicotiana sylvestris
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA  59.3    2e-07   Nicotiana tomentosiformis
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA  59.3    3e-07   Cucumis melo [Oriental melon]
gb|ACA25097.1|  serine/threonine protein kinase A                     56.2    3e-07   Populus tremula [European aspen]
gb|ACA25095.1|  serine/threonine protein kinase A                     56.2    3e-07   Populus tremula [European aspen]
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g           58.9    3e-07   
gb|ACA25102.1|  serine/threonine protein kinase A                     56.2    3e-07   Populus tremula [European aspen]
gb|ACA25084.1|  serine/threonine protein kinase A                     56.2    3e-07   Populus tremula [European aspen]
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1   58.9    3e-07   Solanum lycopersicum
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...  58.9    4e-07   Solanum tuberosum [potatoes]
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  58.5    4e-07   Populus euphratica
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1   58.5    4e-07   
gb|KFK33632.1|  hypothetical protein AALP_AA5G038800                  58.5    5e-07   Arabis alpina [alpine rockcress]
gb|EMT01093.1|  hypothetical protein F775_16963                       58.2    5e-07   
gb|ACA25080.1|  serine/threonine protein kinase A                     55.5    5e-07   Populus tremula [European aspen]
gb|ACA25087.1|  serine/threonine protein kinase A                     55.1    6e-07   Populus tremula [European aspen]
gb|ACA25085.1|  serine/threonine protein kinase A                     55.1    6e-07   Populus tremula [European aspen]
gb|ACA25083.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
gb|ACA25082.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
gb|ACA25100.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
gb|ACA25089.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
ref|XP_006405671.1|  hypothetical protein EUTSA_v10027636mg           57.8    7e-07   Eutrema salsugineum [saltwater cress]
gb|ACA25092.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
gb|ACA25090.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
gb|ACA25101.1|  serine/threonine protein kinase A                     55.1    7e-07   Populus tremula [European aspen]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA  57.8    8e-07   Nelumbo nucifera [Indian lotus]
gb|ACA25099.1|  serine/threonine protein kinase A                     55.1    8e-07   Populus tremula [European aspen]
gb|ACA25081.1|  serine/threonine protein kinase A                     55.1    8e-07   Populus tremula [European aspen]
ref|XP_008360254.1|  PREDICTED: receptor-like protein kinase ANXUR1   54.3    9e-07   
emb|CDP05401.1|  unnamed protein product                              57.4    9e-07   Coffea canephora [robusta coffee]
gb|ACA25098.1|  serine/threonine protein kinase A                     54.7    9e-07   Populus tremula [European aspen]
emb|CDP20271.1|  unnamed protein product                              57.4    1e-06   Coffea canephora [robusta coffee]
emb|CDP19885.1|  unnamed protein product                              57.4    1e-06   Coffea canephora [robusta coffee]
gb|ACA25096.1|  serine/threonine protein kinase A                     54.3    1e-06   Populus tremula [European aspen]
gb|ACA25086.1|  serine/threonine protein kinase A                     54.3    1e-06   Populus tremula [European aspen]
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                  57.0    1e-06   Glycine soja [wild soybean]
gb|ACA25088.1|  serine/threonine protein kinase A                     54.3    1e-06   Populus tremula [European aspen]
ref|NP_001238686.1|  receptor-like kinase                             57.0    1e-06   Glycine max [soybeans]
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1   57.0    1e-06   Nicotiana sylvestris
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...  56.6    2e-06   Brassica rapa
ref|XP_002528705.1|  kinase, putative                                 56.6    2e-06   
emb|CDP19887.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
gb|KDP24658.1|  hypothetical protein JCGZ_26517                       55.1    2e-06   Jatropha curcas
gb|EMS66619.1|  hypothetical protein TRIUR3_14353                     56.2    2e-06   Triticum urartu
emb|CDP17056.1|  unnamed protein product                              56.2    2e-06   Coffea canephora [robusta coffee]
ref|XP_002530995.1|  kinase, putative                                 56.2    2e-06   Ricinus communis
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA  55.8    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...  55.8    3e-06   Solanum tuberosum [potatoes]
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1   55.8    3e-06   Prunus mume [ume]
emb|CDX78036.1|  BnaA09g32310D                                        55.8    3e-06   
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1   55.8    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg           55.8    3e-06   Prunus persica
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA  55.8    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA  55.8    3e-06   Solanum lycopersicum
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g           55.5    4e-06   
gb|EMT17367.1|  Receptor-like protein kinase FERONIA                  55.5    4e-06   
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...  55.5    4e-06   
gb|EMS57312.1|  Receptor-like protein kinase FERONIA                  55.5    4e-06   Triticum urartu
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1   55.5    4e-06   Vitis vinifera
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1   55.5    5e-06   Prunus mume [ume]
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g           55.1    5e-06   Phaseolus vulgaris [French bean]
gb|EMT03407.1|  Receptor-like protein kinase FERONIA                  55.1    5e-06   
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg           55.1    6e-06   Eutrema salsugineum [saltwater cress]
gb|KJB42940.1|  hypothetical protein B456_007G175600                  55.1    6e-06   Gossypium raimondii
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1   55.1    6e-06   Nicotiana tomentosiformis
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg           54.7    7e-06   Prunus persica
ref|XP_010097778.1|  Receptor-like protein kinase                     54.7    7e-06   Morus notabilis
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA  54.7    8e-06   Sesamum indicum [beniseed]
gb|ACA25079.1|  serine/threonine protein kinase A                     52.0    8e-06   Populus tremula [European aspen]
gb|EMT28751.1|  Receptor-like protein kinase FERONIA                  54.3    9e-06   
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1   54.3    9e-06   Populus euphratica
ref|XP_008390575.1|  PREDICTED: receptor-like protein kinase ANXUR1   53.9    9e-06   
gb|ABT18098.1|  FERONIA receptor-like kinase                          54.3    1e-05   Cardamine flexuosa
gb|EAY95324.1|  hypothetical protein OsI_17151                        53.9    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001053685.1|  Os04g0586500                                     53.9    1e-05   
ref|XP_007032832.1|  Malectin/receptor-like protein kinase family...  53.9    1e-05   
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g           53.9    1e-05   Phaseolus vulgaris [French bean]
gb|KDP24661.1|  hypothetical protein JCGZ_26520                       53.9    1e-05   Jatropha curcas
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1   53.9    1e-05   
gb|AHZ44752.1|  CrRLK1L-like protein                                  53.9    1e-05   Platanus x hispanica [London plane tree]
gb|EMT13360.1|  hypothetical protein F775_08521                       53.5    1e-05   
ref|XP_008367132.1|  PREDICTED: uncharacterized protein LOC103430767  53.9    1e-05   
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA  53.9    1e-05   Brachypodium distachyon [annual false brome]
gb|KFK23480.1|  hypothetical protein AALP_AAs40899U000100             52.0    1e-05   Arabis alpina [alpine rockcress]
ref|XP_009372136.1|  PREDICTED: receptor-like protein kinase ANXUR2   53.1    2e-05   Pyrus x bretschneideri [bai li]
gb|KDP27676.1|  hypothetical protein JCGZ_20096                       53.5    2e-05   Jatropha curcas
ref|XP_007045784.1|  Malectin/receptor-like protein kinase family...  53.5    2e-05   Theobroma cacao [chocolate]
emb|CDP06378.1|  unnamed protein product                              53.5    2e-05   Coffea canephora [robusta coffee]
ref|XP_010246590.1|  PREDICTED: receptor-like protein kinase FERONIA  53.5    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2   53.5    2e-05   Elaeis guineensis
ref|XP_006338348.1|  PREDICTED: receptor-like protein kinase FERO...  53.5    2e-05   Solanum tuberosum [potatoes]
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g           53.1    2e-05   
ref|XP_010667956.1|  PREDICTED: receptor-like protein kinase FERONIA  52.8    2e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP27915.1|  hypothetical protein JCGZ_18995                       53.1    2e-05   Jatropha curcas
gb|ABT18099.1|  FERONIA receptor-like kinase                          53.1    2e-05   Cardamine flexuosa
gb|KEH43006.1|  malectin/receptor-like kinase family protein          53.1    2e-05   Medicago truncatula
emb|CDY37883.1|  BnaC04g31230D                                        53.1    2e-05   Brassica napus [oilseed rape]
ref|XP_010552466.1|  PREDICTED: putative receptor-like protein ki...  53.1    2e-05   Tarenaya hassleriana [spider flower]
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                  53.1    2e-05   
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1   53.1    2e-05   
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g           53.1    3e-05   Phaseolus vulgaris [French bean]
ref|NP_198716.1|  putative receptor-like protein kinase               53.1    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...  53.1    3e-05   Cicer arietinum [garbanzo]
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  53.1    3e-05   Malus domestica [apple tree]
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1   53.1    3e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB29840.1|  hypothetical protein B456_005G120700                  53.1    3e-05   Gossypium raimondii
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...  52.8    3e-05   Cicer arietinum [garbanzo]
gb|KEH24563.1|  malectin/receptor-like kinase family protein          52.8    3e-05   Medicago truncatula
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                  52.8    3e-05   Triticum urartu
ref|XP_002316044.1|  Pto-like kinase OGw family protein               52.8    3e-05   
emb|CDP05402.1|  unnamed protein product                              52.8    3e-05   Coffea canephora [robusta coffee]
ref|XP_009139818.1|  PREDICTED: putative receptor-like protein ki...  52.8    3e-05   Brassica rapa
emb|CDX74491.1|  BnaA04g08980D                                        52.8    3e-05   
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA  52.8    3e-05   Eucalyptus grandis [rose gum]
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1   52.4    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA  52.4    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_006844774.1|  hypothetical protein AMTR_s00016p00259140        52.4    4e-05   
ref|XP_002870808.1|  hypothetical protein ARALYDRAFT_916421           52.4    4e-05   
emb|CDY36996.1|  BnaC06g12670D                                        52.4    4e-05   Brassica napus [oilseed rape]
ref|XP_006286236.1|  hypothetical protein CARUB_v10007805mg           52.4    5e-05   Capsella rubella
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                  52.4    5e-05   
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2   52.4    5e-05   
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...  52.0    5e-05   Brassica rapa
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA             52.0    6e-05   Morus notabilis
gb|KDP27678.1|  hypothetical protein JCGZ_20098                       51.6    6e-05   Jatropha curcas
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA  51.6    7e-05   Brassica rapa
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1   51.6    7e-05   Vitis vinifera
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2   51.6    8e-05   Elaeis guineensis
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA  51.2    9e-05   
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA  51.2    9e-05   Nelumbo nucifera [Indian lotus]
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...  51.2    1e-04   
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                  51.2    1e-04   
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...  51.2    1e-04   Brassica rapa
emb|CDX74492.1|  BnaA04g08970D                                        51.2    1e-04   
ref|XP_009139816.1|  PREDICTED: putative receptor-like protein ki...  51.2    1e-04   Brassica rapa
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA  51.2    1e-04   
ref|XP_003552590.2|  PREDICTED: receptor-like protein kinase FERO...  51.2    1e-04   
gb|KDP24278.1|  hypothetical protein JCGZ_25574                       51.2    1e-04   Jatropha curcas
gb|ABT18097.1|  FERONIA receptor-like kinase                          50.8    1e-04   Cardamine flexuosa
ref|XP_002519226.1|  ATP binding protein, putative                    50.8    1e-04   Ricinus communis
ref|NP_198715.1|  putative receptor-like protein kinase               50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAM10331.1|  AT5g38990/K15E6_170                                   50.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA  50.8    1e-04   Nicotiana sylvestris
gb|KDP24662.1|  hypothetical protein JCGZ_26521                       50.8    1e-04   Jatropha curcas
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...  50.8    1e-04   Setaria italica
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...  50.4    1e-04   
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA  50.4    1e-04   Brachypodium distachyon [annual false brome]
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA  50.4    1e-04   Prunus mume [ume]
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...  50.4    2e-04   Glycine max [soybeans]
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...  50.4    2e-04   Cucumis melo [Oriental melon]
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                   50.4    2e-04   Glycine soja [wild soybean]
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g           50.4    2e-04   Phaseolus vulgaris [French bean]
ref|NP_198718.1|  putative receptor-like protein kinase               50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007144836.1|  hypothetical protein PHAVU_007G188300g           50.4    2e-04   Phaseolus vulgaris [French bean]
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260        50.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_003552594.2|  PREDICTED: receptor-like protein kinase FERO...  50.4    2e-04   
ref|XP_007032799.1|  Malectin/receptor protein kinase family prot...  50.1    2e-04   
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2   50.1    2e-04   Pyrus x bretschneideri [bai li]
gb|KHN37917.1|  Putative receptor-like protein kinase                 49.7    2e-04   Glycine soja [wild soybean]
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1   50.1    2e-04   Phoenix dactylifera
gb|KDP23678.1|  hypothetical protein JCGZ_23511                       50.1    2e-04   Jatropha curcas
emb|CDX67422.1|  BnaA07g14620D                                        50.1    2e-04   
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...  49.7    3e-04   Glycine max [soybeans]
gb|KHN37916.1|  Receptor-like protein kinase FERONIA                  50.1    3e-04   Glycine soja [wild soybean]
ref|XP_002870806.1|  predicted protein                                49.7    3e-04   
ref|XP_002308259.1|  kinase family protein                            49.7    3e-04   
dbj|BAJ93584.1|  predicted protein                                    49.7    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...  49.7    3e-04   Glycine max [soybeans]
ref|XP_006603591.1|  PREDICTED: receptor-like protein kinase FERO...  49.7    3e-04   
gb|EAY75971.1|  hypothetical protein OsI_03893                        49.7    3e-04   Oryza sativa Indica Group [Indian rice]
emb|CDX88223.1|  BnaA06g28140D                                        49.7    3e-04   
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710        49.7    3e-04   Sorghum bicolor [broomcorn]
ref|NP_001044372.1|  Os01g0769700                                     49.7    3e-04   
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA  49.7    3e-04   Tarenaya hassleriana [spider flower]
gb|EPS73118.1|  hypothetical protein M569_01631                       49.7    3e-04   Genlisea aurea
gb|KJB38065.1|  hypothetical protein B456_006G235700                  49.7    3e-04   Gossypium raimondii
ref|XP_006842554.1|  hypothetical protein AMTR_s00077p00138840        49.7    3e-04   
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA  49.7    3e-04   Populus euphratica
emb|CDP21458.1|  unnamed protein product                              47.0    4e-04   Coffea canephora [robusta coffee]
emb|CBI27305.3|  unnamed protein product                              49.3    4e-04   Vitis vinifera
ref|XP_002273707.2|  PREDICTED: receptor-like protein kinase FERONIA  49.3    4e-04   Vitis vinifera
ref|XP_004976623.1|  PREDICTED: receptor-like protein kinase FERO...  49.3    4e-04   Setaria italica
gb|KJB80425.1|  hypothetical protein B456_013G096400                  49.3    4e-04   Gossypium raimondii
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA  49.3    4e-04   Zea mays [maize]
gb|ABT18095.1|  FERONIA receptor-like kinase                          49.3    4e-04   Cardamine flexuosa
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...  49.3    4e-04   Theobroma cacao [chocolate]
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA  49.3    4e-04   Fragaria vesca subsp. vesca
ref|NP_198719.1|  putative receptor-like protein kinase               49.3    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA  49.3    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006285765.1|  hypothetical protein CARUB_v10007239mg           48.9    5e-04   Capsella rubella
gb|KHN37921.1|  Receptor-like protein kinase FERONIA                  48.9    5e-04   Glycine soja [wild soybean]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA  48.9    5e-04   Tarenaya hassleriana [spider flower]
emb|CDY37884.1|  BnaC04g31220D                                        48.9    5e-04   Brassica napus [oilseed rape]
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1   48.9    5e-04   Brachypodium distachyon [annual false brome]
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA  48.9    5e-04   Pyrus x bretschneideri [bai li]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                 48.9    6e-04   Citrus sinensis [apfelsine]
gb|KJB71482.1|  hypothetical protein B456_011G124900                  48.9    6e-04   Gossypium raimondii
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg           48.9    6e-04   Citrus clementina [clementine]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...  48.9    6e-04   Citrus sinensis [apfelsine]
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg           48.9    6e-04   Prunus persica
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA  48.9    6e-04   Sesamum indicum [beniseed]
ref|XP_007151356.1|  hypothetical protein PHAVU_004G039600g           48.9    6e-04   Phaseolus vulgaris [French bean]
ref|XP_010441032.1|  PREDICTED: probable receptor-like protein ki...  48.5    6e-04   
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA  48.5    6e-04   Populus euphratica
ref|XP_009419820.1|  PREDICTED: receptor-like protein kinase FERO...  48.5    6e-04   
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320        48.5    7e-04   Sorghum bicolor [broomcorn]
ref|XP_010441031.1|  PREDICTED: probable receptor-like protein ki...  48.5    7e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009419819.1|  PREDICTED: receptor-like protein kinase FERO...  48.5    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK06468.1|  predicted protein                                    48.5    7e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...  48.5    7e-04   
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg           48.5    7e-04   Eutrema salsugineum [saltwater cress]
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...  48.5    8e-04   Setaria italica
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA  48.5    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967845.1|  PREDICTED: receptor-like protein kinase FERO...  48.1    9e-04   
ref|XP_010694005.1|  PREDICTED: putative receptor-like protein ki...  48.1    0.001   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694013.1|  PREDICTED: putative receptor-like protein ki...  48.1    0.001   
ref|XP_002457574.1|  hypothetical protein SORBIDRAFT_03g009660        48.1    0.001   
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1   48.1    0.001   Eucalyptus grandis [rose gum]



>ref|XP_009588433.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=882

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 2/72 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVF  418
            FLL+CGA S +T++D R W+TD H+   +P+N A +S+ AIA EQG L ++VP+  AR+F
Sbjct  34   FLLNCGASSGATAEDNRLWNTDIHFTNLLPSNFATISTTAIASEQGSL-TRVPYMNARIF  92

Query  419  TSELTYSFRVSP  454
             S+ TY+F VSP
Sbjct  93   KSQFTYTFPVSP  104



>ref|XP_009790514.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=879

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CGA S +T +D R W+TD H+   +P+N   +S+PAIA +    + VP+  AR+F 
Sbjct  34   FLLNCGASSDATDEDDRLWNTDIHFTNLLPSNFTTISTPAIASEQGSVTTVPYMNARIFK  93

Query  422  SELTYSFRVSP  454
            S+ TY+F VSP
Sbjct  94   SQFTYTFPVSP  104



>ref|XP_006338349.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=856

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT-AR  412
            + LL+CGA S +T +  R WDTD H+  F+P++ + +S+ A A EQ P  ++VP+TT AR
Sbjct  31   YVLLNCGAQSATTDETDRRWDTDTHFPNFLPSDFSNISTTATASEQDPSVNRVPYTTGAR  90

Query  413  VFTSELTYSFRVSP  454
            +  S  TY+FRVSP
Sbjct  91   IMKSRFTYTFRVSP  104



>ref|XP_004232151.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=869

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTA-R  412
            F LL+CGA S  T   GR WDTD H+  F+P++ + +S+ A A EQ P  +++P+TT  R
Sbjct  31   FVLLNCGAQSAITDDTGRRWDTDTHFPNFLPSDFSSISTTATALEQDPSVNRIPYTTGIR  90

Query  413  VFTSELTYSFRVSP  454
            +  S+ TY+FRV+P
Sbjct  91   IMRSQFTYTFRVTP  104



>ref|XP_009140101.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Brassica rapa]
Length=811

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            + FL++CGA S +    GR W T+  Y   MP+N   LS + + + Q    SQVPFT AR
Sbjct  24   DVFLINCGATSDTNDASGRTWTTE--YETLMPSNLDNLSFAASPSYQDVEVSQVPFTEAR  81

Query  413  VFTSELTYSFRVSP  454
            +F SE TY F+VSP
Sbjct  82   IFQSEFTYKFQVSP  95



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTARVF  418
             LL+CGA S  TS DGR WD D+   +F  +N  E SS  A + QGP   QVP+ TAR+F
Sbjct  51   ILLNCGASSNLTSPDGRSWDGDSQS-KFAASNPPEASSVFAASTQGPSGDQVPYMTARIF  109

Query  419  TSELTYSFRVSP  454
             S+ TY+F V P
Sbjct  110  HSKFTYTFPVLP  121



>gb|KJB10568.1| hypothetical protein B456_001G207900 [Gossypium raimondii]
Length=794

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ LL+CGA S +TS DGR+W  D+ +L     NT+  SS A + Q P  +QVP+ TAR 
Sbjct  28   DYILLNCGASSNTTSYDGRNWVADDDHLY---ANTSSFSSTA-SYQDPSVTQVPYMTARF  83

Query  416  FTSELTYSFRVSP  454
            F  E TY F +SP
Sbjct  84   FRGEFTYKFPLSP  96



>ref|XP_011009252.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=744

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  +  Q P  +QVP+ TAR+
Sbjct  48   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPEASS--VTXQDPSVNQVPYMTARI  104

Query  416  FTSELTYSFRVSP  454
            F S+ TY+F V P
Sbjct  105  FHSKFTYTFPVLP  117



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F L+CG P  ST  DGR W +D    +F  + T   +SPA A Q P   +VP+ TAR+F 
Sbjct  34   FFLNCGGPPDSTDPDGRKWTSDIGS-KFALSTTKSSTSPA-ATQKPSVPEVPYMTARIFQ  91

Query  422  SELTYSFRVSP  454
            SE TYSF V+P
Sbjct  92   SEFTYSFPVAP  102



>dbj|BAK00988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 1/69 (1%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGAP+ +T  DGR WD D+   +F+P+  A +++ A  +   L S VP+ TARVF S 
Sbjct  39   LSCGAPASATDSDGRAWDGDSAS-KFLPSTNAGVAARASYQDPSLPSSVPYVTARVFASS  97

Query  428  LTYSFRVSP  454
             TY+F + P
Sbjct  98   HTYTFPLRP  106



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  A + Q P  +QVP+ TAR
Sbjct  34   DLILLNCGASSNLSSPDGRGWDGDSQS-KFAASNPPEASSVFAASNQDPSVNQVPYMTAR  92

Query  413  VFTSELTYSFRVSP  454
            +F S+ TY+F V P
Sbjct  93   IFHSKFTYTFPVLP  106



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +N  E SS  A + Q P  +QVP+ TAR
Sbjct  35   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPETSSVFAASNQDPSVNQVPYMTAR  93

Query  413  VFTSELTYSFRVSP  454
            +F S+ TY+F V P
Sbjct  94   IFHSKFTYTFPVLP  107



>emb|CDO98765.1| unnamed protein product [Coffea canephora]
Length=859

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             +L+CGAP+ +T  +GR W  D+   +F+ ++   + + A+++   L S VP+ TARVF 
Sbjct  35   LVLACGAPTNATDNNGRSWIPDS---KFLASSDNSIVATALSQDPSLPSTVPYMTARVFQ  91

Query  422  SELTYSFRVSP  454
            S+ TY+FR+SP
Sbjct  92   SQFTYTFRISP  102



>ref|XP_007032827.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03753.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=866

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVF  418
             LL CGA S +TS DGR W+ D+ + +F   N    S  + A +Q    +++P+ TAR+F
Sbjct  33   ILLDCGAQSNTTSSDGRSWEADSDHSKFSAPNRENASFVSTASQQDSSVTRIPYMTARIF  92

Query  419  TSELTYSFRVSP  454
             SE TY+F VSP
Sbjct  93   RSEFTYNFPVSP  104



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 ref|XP_004161706.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cucumis 
sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL CG PS +   D R W+TD+   +F+P  T + S    A Q P    +PF TARV
Sbjct  38   DVILLDCGGPSTANDIDNRKWNTDDKS-KFVPA-TGDSSVSKAATQDPSVPDIPFMTARV  95

Query  416  FTSELTYSFRVSP  454
            F+S  TYSF V+P
Sbjct  96   FSSSFTYSFPVAP  108



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
            F+LSCG+ + ST  DGR WD D+ YL+     + + S P+ A+ Q P L S +P+  AR+
Sbjct  30   FVLSCGSVNSSTDSDGRVWDLDSKYLK-----SEDNSVPSKAQFQDPSLPSTIPYMNARI  84

Query  416  FTSELTYSFRVSP  454
            FT+E +Y+F VSP
Sbjct  85   FTAEASYTFSVSP  97



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TDN   +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  36   ILLNCGGPPSSTDTDGREWTTDNGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  94   APYTYTFPVA  103



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TDN   +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  32   ILLNCGGPPSSTDTDGREWTTDNGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  89

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  90   APYTYTFPVA  99



>ref|XP_006427852.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
 ref|XP_006464563.1| PREDICTED: putative receptor-like protein kinase At5g39000-like 
[Citrus sinensis]
 gb|ESR41092.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
Length=911

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            ++ L+ CG  S +TS DGR+WD D H  +F  +N+A  S  + A  Q     QVP+ TAR
Sbjct  33   DYILIICGESSNTTSSDGRNWDGDAHS-KFSSSNSATKSFTSRASFQENSVPQVPYMTAR  91

Query  413  VFTSELTYSFRVSP  454
            VF  E TY+F VSP
Sbjct  92   VFPEEFTYTFPVSP  105



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S++T  DG+ W  D    +F+P++   L+S A A QGP   +VP+ TAR+F 
Sbjct  35   ILLNCGAASETTDTDGQKWSGDVGS-KFLPSSDNTLTSRA-ATQGPSVPEVPYMTARIFH  92

Query  422  SELTYSFRVS  451
            SE TY+F V+
Sbjct  93   SEFTYTFPVT  102



>gb|KDO53394.1| hypothetical protein CISIN_1g002533mg [Citrus sinensis]
Length=911

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            ++ L+ CG  S +TS DGR+WD D H  +F  +N+A  S  + A  Q     QVP+ TAR
Sbjct  33   DYILIICGESSNTTSSDGRNWDGDAHS-KFSSSNSATKSFTSRASFQENSVPQVPYMTAR  91

Query  413  VFTSELTYSFRVSP  454
            VF  E TY+F VSP
Sbjct  92   VFPEEFTYTFPVSP  105



>emb|CDP15786.1| unnamed protein product [Coffea canephora]
Length=517

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S +TS DGR W+ D    +F+P + A +S    A EQ    +Q+PF TAR
Sbjct  30   DYILINCGSSSNATSTDGRHWEGDVGS-KFLPNDVANISLADTATEQHSSVTQIPFLTAR  88

Query  413  VFTSELTYSFRVSP  454
            +  S+ +Y+F VSP
Sbjct  89   IIRSQFSYTFPVSP  102



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ S+  DGR+W TDN       + T + ++   A Q P   QVPF TAR+F 
Sbjct  35   ILLNCGGPAVSSDPDGREWTTDNG--SKFGSLTGKSTTSQAAAQDPAVPQVPFMTARIFQ  92

Query  422  SELTYSFRVS  451
            S+ TYSF V+
Sbjct  93   SQYTYSFPVA  102



>gb|KEH32083.1| feronia receptor-like kinase [Medicago truncatula]
Length=701

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  38   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  95

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  96   SPYTYSFPVA  105



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+L+CGA + +T  +GR W +D    +F+ +  + LS+ A ++   L S VP+ TAR+F 
Sbjct  48   FVLACGATADATDSNGRKWASD---AKFLISPNSSLSATAQSQDPSLPSTVPYMTARIFK  104

Query  422  SELTYSFRVSP  454
            SE TY F VSP
Sbjct  105  SEATYKFSVSP  115



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  38   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  95

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  96   SPYTYSFPVA  105



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P+ ST  DGR+W TDN   +F  +     +S A A Q P   Q+PF TARVF 
Sbjct  32   ILLNCGGPAVSTDPDGREWTTDNGS-KFGSSAVKSTTSQA-ATQDPAVPQIPFMTARVFQ  89

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  90   SPYTYSFPVA  99



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W +D  + YL+   ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDGLKDADGRKWGSDIGSTYLKGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVSP  454
            F SE TYSF V+P
Sbjct  91   FESEFTYSFPVAP  103



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W +D  + YL+   ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDGLKDADGRKWGSDIGSTYLKGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVSP  454
            F SE TYSF V+P
Sbjct  91   FQSEFTYSFPVAP  103



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL CG PS +   D R W+TD+   +F+P       S A A Q P    +PF TARV
Sbjct  38   DVILLDCGGPSTANDIDSRKWNTDDKS-KFVPAAGDSTVSKA-ATQDPSVPDIPFMTARV  95

Query  416  FTSELTYSFRVSP  454
            F+S  TYSF V+P
Sbjct  96   FSSNFTYSFPVAP  108



>gb|ACA25097.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>gb|ACA25095.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S   S DGR WD D+   +F  +N  E SS    + Q P  +QVP+ TAR
Sbjct  33   DLILLNCGASSNLLSPDGRGWDGDSQS-KFAASNPPEASSVFEASNQDPSVNQVPYMTAR  91

Query  413  VFTSELTYSFRVSP  454
            +F S+ TY+F V P
Sbjct  92   IFHSKFTYTFPVLP  105



>gb|ACA25102.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>gb|ACA25084.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>ref|XP_004243035.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=854

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+LSCGA S +T  DGR W  D+ Y  F  ++   ++S A  +   L S +P+ TAR+F 
Sbjct  32   FVLSCGATSNATDADGRIWSPDSTY--FPSSSGNSITSKAKYQDPSLISDIPYMTARIFK  89

Query  422  SELTYSFRVSP  454
            ++ TYSF VSP
Sbjct  90   NQTTYSFPVSP  100



>ref|XP_006358215.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Solanum 
tuberosum]
Length=854

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+LSCGA S +T  DGR W  D+ Y  F  ++   ++S A  +   L S +P+ TAR+F 
Sbjct  32   FVLSCGATSNATDADGRIWSPDSTY--FPSSSGNSITSKAKYQDPSLISDIPYMTARIFK  89

Query  422  SELTYSFRVSP  454
            ++ TYSF VSP
Sbjct  90   NQTTYSFPVSP  100



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CGA S  +S DGR WD D+   +F  +N  E S      Q P  +QVP+ TAR+
Sbjct  48   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASNPPEAS--XCDSQDPSVNQVPYMTARI  104

Query  416  FTSELTYSFRVSP  454
            F S+ TY+F V P
Sbjct  105  FHSKFTYTFPVLP  117



>ref|XP_010319813.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=873

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+LSCGA S +T  DGR W  D+ Y  F  ++   ++S A  +   L S +P+ TAR+F 
Sbjct  51   FVLSCGATSTATDADGRIWSPDSTY--FPSSSGNSITSKAKYQDPSLISDIPYMTARIFK  108

Query  422  SELTYSFRVSP  454
            ++ TYSF VSP
Sbjct  109  NQTTYSFPVSP  119



>gb|KFK33632.1| hypothetical protein AALP_AA5G038800 [Arabis alpina]
Length=827

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            + FL +CG    +T   GR+W  ++   +  PTN+   S PA A  QGP    +P+  AR
Sbjct  29   DVFLFNCGDTFNNTDDTGRNWTAEDP--KTFPTNSENASFPAYANSQGPSVLLIPYKEAR  86

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF VSP
Sbjct  87   IFQSDFTYSFSVSP  100



>gb|EMT01093.1| hypothetical protein F775_16963 [Aegilops tauschii]
Length=509

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCG+ + +T  DGR WD D+  + F+P+  A +++ A  +   L S VP+ TARVF S 
Sbjct  41   LSCGSSASATDSDGRAWDGDSASM-FLPSTNAGVAARASYQDPSLPSTVPYMTARVFASS  99

Query  428  LTYSFRVSP  454
             TY+F V P
Sbjct  100  HTYTFLVRP  108



>gb|ACA25080.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAEKQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25087.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25085.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25093.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25094.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25083.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25082.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25100.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25089.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>ref|XP_006405671.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
 gb|ESQ47124.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
Length=876

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNH-YLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + FL +CGA S +    GR+W  +N   L   P N +  S  +  + G    QVP+TTAR
Sbjct  31   DVFLFNCGATSDTVDNTGRNWTAENRKILSSNPVNASFPSESSFQDSG--VPQVPYTTAR  88

Query  413  VFTSELTYSFRVSP  454
            +F SE TYSF VSP
Sbjct  89   IFRSEFTYSFPVSP  102



>gb|ACA25092.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25090.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25101.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +ST  DGR W  D    +F P     L+S A A Q P    VP+ TARVF 
Sbjct  38   ILLNCGAAQESTDSDGRKWTGDVGS-KFAPAAANTLTSTA-ATQDPSVPDVPYMTARVFR  95

Query  422  SELTYSFRVS  451
            SE TYSF V+
Sbjct  96   SEFTYSFPVA  105



>gb|ACA25099.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|ACA25081.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>ref|XP_008360254.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=115

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTA  409
            E ++++CG+ S  T  DGR W  D+ +L+     ++E S  A A+ Q P L SQ+P+ +A
Sbjct  31   ESYIIACGSSSGGTDSDGRRWVPDSRFLK-----SSENSKTATAQYQDPSLPSQIPYMSA  85

Query  410  RVFTSELTYSFRVSP  454
            R+F S  +Y F VSP
Sbjct  86   RIFNSAASYKFFVSP  100



>emb|CDP05401.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ L++CG  S +TS DGR+W  D    +F P + A +SS A+    P  S  PF TAR+
Sbjct  30   DYILINCGTSSNATSADGRNWYGDAGS-KFSPNDMASISS-AVTATAPSVSGAPFLTARI  87

Query  416  FTSELTYSFRVSP  454
              S  +Y+F VSP
Sbjct  88   IRSNFSYTFPVSP  100



>gb|ACA25098.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +     S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAEKQDPSFPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>emb|CDP20271.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S STS DGR WD D    +F P + A +SS   A E     S VPF++AR
Sbjct  31   DYILINCGSSSNSTSVDGRKWDGDVGS-KFSPNDMANISSAVTATELDSSVSGVPFSSAR  89

Query  413  VFTSELTYSFRVS  451
            +  S+ +Y+F VS
Sbjct  90   IIRSQFSYTFPVS  102



>emb|CDP19885.1| unnamed protein product [Coffea canephora]
Length=895

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG  S +TS DGR+W  D    +F P + A +SS   A EQ P  S  P+  AR
Sbjct  30   DYILINCGTSSNATSADGRNWYGDAGS-KFSPNDMATISSAVTAIEQDPSVSGAPYLNAR  88

Query  413  VFTSELTYSFRVSP  454
            +  S  +Y+F VSP
Sbjct  89   IIRSNFSYTFPVSP  102



>gb|ACA25096.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +     S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSFPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>gb|ACA25086.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +     S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSFPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TD    +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLNCGGPPSSTDTDGREWTTDVGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  92

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  93   APYTYTFPVA  102



>gb|ACA25088.1| serine/threonine protein kinase A, partial [Populus tremula]
 gb|ACA25091.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGRDW  D  ++   P N+  ++S A  +     S +P+ TAR+FT
Sbjct  37   YILACGASGAGTDSDGRDWQPDAKHIN-SPGNS--ITSTAENQDPSFPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  94   SESTYKFSV  102



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P  ST  DGR+W TD    +F  +     +SPA A Q P   QVP+ TARVF 
Sbjct  24   ILLNCGGPPSSTDTDGREWTTDVGS-KFGSSTAKSATSPA-ATQDPAVPQVPYMTARVFH  81

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  82   APYTYTFPVA  91



>ref|XP_009799586.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=860

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+L+CGA S +T  DGR W  D+ +L   P+  + ++S A  +   L S +P+ TAR+F 
Sbjct  35   FVLACGATSNATDADGRIWSPDSTHL---PSGNS-ITSKAKYQDPSLVSDIPYMTARIFK  90

Query  422  SELTYSFRVSP  454
            ++ TYSF VSP
Sbjct  91   TQTTYSFPVSP  101



>ref|XP_009115877.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=875

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 5/75 (7%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + FL +CGA S +T   GR W  +N   Q + +N   A  SS A +++  +  QVP+  A
Sbjct  30   DLFLFNCGATSDNTDNTGRKWTAENR--QTLSSNAVNASFSSDASSQESGV-PQVPYLKA  86

Query  410  RVFTSELTYSFRVSP  454
            R+F S+ TYSF VSP
Sbjct  87   RIFRSDFTYSFPVSP  101



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 2/67 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA S +   DG+ W  D +    + ++ + +SS A   Q P  SQ+PF TARVF 
Sbjct  33   ILLDCGATSDNADDDGQKWTADKNSKFLLSSDNSTISSAAT--QDPAVSQIPFMTARVFH  90

Query  422  SELTYSF  442
            S  TYSF
Sbjct  91   SNFTYSF  97



>emb|CDP19887.1| unnamed protein product [Coffea canephora]
Length=825

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ L++CG+ S +TS DGR+W  D    +F P + A +SS   A EQ    S  P+ TAR
Sbjct  30   DYILINCGSSSNATSADGRNWYGDAGS-KFSPNDMATISSAVTATEQDSSVSGAPYLTAR  88

Query  413  VFTSELTYSFRVSP  454
            +  S  +Y+F VSP
Sbjct  89   IIRSNFSYTFPVSP  102



>gb|KDP24658.1| hypothetical protein JCGZ_26517 [Jatropha curcas]
Length=264

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            E FLL+CGA   +TS DGR+W +D +  +F+  N+   S    A  Q P  +QVPF TAR
Sbjct  48   EIFLLNCGASFDTTSLDGRNWVSDFNS-KFLAFNSQISSLEYTASLQDPSVTQVPFMTAR  106

Query  413  VFTSELTYSFRVSP  454
            +  S+  Y F VSP
Sbjct  107  ISQSKFIYVFPVSP  120



>gb|EMS66619.1| hypothetical protein TRIUR3_14353 [Triticum urartu]
Length=503

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGA + +T  DGR W+ D+   +F+ +  A +++ A  +   L S VP+ TARVF S 
Sbjct  34   LSCGASAPATDSDGRAWEGDSTS-KFLASTNAGVAARASYQDPSLPSSVPYVTARVFASS  92

Query  428  LTYSFRVSP  454
             TY+F VSP
Sbjct  93   HTYTFLVSP  101



>emb|CDP17056.1| unnamed protein product [Coffea canephora]
Length=881

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             +L CG+    T  DGR W+ D  YL  + +N   ++S A  +   L S VP+ TAR+FT
Sbjct  32   LVLDCGSSDGGTDADGRKWEADAKYL--VNSNDKSIASKADNQDPSLPSDVPYMTARIFT  89

Query  422  SELTYSFRVS  451
            SE  Y F V+
Sbjct  90   SEAIYQFPVA  99



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQ-GPLASQVPFTTAR  412
            +  LL+CG  S +TS DGR WD D    +F+ +N+   S    A Q  P A++VP+  AR
Sbjct  27   DLILLNCGTSSSATSLDGRGWDGDAQS-KFLASNSETASYGCSASQRDPSATEVPYMDAR  85

Query  413  VFTSELTYSFRVSP  454
            V  S+ TY F VSP
Sbjct  86   VSQSKFTYLFPVSP  99



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG+ S++T  DG+ W  D    +F P+    L S A A QGP    VP+ TAR+F 
Sbjct  35   ILLNCGSTSETTDTDGQKWTGDVGS-KFAPSTANTLISTA-ATQGPSVPDVPYMTARIFR  92

Query  422  SELTYSFRVS  451
            SE TY+F V+
Sbjct  93   SEFTYTFPVA  102



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (57%), Gaps = 7/72 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
             LL+CG P      DGR W TD  + Y+    ++T++      A+Q P   QVPF +ARV
Sbjct  36   ILLNCGGPDNLPDADGRKWGTDIGSKYMLGSKSSTSD-----AADQKPSVPQVPFMSARV  90

Query  416  FTSELTYSFRVS  451
            F SE TYSF V+
Sbjct  91   FQSEFTYSFPVA  102



>ref|XP_008218280.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=875

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 8/73 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
             +L CG+ +++   DGR W  D+ YL      T    SPA A+ Q P L S+VP+  AR+
Sbjct  31   LILGCGSENEAKDADGRKWQPDSKYL------TGSKGSPAQAQYQDPALLSEVPYMKARI  84

Query  416  FTSELTYSFRVSP  454
            FTS  TY F V P
Sbjct  85   FTSNATYKFPVKP  97



>emb|CDX78036.1| BnaA09g32310D [Brassica napus]
Length=867

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDN-HYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            + FL +CGA S +T   GR W  +N   L     N +  S  +  E G    QVP+  AR
Sbjct  30   DLFLFNCGATSDNTDNTGRKWTAENRQTLSSNAVNASFSSDASFQESG--VPQVPYMKAR  87

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF VSP
Sbjct  88   IFRSDFTYSFPVSP  101



>ref|XP_010258502.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=855

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
            FLLSCG+ S     DGR W+ D+ YL+     T + S P+ AE Q P L S +P+ +ARV
Sbjct  31   FLLSCGSTSSDADSDGRTWEPDSKYLE-----TQDNSMPSTAEFQDPSLPSTIPYMSARV  85

Query  416  FTSELTYSFRVS  451
            FT+  +Y F +S
Sbjct  86   FTAPSSYKFSIS  97



>ref|XP_007208221.1| hypothetical protein PRUPE_ppa018611mg [Prunus persica]
 gb|EMJ09420.1| hypothetical protein PRUPE_ppa018611mg [Prunus persica]
Length=876

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 8/73 (11%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
             +L CG+ +++   DGR W  D+ YL      T    SPA A+ Q P L S+VP+  AR+
Sbjct  31   LILGCGSENEAKDADGRKWQPDSKYL------TGSKGSPAQAQYQDPALLSEVPYMKARI  84

Query  416  FTSELTYSFRVSP  454
            FTS  TY F V P
Sbjct  85   FTSNATYKFPVKP  97



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +2

Query  242  FLLSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+CGA  + ST  DGR+W++D+   +FM T T   S    A Q P   +VP+ TAR+F
Sbjct  29   ILLNCGASDRQSTDVDGRNWNSDDGS-KFMST-TRGSSMATAATQAPDVGEVPYMTARIF  86

Query  419  TSELTYSFRVSP  454
             S  TYS  V+P
Sbjct  87   DSNFTYSIAVAP  98



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG P      DGR W TD    ++M  + + +S  A  +Q P   QVPF +ARVF 
Sbjct  36   ILLNCGGPDNLPDADGRKWGTDVGS-KYMLGSKSSISDAA--DQKPSVPQVPFMSARVFQ  92

Query  422  SELTYSFRVS  451
            SE TYSF V+
Sbjct  93   SEFTYSFPVA  102



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSP-AIAEQGPLASQVPFTTAR  412
            +  LL+CGA S  +S DGR WD D+   +F  +   E SS    +   P  +QVP+ TAR
Sbjct  43   DLILLNCGASSNLSSPDGRSWDGDSQS-KFAASKPPEASSVFEASNHDPSVNQVPYMTAR  101

Query  413  VFTSELTYSFRVSP  454
            +F S+ TY+F V P
Sbjct  102  IFHSKFTYTFPVLP  115



>gb|EMT17367.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=779

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FL+ CGA S ++  DGR W+ D ++   +P     LS+ A      L S+VP+ TAR+FT
Sbjct  31   FLMRCGATSSASDSDGRTWEGDANFGLALPG----LSAKASYLDPSLPSRVPYMTARIFT  86

Query  422  SELTYSFRVSP  454
            S  TYS  V P
Sbjct  87   SNSTYSLGVDP  97



>ref|XP_007032831.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03757.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=884

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTAR  412
            ++ LLSCGA   S S+DGR W  D    +F  +N+   S  + A  Q    +QVP+ TAR
Sbjct  30   DYILLSCGASLNSISEDGRKWIPDEKS-KFSTSNSVNSSFASTASRQDHAVTQVPYMTAR  88

Query  413  VFTSELTYSFRVSP  454
            VF    TYSF VSP
Sbjct  89   VFRDIFTYSFPVSP  102



>gb|EMS57312.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=839

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
              LL+CG  ++     GR WD D   + F P+   + ++ A+ +   L  +VP+TTAR+F
Sbjct  34   LILLNCGESTQDDDDGGRSWDGDTGSI-FAPSMKGD-AAIALGQPPSLTPRVPYTTARIF  91

Query  419  TSELTYSFRVSP  454
            TS  TYSF VSP
Sbjct  92   TSNYTYSFPVSP  103



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+LSCG  S     DGR W  D    +F+ +    +S+ A  +   L S VP+ +AR+FT
Sbjct  35   FILSCGDSSGGADADGRKWVPDT---KFLASPGKSISATAQLQDPSLPSPVPYMSARIFT  91

Query  422  SELTYSFRVSP  454
            SE TY F VSP
Sbjct  92   SESTYQFSVSP  102



>ref|XP_008223394.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=860

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
            +++SCG+ S  T  DGR W +D+ +L      +++ S+ A A+ Q P L SQVP+ +AR+
Sbjct  31   YVISCGSSSGGTDSDGRKWASDSQFL-----TSSDKSNTATAQYQDPSLPSQVPYMSARI  85

Query  416  FTSELTYSFRVSP  454
            F S  +Y F VSP
Sbjct  86   FNSASSYKFSVSP  98



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CG P  ST  DGR+W TD        ++ +   SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLDCGGPPSSTDTDGREWTTDVGSKFDSSSSKSTTVSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  94   APFTYAFPVA  103



>gb|EMT03407.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=778

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
              LL+CGA S++    GR WD D+   +F P+    +++ A  +   L S+ PF TAR+F
Sbjct  34   LILLNCGASSQNIDDSGRTWDGDSGS-KFTPS-VKGVATNASYQDPSLPSRTPFMTARIF  91

Query  419  TSELTYSFRVSP  454
            TS  TYSF VSP
Sbjct  92   TSSYTYSFPVSP  103



>ref|XP_006408164.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
 gb|ESQ49617.1| hypothetical protein EUTSA_v10020050mg [Eutrema salsugineum]
Length=854

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 4/69 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F LSCGA   ST QD ++W+ D  +L+        + +PA  +   L S VP+ TAR+FT
Sbjct  29   FALSCGASEASTDQDKKEWEPDTKFLK----TGNSIHAPATYQDPSLLSTVPYMTARIFT  84

Query  422  SELTYSFRV  448
            +  TY   V
Sbjct  85   APATYEIPV  93



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 4/75 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKST--SQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT  406
            ++ LL CGAPS S+  S+DGR W TD    +F  +N+   SS   A  Q    ++VP+ T
Sbjct  27   DYILLDCGAPSSSSLVSEDGRKWITDERS-KFATSNSENASSNFRATRQDHSVTRVPYMT  85

Query  407  ARVFTSELTYSFRVS  451
            ARVF  + TYSF VS
Sbjct  86   ARVFHDKFTYSFPVS  100



>ref|XP_009602553.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana tomentosiformis]
Length=867

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F+L+CGA S +T  DGR W  D+ +L     N+  ++S A  +   L S +P+ TAR+F 
Sbjct  40   FVLACGATSNATDADGRIWSPDSTHLPSSSGNS--ITSKAKYQDPSLVSDIPYMTARIFK  97

Query  422  SELTYSFRVSP  454
            ++  Y+F VSP
Sbjct  98   TQTAYTFPVSP  108



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            +++SCG+ S  T  DGR W +D+   QF+ ++    ++ A  +   L SQVP+ +AR+F 
Sbjct  31   YVISCGSSSGGTDSDGRKWASDS---QFLTSSYKSNTATAQYQDPSLPSQVPYMSARIFN  87

Query  422  SELTYSFRVSP  454
            S  +Y F VSP
Sbjct  88   SASSYKFSVSP  98



>ref|XP_010097778.1| Receptor-like protein kinase [Morus notabilis]
 gb|EXB71057.1| Receptor-like protein kinase [Morus notabilis]
Length=861

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++LSCG   +ST  +GR+W  D+   + +P +   + + A+ +   L SQVP+ TAR+FT
Sbjct  36   YVLSCGGSIESTDTNGREWAPDS---KLVPPSGDSIPATALHQDPSLPSQVPYMTARIFT  92

Query  422  SELTYSFRVSP  454
            SE  Y+F   P
Sbjct  93   SESAYNFSALP  103



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P  ST  DGR W +D      + T  +  ++ AI  Q P   +VP+ TAR+F 
Sbjct  36   IFLNCGGPPDSTDSDGRKWTSDIGSKFALSTTKSSTATAAI--QKPSVPEVPYMTARIFQ  93

Query  422  SELTYSFRVS  451
            SE TYSF V+
Sbjct  94   SEFTYSFPVA  103



>gb|ACA25079.1| serine/threonine protein kinase A, partial [Populus tremula]
Length=162

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+ GA    T  DGRDW TD   +   P N+  ++S A  +   L S +P+ TAR+FT
Sbjct  37   YILAYGASGAGTDSDGRDWQTDAKNIN-SPGNS--ITSTAEKQDPSLPSTIPYMTARIFT  93

Query  422  SELTYSFRV  448
            +E TY F V
Sbjct  94   TESTYKFSV  102



>gb|EMT28751.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=737

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP-LASQVPFTTARV  415
              LL+CG   +     GR WD DN   +F P+   E  + + + Q P L S VP+ TAR+
Sbjct  12   LILLNCGGSGQEVDSGGRTWDGDNSS-KFTPS--VEGVAASASYQDPSLPSMVPYMTARI  68

Query  416  FTSELTYSFRVSP  454
            FTS  TYSF V P
Sbjct  69   FTSNYTYSFPVRP  81



>ref|XP_011019995.1| PREDICTED: receptor-like protein kinase ANXUR1 [Populus euphratica]
Length=855

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA    T  DGR+W +D +Y+     +TA   + A  +   L S +P+ TAR+F+
Sbjct  35   YVLACGASGSGTDSDGRNWQSDANYIISSGNSTA---ATAQNQDPSLPSTIPYMTARIFS  91

Query  422  SELTYSFRV  448
            SE TY F V
Sbjct  92   SESTYKFSV  100



>ref|XP_008390575.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
 ref|XP_008360245.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=444

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKS-TSQDGRDWDTDNHYL---QFMPTNTAELSSPAIAEQGPLASQVPFT  403
            E ++LSCG+ S   T  DGR W TD+ YL       T  AE   PA      L S+VPFT
Sbjct  32   ESYILSCGSSSDGETDSDGRKWTTDSKYLVASNNTKTAKAEYQDPA------LPSKVPFT  85

Query  404  TARVFTSELTYSFRV  448
            TAR+  S  +Y F V
Sbjct  86   TARIMNSATSYKFSV  100



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            LL+CGA S S+  D R W  DN   +F+ +  ++ +SPA A Q P  S++P+ TARV  S
Sbjct  40   LLNCGASSNSSDADKRAWSADN-INKFLSSGDSK-TSPA-ATQDPSVSEIPYMTARVSRS  96

Query  425  ELTYSFRVS  451
              TYSF V+
Sbjct  97   PFTYSFPVA  105



>gb|EAY95324.1| hypothetical protein OsI_17151 [Oryza sativa Indica Group]
Length=513

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGA + +T  DGR WD D     F P+ T  +++ A  +   L S VP+ TARVF+S 
Sbjct  39   LSCGASASATDGDGRAWDGD-AVSTFAPSVTG-VAADASYQDPSLPSPVPYMTARVFSSS  96

Query  428  LTYSFRVSP  454
             TYSF V P
Sbjct  97   YTYSFPVKP  105



>ref|NP_001053685.1| Os04g0586500 [Oryza sativa Japonica Group]
 emb|CAE03769.2| OSJNBa0013K16.18 [Oryza sativa Japonica Group]
 dbj|BAF15599.1| Os04g0586500 [Oryza sativa Japonica Group]
 gb|EAZ15355.1| hypothetical protein OsJ_30771 [Oryza sativa Japonica Group]
 dbj|BAG97723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=513

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGA + +T  DGR WD D     F P+ T  +++ A  +   L S VP+ TARVF+S 
Sbjct  39   LSCGASASATDGDGRAWDGD-AVSTFAPSVTG-VAADASYQDPSLPSPVPYMTARVFSSS  96

Query  428  LTYSFRVSP  454
             TYSF V P
Sbjct  97   YTYSFPVKP  105



>ref|XP_007032832.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03758.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=807

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL+CG  S +TS DGR+W  D  Y      + A   +   ++  P  ++VP+ TAR+
Sbjct  30   DHILLNCGTSSNTTSLDGRNWVGDADYKYSSSISKASSFASKASDLEPSVTEVPYMTARI  89

Query  416  FTSELTYSFRVSP  454
            F  + TY F VSP
Sbjct  90   FHGKFTYKFPVSP  102



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CG PS ST  DGR W TD        +  +   SPA A Q P   QVP+ TARVF 
Sbjct  35   ILLDCGGPSSSTDTDGRVWTTDVGSKFDSSSAKSTTVSPA-ATQDPAVPQVPYMTARVFH  93

Query  422  SELTYSFRVS  451
            +  TY+F V+
Sbjct  94   APFTYAFPVA  103



>gb|KDP24661.1| hypothetical protein JCGZ_26520 [Jatropha curcas]
Length=978

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LLSCGA S +TS DGR+W +D         +     +   + Q    +QVP+ TAR+
Sbjct  209  EIILLSCGASSLTTSPDGRNWVSDARSKFGASISLNSSFAFKASGQDTSVTQVPYMTARI  268

Query  416  FTSELTYSFRVSP  454
            F S+ TYSF VSP
Sbjct  269  FLSKFTYSFPVSP  281



>ref|XP_008390536.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=860

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTA  409
            E ++++CG+ S  T  DGR W  D+ +L+     ++E S  A A+ Q P L SQ+P+ +A
Sbjct  31   ESYIIACGSSSGGTDSDGRRWVPDSRFLK-----SSENSKTATAQYQDPSLPSQIPYMSA  85

Query  410  RVFTSELTYSFRVSP  454
            R+F S  +Y F VSP
Sbjct  86   RIFNSAASYKFFVSP  100



>gb|AHZ44752.1| CrRLK1L-like protein, partial [Platanus x acerifolia]
Length=774

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG+  ++   DGR W TD    +F+      L+S A A Q P    VPF TAR+F 
Sbjct  78   ILLNCGSAPETVDTDGRKWTTDIGS-KFVAAGDNSLASSA-ATQDPSVPDVPFMTARIFR  135

Query  422  SELTYSFRV  448
            SE TYSF V
Sbjct  136  SEFTYSFPV  144



>gb|EMT13360.1| hypothetical protein F775_08521 [Aegilops tauschii]
Length=499

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            LSCGA + +T  DGR WD D+   +F+ +  A +++ A  +   L S VP+  ARVF S 
Sbjct  36   LSCGASASATDSDGRAWDGDSAS-KFLTSANAGVAARASYQDPSLPSSVPYMMARVFASS  94

Query  428  LTYSFRVSP  454
             TY+F V P
Sbjct  95   HTYTFLVRP  103



>ref|XP_008367132.1| PREDICTED: uncharacterized protein LOC103430767 [Malus domestica]
Length=1104

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKS-TSQDGRDWDTDNHYL---QFMPTNTAELSSPAIAEQGPLASQVPFT  403
            E ++LSCG+ S   T  DGR W TD+ YL       T  AE   PA      L S+VPFT
Sbjct  32   ESYILSCGSSSDGETDSDGRKWTTDSKYLVASNNTKTAKAEYQDPA------LPSKVPFT  85

Query  404  TARVFTSELTYSFRV  448
            TAR+  S  +Y F V
Sbjct  86   TARIMNSATSYKFSV  100



>ref|XP_003568697.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=878

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L+CGA  ++   +GR WD D    +F P     +++PA  +   L S VPF TAR+FTS 
Sbjct  35   LNCGASGQNNDDNGRTWDGDTSS-KFAPL-VKGVTAPASYQHPSLPSTVPFMTARIFTSN  92

Query  428  LTYSFRVS  451
             TYSF VS
Sbjct  93   YTYSFPVS  100



>gb|KFK23480.1| hypothetical protein AALP_AAs40899U000100, partial [Arabis alpina]
Length=201

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQ-GPLASQVPFTTAR  412
            + FL +CG     T   GR+W  ++   +  P+N+   S PA     GP    VP+  AR
Sbjct  34   DVFLFTCGDTFNGTDDTGRNWTAEDP--KTFPSNSENASFPAYENSLGPSVLLVPYKGAR  91

Query  413  VFTSELTYSFRVSP  454
            VF S+ TYSF VSP
Sbjct  92   VFQSDFTYSFSVSP  105



>ref|XP_009372136.1| PREDICTED: receptor-like protein kinase ANXUR2 [Pyrus x bretschneideri]
Length=444

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 10/75 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKS-TSQDGRDWDTDNHYLQF---MPTNTAELSSPAIAEQGPLASQVPFT  403
            E ++LSCG+ S   T  DGR W TD+ YL       T  AE   PA      L S+VPFT
Sbjct  32   ESYILSCGSSSDGETDSDGRKWTTDSKYLVASINTKTAKAEYQDPA------LPSKVPFT  85

Query  404  TARVFTSELTYSFRV  448
            TAR+  S  +Y F V
Sbjct  86   TARIMNSATSYKFSV  100



>gb|KDP27676.1| hypothetical protein JCGZ_20096 [Jatropha curcas]
Length=838

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+ GAP    S DGR+W++D +   ++ P N+   ++   ++Q P  +QVP+ TAR+ 
Sbjct  33   ILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPYMTARII  92

Query  419  TSELTYSFRVS  451
             S+ T  F VS
Sbjct  93   RSKYTCMFPVS  103



>ref|XP_007045784.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY01616.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=822

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = +2

Query  236  EFFLLSCGA-PSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTT  406
            E  LL CG+  S++ S DGR+W +D  +H++   P ++  +S  + A  G    +VP+ T
Sbjct  46   ENILLDCGSLASQAVSYDGRNWSSDIRSHFVASNPDSSFTVSRASSA--GTSVPEVPYMT  103

Query  407  ARVFTSELTYSFRVSP  454
            AR+F S+ TYSF VSP
Sbjct  104  ARLFHSQFTYSFNVSP  119



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 40/72 (56%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LLSCG PS+ST  DGR W +D         +N++    PA A Q P   QVP+  AR+F
Sbjct  36   ILLSCGGPSQSTDIDGRKWYSDIGSKFALASSNSSVF--PA-AVQKPSVPQVPYMNARIF  92

Query  419  TSELTYSFRVSP  454
             S  TY F V+P
Sbjct  93   QSNYTYRFPVAP  104



>ref|XP_010246590.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=836

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKST-SQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTA  409
            E  LL+CG+P KS  SQDGR+W  D     F P +   LS+ + A +Q     Q+P+ TA
Sbjct  41   EEILLNCGSPLKSIQSQDGRNWTGDVGS-NFAPMDRFNLSTTSTASQQDSSVPQIPYMTA  99

Query  410  RVFTSELTYSFRVSP  454
            RVF S   Y+F V P
Sbjct  100  RVFHSPFVYTFLVQP  114



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FL++CG+ S +   DGR W  D+   +F  +     ++ A ++   L S VP+ TARVFT
Sbjct  32   FLVNCGSSSDAADADGRKWSADDTS-KFGVSTKNSATATAASQDPSLPSAVPYMTARVFT  90

Query  422  SELTYSFRVS  451
            SE TY F V+
Sbjct  91   SESTYKFSVN  100



>ref|XP_006338348.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=873

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTT-AR  412
            F LL+CGA S +T    R WDTD H+  F+P+N   +S+ A A EQ P  ++VP+TT AR
Sbjct  31   FVLLNCGAQSATTDDTDRRWDTDTHFPNFLPSNFTSISTTATASEQDPSVNRVPYTTGAR  90

Query  413  VFTSELTYSFRVSP  454
            +  S+ TY+FRV+P
Sbjct  91   IMRSQFTYTFRVTP  104



>ref|XP_002311383.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
 gb|EEE88750.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
Length=854

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            +L+CGA    T  DGR+W +D +Y+     +TA   + A  +   L S +P+ TAR+F+S
Sbjct  36   VLACGASGSGTDSDGRNWQSDANYIISSGNSTA---ATAQNQDPSLPSTIPYMTARIFSS  92

Query  425  ELTYSFRV  448
            E TY F V
Sbjct  93   ESTYKFSV  100



>ref|XP_010667956.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 3/71 (4%)
 Frame = +2

Query  245  LLSCGA-PSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            LL+CG+  +K+T  DGR+W +DN   +F+ ++     + A  E  P    +P+ +AR+F 
Sbjct  30   LLNCGSFDAKTTDSDGRNWTSDNGS-KFLQSSKGSFRASATTE-APDVGNIPYMSARIFH  87

Query  422  SELTYSFRVSP  454
            S  TYSF VSP
Sbjct  88   SNATYSFPVSP  98



>gb|KDP27915.1| hypothetical protein JCGZ_18995 [Jatropha curcas]
Length=860

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  +L+CGA S  T  DGR W  D  Y   M +++  +++ A  +   L S VP+ TAR+
Sbjct  38   ESHVLACGATSDGTDSDGRKWLPDTKY---MNSSSNSITATADNQDPSLPSTVPYMTARI  94

Query  416  FTSELTYSFRV  448
            FTS  TY F V
Sbjct  95   FTSPTTYKFSV  105



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA S S+  D R W  D++  +F+ ++    +SPA A QG   S++P+ TAR+  
Sbjct  39   ILLNCGASSNSSDADKRAWSADDNN-KFLSSSGDSKTSPA-ATQGSSVSEIPYMTARISQ  96

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  97   SPFTYSFSVA  106



>gb|KEH43006.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=868

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 5/74 (7%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL CG   +     DGR W+ DN YL    +    ++S A  +   L S++P+ +AR
Sbjct  27   ESLLLGCGLGDNGGKDSDGRQWNPDNKYL----SGGNSITSKASFQDPSLLSEIPYMSAR  82

Query  413  VFTSELTYSFRVSP  454
            VFTSE TY F + P
Sbjct  83   VFTSESTYKFPILP  96



>emb|CDY37883.1| BnaC04g31230D [Brassica napus]
Length=793

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG  S +     + W +D  +L  + +N   +S  + A       QVP+TTARV
Sbjct  29   DLFLINCGTSSDTIDSQSQTWTSDQQHL--LTSNLDNVSFSSNASYQEEVPQVPYTTARV  86

Query  416  FTSELTYSFRVSP  454
            F S + YSF VSP
Sbjct  87   FLSNVDYSFPVSP  99



>ref|XP_010552466.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Tarenaya 
hassleriana]
Length=964

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 4/75 (5%)
 Frame = +2

Query  236  EFFLLSCGAP-SKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTA  409
            +  L++CGA  S    Q GR W  ++  L  +  N+   S PA A  Q P   QVP+ TA
Sbjct  89   DLLLVNCGATGSNIADQSGRIWSAEDRRL--LSANSNGSSFPATASVQEPSVEQVPYMTA  146

Query  410  RVFTSELTYSFRVSP  454
            R+F S+  YSF VSP
Sbjct  147  RIFRSDFRYSFPVSP  161



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 37/71 (52%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR WD D    ++ P    +L+S +   Q P   QVP+ TARV  
Sbjct  44   ILLDCGATGKGNDTDGRQWDGDAGS-KYAP---PKLASASAGAQDPSVPQVPYLTARVSA  99

Query  422  SELTYSFRVSP  454
            +  TYSF + P
Sbjct  100  APFTYSFPLGP  110



>ref|XP_009372137.1| PREDICTED: receptor-like protein kinase ANXUR1 [Pyrus x bretschneideri]
Length=879

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTA  409
            E ++++CG+ S  T  DGR W  D+ +L     +++E S  A A+ Q P L SQ+P+ +A
Sbjct  50   ESYIIACGSSSGGTDSDGRRWVPDSRFL-----SSSENSKTATAQYQDPSLPSQIPYMSA  104

Query  410  RVFTSELTYSFRVSP  454
            R+F S  +Y F VSP
Sbjct  105  RIFNSAASYKFFVSP  119



>ref|XP_007147183.1| hypothetical protein PHAVU_006G102700g [Phaseolus vulgaris]
 gb|ESW19177.1| hypothetical protein PHAVU_006G102700g [Phaseolus vulgaris]
Length=862

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (54%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             +L CG    +   D R W  D    +F+ T    ++S A  +   L S++P+ +AR+FT
Sbjct  32   LILGCGLDGGAEDGDTRKWSPDK---KFLGTEGGSITSKASYQDPSLTSEIPYMSARIFT  88

Query  422  SELTYSFRVSP  454
            SE TY+F V P
Sbjct  89   SESTYTFPVKP  99



>ref|NP_198716.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID8.1|Y5900_ARATH RecName: Full=Putative receptor-like protein kinase At5g39000; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10824.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AED94385.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=873

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S +    GR+W  +N   + + +N    S  A A  Q    SQ+P+ TAR
Sbjct  30   DVFLFNCGDTSNNVDVSGRNWTAENQ--KILSSNLVNASFTAQASYQESGVSQIPYMTAR  87

Query  413  VFTSELTYSFRVSP  454
            +F SE TYSF V+P
Sbjct  88   IFRSEFTYSFPVTP  101



>ref|XP_004494710.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Cicer arietinum]
Length=865

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 37/72 (51%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             +L CG     +   DGR W  DN   +F+ T     +S A  +   L S VP+ TAR+F
Sbjct  32   LILGCGLDEGGAKDDDGRQWSPDN---KFLATEGGSNTSKATYQDPSLTSVVPYMTARIF  88

Query  419  TSELTYSFRVSP  454
            TSE  Y F+V P
Sbjct  89   TSETAYKFQVQP  100



>ref|XP_008388681.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
ANXUR2 [Malus domestica]
Length=879

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 41/72 (57%), Gaps = 5/72 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP-LASQVPFTTARVF  418
             +L CGA +++   DGR W  D+ YL     ++++ +S     Q P L S+VP+  AR+F
Sbjct  31   LILGCGAENEAKDADGRKWQPDSKYL----ADSSKTTSAQAQYQDPALLSEVPYMKARIF  86

Query  419  TSELTYSFRVSP  454
            T+  TY   V+P
Sbjct  87   TANATYKLPVNP  98



>ref|XP_010684237.1| PREDICTED: receptor-like protein kinase ANXUR1 [Beta vulgaris 
subsp. vulgaris]
Length=865

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            + CGA  +    DGR WDTDN YL   P+     S  A  +   L S++P+ +AR+  SE
Sbjct  35   IDCGATGQGKDGDGRQWDTDNKYL---PSQGNSQSVKAQFQDPSLPSEIPYMSARISNSE  91

Query  428  LTYSFRVS  451
            + Y F ++
Sbjct  92   MAYKFPIN  99



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S++T  D R W  D    +F+  +   ++S A A Q P   +VP+ TARV
Sbjct  32   EKILLNCGGKSEATDNDNRKWTPDVGS-KFLLGSGNSVASQA-ATQDPAVPEVPYMTARV  89

Query  416  FTSELTYSFRVSP  454
            F S  TYSF V P
Sbjct  90   FRSNFTYSFPVVP  102



>ref|XP_004495609.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Cicer arietinum]
Length=867

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 5/74 (7%)
 Frame = +2

Query  236  EFFLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E   L CG + S     DGR W+ DN Y     +    ++S A  +   L S++P+ TAR
Sbjct  31   ESLTLGCGLSESGGKDADGRQWNQDNKYF----SGGNSITSKASFQDPSLLSEIPYMTAR  86

Query  413  VFTSELTYSFRVSP  454
            +FTSE TY F + P
Sbjct  87   IFTSESTYKFPIEP  100



>gb|KEH24563.1| malectin/receptor-like kinase family protein [Medicago truncatula]
Length=872

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             +L CG     +  +DGR W  DN   +F+ T     +  A  +   L+S VP+ +AR+F
Sbjct  39   LILGCGLDEGGAKDEDGRQWSPDN---KFLATQNGSTTYKAAYQDPSLSSVVPYMSARIF  95

Query  419  TSELTYSFRVSP  454
            TSE TY F V P
Sbjct  96   TSETTYKFNVQP  107



>gb|EMS60533.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=836

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FL+ CGA S ++  DGR W+ D ++   +P     LS+ A      L S VP+ TAR+FT
Sbjct  31   FLMRCGATSSASDSDGRTWEGDANFGLALPG----LSAKASYLDPSLPSPVPYLTARIFT  86

Query  422  SELTYSFRVSP  454
            S  TY+  V P
Sbjct  87   SNSTYTLGVDP  97



>ref|XP_002316044.1| Pto-like kinase OGw family protein [Populus trichocarpa]
 gb|EEF02215.1| Pto-like kinase OGw family protein [Populus trichocarpa]
Length=858

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 9/72 (13%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMP---TNTAELSSPAIAEQGPLASQVPFTTAR  412
            ++L+CGA    T  D RDW  D  ++       T+TAE   P+      L S +P+ TAR
Sbjct  37   YILACGASGAGTDSDSRDWQPDAKHINSSGNSITSTAENQDPS------LPSTIPYMTAR  90

Query  413  VFTSELTYSFRV  448
            +FTSE TY F V
Sbjct  91   IFTSESTYKFSV  102



>emb|CDP05402.1| unnamed protein product [Coffea canephora]
Length=892

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ L++CG  S +TS DGR+W  D    +F P + A +S    A +  L+  VP+ TAR+
Sbjct  30   DYILINCGLSSNATSADGRNWYGDAGS-KFTPIDMANISLAVTATEQGLS--VPYLTARI  86

Query  416  FTSELTYSFRVSP  454
              S  +Y+F VSP
Sbjct  87   IRSNFSYTFPVSP  99



>ref|XP_009139818.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=832

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG  S +     + W +D  +L  + +    LS  + A       QVP+TTAR+
Sbjct  31   DLFLINCGTSSDTIDSQSQTWTSDQQHL--LTSKLKNLSFSSDASYQEEVPQVPYTTARI  88

Query  416  FTSELTYSFRVSP  454
            F S + YSF VSP
Sbjct  89   FLSNVNYSFPVSP  101



>emb|CDX74491.1| BnaA04g08980D [Brassica napus]
Length=832

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG  S +     + W +D  +L  + +    LS  + A       QVP+TTAR+
Sbjct  31   DLFLINCGTSSDTIDSQSQTWTSDQQHL--LTSKLKNLSFSSDASYQEEVPQVPYTTARI  88

Query  416  FTSELTYSFRVSP  454
            F S + YSF VSP
Sbjct  89   FLSNVNYSFPVSP  101



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA S++T  DG+ W ++      +P +TA       A Q P   QVP+ TAR+F 
Sbjct  38   ILLDCGAASQTTDADGQVWTSE--IGSKIPASTANAIMATAATQDPSVPQVPYMTARIFQ  95

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  96   SNFTYSFPVA  105



>ref|XP_009385224.1| PREDICTED: receptor-like protein kinase ANXUR1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 12/76 (16%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAEL----SSPAIAE-QGP-LASQVPFT  403
             LL+CG+ S++T  DGR W  D+      PT+T+ L    S+PA A  Q P L S VP+ 
Sbjct  32   ILLNCGSSSEATDSDGRKWIADS------PTSTSSLVSKNSNPATAVYQDPSLPSAVPYM  85

Query  404  TARVFTSELTYSFRVS  451
            +AR+F SE TY F V+
Sbjct  86   SARIFASESTYKFAVN  101



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P+++T  +G  W +D    +F     +  +SPA A Q P   +VPF TARVF 
Sbjct  33   IFLNCGGPAETTDSNGVKWTSDVGS-KFASGGNSSTTSPA-ATQDPAVPEVPFMTARVFR  90

Query  422  SELTYSFRVS  451
            S+ TY F V+
Sbjct  91   SQFTYKFPVA  100



>ref|XP_006844774.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
 gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGP-LASQVPFTTARV  415
             L++CG+ S     DGR W  D H  ++  T  +E + PA AE Q P L S +P+ +AR+
Sbjct  42   ILVNCGSSSDGVDADGRSWKGDVHGSRY--TLDSENTVPARAETQDPSLPSTIPYMSARI  99

Query  416  FTSELTYSFRVSP  454
            F+S  TY F V+P
Sbjct  100  FSSRSTYEFSVTP  112



>ref|XP_002870808.1| hypothetical protein ARALYDRAFT_916421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47067.1| hypothetical protein ARALYDRAFT_916421 [Arabidopsis lyrata subsp. 
lyrata]
Length=884

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 5/75 (7%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + FL++CG  S +  Q GR W  +   ++ +P+N+  A  +S A+ +   +A QVP+  A
Sbjct  30   DVFLINCGDNSATNDQSGRTWTPEE--VKALPSNSDFASFTSDALYQDSGIA-QVPYMKA  86

Query  410  RVFTSELTYSFRVSP  454
            R+F S  TYSF VSP
Sbjct  87   RIFRSNFTYSFLVSP  101



>emb|CDY36996.1| BnaC06g12670D [Brassica napus]
Length=872

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CGA S   S  GR+W  +N   + +P+N+ + S  + A  Q      VP+ TAR
Sbjct  30   DLFLFNCGANS-DVSDRGRNWTAENR--KTLPSNSGDASFSSDASFQESGVPLVPYKTAR  86

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF VSP
Sbjct  87   IFRSDFTYSFPVSP  100



>ref|XP_006286236.1| hypothetical protein CARUB_v10007805mg [Capsella rubella]
 gb|EOA19134.1| hypothetical protein CARUB_v10007805mg [Capsella rubella]
Length=814

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG  S +   +GR W  ++  L       A LSS A A Q    + +P+  AR+
Sbjct  30   DVFLINCGDTSDNMDDNGRKWTAEDWKLLSSNLVNASLSSEA-AYQDSGVTLIPYMKARI  88

Query  416  FTSELTYSFRVSP  454
            F SE TY+F+V+P
Sbjct  89   FRSEFTYTFQVTP  101



>gb|EMT27425.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=841

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 36/71 (51%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR+W  D    ++ P N   L+S     Q P   QVP+ TARV  
Sbjct  28   ILLDCGATGKGNDTDGREWRGDAGS-KYAPPN---LASADAGAQDPSVPQVPYLTARVSA  83

Query  422  SELTYSFRVSP  454
            +  TYSF + P
Sbjct  84   AAFTYSFPLGP  94



>ref|XP_008370712.1| PREDICTED: receptor-like protein kinase ANXUR2 [Malus domestica]
Length=883

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 5/72 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP-LASQVPFTTARVF  418
             +L CGA +++   DGR W  D  YL     ++++ +S     Q P L S+VP+  AR+F
Sbjct  31   LILGCGADNEAKDADGRKWQPDKKYL----ADSSKTTSAQAQYQDPALLSEVPYMKARIF  86

Query  419  TSELTYSFRVSP  454
            T+  TY   V P
Sbjct  87   TANTTYKLPVQP  98



>ref|XP_009125099.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Brassica 
rapa]
Length=873

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS-SPAIAEQGPLASQVPFTTAR  412
            + FL +CGA S  T   GR W  +N   + +P+N+ + S S   + Q      VP+ TAR
Sbjct  30   DLFLFNCGANSDVTDS-GRSWTAENR--KTLPSNSGDASFSSEASFQESGVPLVPYKTAR  86

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF VSP
Sbjct  87   IFRSDFTYSFPVSP  100



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E   L+CG P++    DG+ W +D   L    +  A+ ++   + Q P  S +PF TARV
Sbjct  35   EQIFLNCGGPTEEA--DGKKWTSDKGSLYL--SKAAKSTTSEASSQDPSVSTIPFMTARV  90

Query  416  FTSELTYSFRVSP  454
            F S+ TYS  V+P
Sbjct  91   FQSDFTYSISVAP  103



>gb|KDP27678.1| hypothetical protein JCGZ_20098 [Jatropha curcas]
Length=464

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            +  LL+ GAPS   S D R W+ D +   ++ P N+   S+   ++Q P  +QVP+ TAR
Sbjct  31   DLILLNSGAPSGDQSMDRRKWEGDADQQSKYCPMNSETSSASKASQQDPSVTQVPYMTAR  90

Query  413  VFTSELTYSFRVS  451
            +  S+ T  F VS
Sbjct  91   IIRSKYTCMFPVS  103



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            LL+CG  S  T  D R W  D    +F+ ++    +SPA A Q P   +VP+ TAR+F S
Sbjct  37   LLNCGGSSDLTDTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPEVPYMTARIFRS  94

Query  425  ELTYSFRVS  451
              TYSF V+
Sbjct  95   PFTYSFPVA  103



>ref|XP_002271113.1| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
Length=857

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 4/69 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             +LSCG+ S  T  DGR W +D+ YL     +   +S+ A ++   L S VP+ +AR+F+
Sbjct  30   LILSCGSASGGTDADGRKWVSDSAYL----VSDESISATAQSQDPSLPSPVPYMSARIFS  85

Query  422  SELTYSFRV  448
            +E +Y F V
Sbjct  86   AESSYKFSV  94



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CG+ +  T  D R W  D+   +F P+  +  ++PA  +   L S VP+ TAR+FT
Sbjct  35   ILLDCGSSADGTDADHRKWAADDSS-KFRPSGNS-TTAPAAFQDPSLLSPVPYMTARIFT  92

Query  422  SELTYSFRVS  451
            SE TY F VS
Sbjct  93   SESTYKFAVS  102



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P+++T   G  W +D    +F     +  +SPA A Q P   +VPF TARVF 
Sbjct  33   IFLNCGGPAETTDSXGVKWTSDVGS-KFASGGNSSTTSPA-ATQDPAVPEVPFMTARVFR  90

Query  422  SELTYSFRVS  451
            S+ TY F V+
Sbjct  91   SQFTYKFPVA  100



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query  242  FLLSCGAPSKS-TSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
              L+CGAP +  T+QDGR+W  D         +   +SS + A QGP   Q+P+ TAR+F
Sbjct  32   IFLNCGAPPEVITAQDGRNWTGDIGSKLAPLASLINISSISQATQGPSVPQIPYLTARIF  91

Query  419  TSELTYSFRVS  451
             +  TY F VS
Sbjct  92   YAPFTYKFPVS  102



>ref|XP_007035799.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY06725.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=886

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 38/70 (54%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++LSCGA    T  DGR W  D    +F+ ++    +  A+ +   L S VP+  AR+FT
Sbjct  65   YILSCGASGDETDADGRKWSPDT---KFLASSDNSETVTALYQDPSLPSTVPYMNARIFT  121

Query  422  SELTYSFRVS  451
            S  +Y F VS
Sbjct  122  STTSYKFSVS  131



>gb|EMT16871.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=883

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 2/72 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
              L++CGA  +     GR WD D    +F P+    +++ A  +   L S VPF TAR+F
Sbjct  32   LILVNCGASVQGDDDSGRTWDGDTGS-KFAPS-LKGVAATAPNQDPSLPSTVPFMTARIF  89

Query  419  TSELTYSFRVSP  454
            TS  TYSF V P
Sbjct  90   TSNYTYSFSVKP  101



>ref|XP_009139815.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X1 [Brassica rapa]
Length=885

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +     F+P+N A  S  + A  QG   S+VP+ TAR
Sbjct  30   DVFLFNCGETSDQMDISGRNWMAEQP--NFLPSNAANASFVSHASFQGSGVSKVPYMTAR  87

Query  413  VFTSELTYSFRVSP  454
            +F  + TY F VSP
Sbjct  88   IFRHDFTYRFPVSP  101



>emb|CDX74492.1| BnaA04g08970D [Brassica napus]
Length=885

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +     F+P+N A  S  + A  QG   S+VP+ TAR
Sbjct  30   DVFLFNCGETSDQMDISGRNWMAEQP--NFLPSNAANASFVSHASFQGSGVSKVPYMTAR  87

Query  413  VFTSELTYSFRVSP  454
            +F  + TY F VSP
Sbjct  88   IFRHDFTYRFPVSP  101



>ref|XP_009139816.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X2 [Brassica rapa]
Length=855

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +     F+P+N A  S  + A  QG   S+VP+ TAR
Sbjct  30   DVFLFNCGETSDQMDISGRNWMAEQP--NFLPSNAANASFVSHASFQGSGVSKVPYMTAR  87

Query  413  VFTSELTYSFRVSP  454
            +F  + TY F VSP
Sbjct  88   IFRHDFTYRFPVSP  101



>ref|XP_008668826.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 tpg|DAA35839.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=897

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +2

Query  248  LSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CGA S  ST  DGR WD+D    +F P+    +++ A ++   L S  P+ TARVFTS
Sbjct  37   LDCGASSSTSTDADGRSWDSDASS-KFAPSLNG-VAATASSQDPSLPSPTPYMTARVFTS  94

Query  425  ELTYSFRVSP  454
              TYSF V+P
Sbjct  95   NYTYSFPVTP  104



>ref|XP_003552590.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=922

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR+
Sbjct  88   ELFSINCGSSSNLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARL  141

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  142  SHSQFTYSFPVS  153



>gb|KDP24278.1| hypothetical protein JCGZ_25574 [Jatropha curcas]
Length=845

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            +  LL+ GAP    S DGR W++D +   ++ P N+   S+   ++Q P  + VP+ TAR
Sbjct  31   DLILLNSGAPYGKQSMDGRKWESDADKQSKYCPVNSETSSASKASQQDPSVTPVPYMTAR  90

Query  413  VFTSELTYSFRVS  451
            +  S+ T  F VS
Sbjct  91   IIRSKYTCMFPVS  103



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S     D R W +D    +F+ ++    +SPA A Q P  SQVP+ TARVF 
Sbjct  37   ILLNCGGVSDLVDTDNRTWISDVKS-KFLSSSGDSKTSPA-ATQDPSVSQVPYMTARVFR  94

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  95   SPFTYSFPVA  104



>ref|XP_002519226.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43090.1| ATP binding protein, putative [Ricinus communis]
Length=854

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA +  T  DGR W+ D  Y++   ++   + + A  +   L S VP+ T R+FT
Sbjct  31   YVLACGASNAGTDGDGRKWEPDTKYVK---SSGNSIMATADNQDPSLPSTVPYMTGRLFT  87

Query  422  SELTYSFRV  448
            S  TY+F V
Sbjct  88   SAFTYTFPV  96



>ref|NP_198715.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID9.1|Y5389_ARATH RecName: Full=Probable receptor-like protein kinase At5g38990; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10823.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94384.1| malectin/receptor-like protein kinase family protein [Arabidopsis 
thaliana]
Length=880

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVPFT  403
            + FL++CG  S +    GR+W T+N   +FM +N  +     SS +  E G    QVP+ 
Sbjct  27   DVFLINCGDTSNNMDYSGRNWTTENP--KFMSSNAVDDASFTSSASYQESG--IPQVPYL  82

Query  404  TARVFTSELTYSFRVSP  454
             AR+F  + TYSF VSP
Sbjct  83   KARIFRYDFTYSFPVSP  99



>gb|AAM10331.1| AT5g38990/K15E6_170 [Arabidopsis thaliana]
 gb|AAN18200.1| At5g38990/K15E6_170 [Arabidopsis thaliana]
Length=880

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAE----LSSPAIAEQGPLASQVPFT  403
            + FL++CG  S +    GR+W T+N   +FM +N  +     SS +  E G    QVP+ 
Sbjct  27   DVFLINCGDTSNNMDYSGRNWTTENP--KFMSSNAVDDASFTSSASYQESG--IPQVPYL  82

Query  404  TARVFTSELTYSFRVSP  454
             AR+F  + TYSF VSP
Sbjct  83   KARIFRYDFTYSFPVSP  99



>ref|XP_009790513.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=874

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CGA S +  +D R W TD +Y   +P++ + +S+ A A      ++V + +AR+F 
Sbjct  43   FLLNCGASSDAIDED-RLWSTDANYPDSLPSDFSSISTTANAS--GQVTRVYYMSARIFQ  99

Query  422  SELTYSFRVSP  454
            S+ TY+F VSP
Sbjct  100  SQFTYNFIVSP  110



>gb|KDP24662.1| hypothetical protein JCGZ_26521 [Jatropha curcas]
Length=740

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAI--AEQGPLASQVPFTTA  409
            +  LL+CG  S +TS DGR+W +D         +T++ SS A   + Q    +QVP+ TA
Sbjct  48   DIILLNCGESSLTTSPDGRNWVSDAR--SKFGASTSQNSSFAFKASRQDTSVTQVPYMTA  105

Query  410  RVFTSELTYSFRVS  451
            R+F S+ TYSF VS
Sbjct  106  RIFLSKFTYSFPVS  119



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 37/71 (52%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  +    DGR W  D       P+N A  ++PA + Q P   QVP+ TARV  
Sbjct  36   ILLDCGAKGQGNDTDGRMWGGDEGSKYAPPSNLAA-AAPA-SGQDPSVPQVPYLTARVSA  93

Query  422  SELTYSFRVSP  454
            S  TYSF + P
Sbjct  94   SPFTYSFPLGP  104



>ref|XP_008456162.1| PREDICTED: receptor-like protein kinase ANXUR1 isoform X2 [Cucumis 
melo]
Length=791

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  254  CGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSELT  433
            CG+   +T ++GR W +D+ +L   P NT  L+ PA  +   + SQVP+  ARVFT+   
Sbjct  40   CGSNEDATDENGRKWISDSKFLD--PKNT--LAVPAGFQDPSMTSQVPYMEARVFTAVTA  95

Query  434  YSFRVSP  454
            Y F + P
Sbjct  96   YKFPIKP  102



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 34/70 (49%), Gaps = 4/70 (6%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            LL CGA       DGR+W  D    ++ P N   L S     Q P   QVP+ TARV  +
Sbjct  52   LLDCGATGNGNDTDGREWGGDAGS-KYAPAN---LGSAIAGAQDPSVPQVPYLTARVSAA  107

Query  425  ELTYSFRVSP  454
              TYSF + P
Sbjct  108  PFTYSFPLGP  117



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P ++T  DG  W +D        +     +SPA A Q P   +VPF TARVF 
Sbjct  35   IFLNCGGPPETTDSDGLKWTSD--IGSKFASGANSTTSPA-ATQDPAVPEVPFMTARVFR  91

Query  422  SELTYSFRVS  451
            SE TY F V+
Sbjct  92   SEYTYKFPVA  101



>ref|XP_003520841.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Glycine 
max]
Length=869

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 39/72 (54%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             +L CG     +   DGR+W  DN   +F+      ++S A  +   L S++P+ +ARVF
Sbjct  37   LILGCGLDGGGAKDADGREWSPDN---KFLGPEGGSITSKASYQDPSLMSEIPYMSARVF  93

Query  419  TSELTYSFRVSP  454
            +SE TY F + P
Sbjct  94   SSEATYKFPIQP  105



>ref|XP_008456155.1| PREDICTED: receptor-like protein kinase ANXUR2 isoform X1 [Cucumis 
melo]
Length=855

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +2

Query  254  CGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSELT  433
            CG+   +T ++GR W +D+ +L   P NT  L+ PA  +   + SQVP+  ARVFT+   
Sbjct  40   CGSNEDATDENGRKWISDSKFLD--PKNT--LAVPAGFQDPSMTSQVPYMEARVFTAVTA  95

Query  434  YSFRVSP  454
            Y F + P
Sbjct  96   YKFPIKP  102



>gb|KHN31469.1| Receptor-like protein kinase ANXUR2 [Glycine soja]
Length=846

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 39/72 (54%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             +L CG     +   DGR+W  DN   +F+      ++S A  +   L S++P+ +ARVF
Sbjct  14   LILGCGLDGGGAKDADGREWSPDN---KFLGPEGGSITSKASYQDPSLMSEIPYMSARVF  70

Query  419  TSELTYSFRVSP  454
            +SE TY F + P
Sbjct  71   SSEATYKFPIQP  82



>ref|XP_007151348.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
 gb|ESW23342.1| hypothetical protein PHAVU_004G038800g [Phaseolus vulgaris]
Length=891

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDG-RDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTT  406
            E F +SCG   KS+  DG R W  D D  YL F   + +E ++     Q P  +Q+P++T
Sbjct  33   EIFTISCGTTGKSS--DGQRRWTGDEDTKYLSFKDGSVSEKATT----QSPSTNQIPYST  86

Query  407  ARVFTSELTYSFRVSP  454
            AR+  S+  YSF VSP
Sbjct  87   ARLSRSQFNYSFPVSP  102



>ref|NP_198718.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID6.1|Y5392_ARATH RecName: Full=Probable receptor-like protein kinase At5g39020; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10826.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94387.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=813

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S +    GR+W  ++   Q + +N    S  + A  Q    S++P+  AR
Sbjct  27   DVFLFNCGDTSNNVDNSGRNWTVESR--QILSSNLVNASFTSEASYQKAGVSRIPYMKAR  84

Query  413  VFTSELTYSFRVSP  454
            +F SE TYSF V+P
Sbjct  85   IFRSEFTYSFPVTP  98



>ref|XP_007144836.1| hypothetical protein PHAVU_007G188300g [Phaseolus vulgaris]
 gb|ESW16830.1| hypothetical protein PHAVU_007G188300g [Phaseolus vulgaris]
Length=862

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 5/68 (7%)
 Frame = +2

Query  242  FLLSCG-APSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
            FLL CG A       DGR W  D+ YL    + T  L+  A  +   L S+VP+ TAR+F
Sbjct  31   FLLGCGLAKEGGKDSDGRQWTPDDKYL----SETNSLTFKASFQDPSLLSEVPYMTARIF  86

Query  419  TSELTYSF  442
            T+E +Y F
Sbjct  87   TAEASYKF  94



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 35/71 (49%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  +    DGR W  D       P N A ++S +   Q P   QVP+ TARV  
Sbjct  40   ILLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASAS--GQDPSVPQVPYLTARVSA  97

Query  422  SELTYSFRVSP  454
            S  TYSF + P
Sbjct  98   SPFTYSFPLGP  108



>ref|XP_003552594.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=874

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  35   ELFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  88

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  89   SHSQFTYSFSVS  100



>ref|XP_007032799.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY03725.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
Length=888

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 40/72 (56%), Gaps = 4/72 (6%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAEL--SSPAIAE-QGPLASQVPFTTARVF  418
            L+CGA S S   DGR W  D    +F P  ++    S+P  A+ QG     VP+ TARV 
Sbjct  38   LNCGALSDSHGSDGRFWAGDKSS-KFGPVESSRTIPSAPYEADNQGGSVETVPYMTARVS  96

Query  419  TSELTYSFRVSP  454
            +SE  YSF VSP
Sbjct  97   SSEFKYSFPVSP  108



>ref|XP_009364589.1| PREDICTED: receptor-like protein kinase ANXUR2 [Pyrus x bretschneideri]
Length=880

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 5/72 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP-LASQVPFTTARVF  418
             +L CG  +++   DGR W  D  YL     ++++ +S     Q P L S+VP+  AR+F
Sbjct  31   LILGCGYENEAKDADGRKWQPDTKYL----ADSSKTTSAQAQYQDPELLSEVPYMKARIF  86

Query  419  TSELTYSFRVSP  454
            T+  TY   V P
Sbjct  87   TANATYKLPVKP  98



>gb|KHN37917.1| Putative receptor-like protein kinase [Glycine soja]
Length=314

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  35   EIFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  88

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  89   SHSQFTYSFSVS  100



>ref|XP_008809255.1| PREDICTED: receptor-like protein kinase ANXUR1 [Phoenix dactylifera]
Length=865

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGP-LASQVPFTTARVF  418
             LL+CG+ +  T  D R W  DN   +  P+  +  +  A   Q P L S VP+ TAR+F
Sbjct  35   ILLNCGSSADGTDADNRKWAADNGS-KLRPSGNSAAAQAAF--QDPSLLSPVPYMTARIF  91

Query  419  TSELTYSFRVS  451
            TSE TY F VS
Sbjct  92   TSESTYKFAVS  102



>gb|KDP23678.1| hypothetical protein JCGZ_23511 [Jatropha curcas]
Length=828

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (48%), Gaps = 5/71 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            F L+CG        DG+ W+ D  Y+     N     + A  +   +AS +PF  AR+FT
Sbjct  29   FFLTCGTEKGGADADGQIWEPDTKYISGNHPN-----AKARTQDSTIASDIPFMVARIFT  83

Query  422  SELTYSFRVSP  454
            SE TY   V P
Sbjct  84   SEATYKLPVKP  94



>emb|CDX67422.1| BnaA07g14620D [Brassica napus]
Length=722

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 10/77 (13%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELS---SPAIAEQG-PLASQVPFT  403
            + FL +CGA S  T   GR W  +N   + +P+N+ + S     +  E G PL   VP+ 
Sbjct  30   DLFLFNCGANSDVTDS-GRSWTAENR--KTLPSNSGDASFSSEASFQESGVPL---VPYK  83

Query  404  TARVFTSELTYSFRVSP  454
            TAR+F S+ TYSF VSP
Sbjct  84   TARIFRSDFTYSFPVSP  100



>ref|XP_006606937.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Glycine 
max]
Length=843

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 4/57 (7%)
 Frame = +2

Query  284  DGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSELTYSFRVSP  454
            DGR W  DN YL    +    ++S A  +   L S+VP+ T+RVFTSE TY F V P
Sbjct  46   DGRQWTPDNKYL----SGGNSVTSKASFQDPSLFSEVPYMTSRVFTSEATYKFPVKP  98



>gb|KHN37916.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=1071

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  330  ELFSINCGSSSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  383

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  384  SHSQFTYSFPVS  395



>ref|XP_002870806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=478

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (55%), Gaps = 1/73 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL +CG  S +   +GR+W  ++  +       A  +S A + Q    S++P+  AR+
Sbjct  27   DVFLFNCGDTSNNVDNNGRNWTAEDRKILSSNLVNASYTSEA-SYQKTGVSRIPYMKARI  85

Query  416  FTSELTYSFRVSP  454
            F SE TYSF V+P
Sbjct  86   FRSEFTYSFPVTP  98



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S  +  DGRDW +D        +++   S+   + Q P   QVP+ TAR+
Sbjct  31   EKILLDCGANSDQSDSDGRDWTSDRG--SSFLSSSTNSSTATASTQDPSVPQVPYLTARI  88

Query  416  FTSELTYSFRV  448
            F S  TYSF V
Sbjct  89   FRSSFTYSFPV  99



>dbj|BAJ93584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 2/72 (3%)
 Frame = +2

Query  239  FFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
              L++CGA  +     GR W  D    +F P+    +++ A  +   L S VPF TAR+F
Sbjct  33   LILVNCGASGQEDDDSGRTWGEDTGS-KFAPS-LKGVAANAQRQDSSLPSTVPFMTARIF  90

Query  419  TSELTYSFRVSP  454
            TS  TYSF V+P
Sbjct  91   TSNYTYSFPVTP  102



>ref|XP_006604845.1| PREDICTED: receptor-like protein kinase ANXUR2-like [Glycine 
max]
Length=866

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +2

Query  242  FLLSCGAPSK-STSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             +L CG     +   DGR W  D+   +F+      ++S A  +   L S++P+ +ARVF
Sbjct  35   LILGCGLDGGGAKDADGRQWSPDS---KFLGPEGGSITSKASYQDPSLMSEIPYMSARVF  91

Query  419  TSELTYSFRVSP  454
            TSE TY F V P
Sbjct  92   TSETTYKFPVQP  103



>ref|XP_006603591.1| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=627

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  180  ELFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSTLEGPYTDARF  233

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  234  SHSQFTYSFSVS  245



>gb|EAY75971.1| hypothetical protein OsI_03893 [Oryza sativa Indica Group]
Length=859

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 34/67 (51%), Gaps = 4/67 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR W  D    ++ P   A L S + A Q P   QVP+ TARV  
Sbjct  50   ILLDCGATGKGNDTDGRVWSGDAGS-KYAP---ASLGSASAAGQDPSVPQVPYLTARVSA  105

Query  422  SELTYSF  442
            +  TYSF
Sbjct  106  APFTYSF  112



>emb|CDX88223.1| BnaA06g28140D [Brassica napus]
Length=811

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 38/74 (51%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            +  L++CGA S +     R W T   Y    P N+ +LS  A A  Q   AS VPF  AR
Sbjct  30   DVLLINCGATSYTNDTGNRTW-TVEFYWDHSPWNSEKLSFAAKASYQDVAASPVPFREAR  88

Query  413  VFTSELTYSFRVSP  454
            +F S  TY F VSP
Sbjct  89   IFRSNFTYKFHVSP  102



>ref|XP_002447169.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
 gb|EES11497.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
Length=877

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = +2

Query  248  LSCGAPSKST-SQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTS  424
            L CGA S +    DGR WD+D +  +F P     +++ A  +   L S  P+ TAR+FTS
Sbjct  37   LDCGATSPTGPDADGRSWDSDTNS-KFAPA-LKGIAATASYQDSSLPSATPYMTARIFTS  94

Query  425  ELTYSFRVSP  454
              TYSF VSP
Sbjct  95   NYTYSFPVSP  104



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 34/67 (51%), Gaps = 4/67 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  K    DGR W  D    ++ P   A L S + A Q P   QVP+ TARV  
Sbjct  50   ILLDCGATGKGNDTDGRVWSGDAGS-KYAP---ASLGSASAAGQDPSVPQVPYLTARVSA  105

Query  422  SELTYSF  442
            +  TYSF
Sbjct  106  APFTYSF  112



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            FLL+CG  S++   D R W  D    +F+ ++    +SPA + Q P   QVP+ TARVF 
Sbjct  33   FLLNCGESSEAFDTDNRTWIPDVKS-KFLSSSGDSKASPA-STQDPSVPQVPYMTARVFR  90

Query  422  SELTYSFRVS  451
            S  TYSF V+
Sbjct  91   SSFTYSFPVA  100



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 38/69 (55%), Gaps = 5/69 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD--NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
              L+CG P+ ST  D + W TD  + +L    TN+   S+     Q P   QVP+ TAR+
Sbjct  34   IFLNCGGPAVSTDSDNQTWTTDVLSKFLSSPSTNSLTASASV---QLPDVPQVPYMTARI  90

Query  416  FTSELTYSF  442
            F SE TYSF
Sbjct  91   FKSEFTYSF  99



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S  +  D R W  D    +F+      ++SPA + Q P   +VP+ TARV
Sbjct  36   EKILLNCGEKSDLSDNDNRKWTPDVGS-KFLTGTEKSVTSPA-SSQDPAVPEVPYMTARV  93

Query  416  FTSELTYSFRV  448
            F S  TYSF V
Sbjct  94   FHSNFTYSFPV  104



>ref|XP_006842554.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 1/73 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            +  LL CG  S S   D R W  D +  +F P +   L   A  +   L S+ P+ TAR+
Sbjct  42   DVILLDCGTDSDSNDADNRHWTGDANS-RFAPASQNTLPVQASNQDTSLPSKTPYMTARI  100

Query  416  FTSELTYSFRVSP  454
            F S  TY+F V+P
Sbjct  101  FNSNFTYTFPVTP  113



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (51%), Gaps = 2/71 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S     DGRDW +D        +  +  ++ +   Q P   QVP+ TAR+
Sbjct  34   EKTLLDCGANSDRPDSDGRDWTSDKGSSFLSSSGKSSTATAST--QDPAVPQVPYLTARI  91

Query  416  FTSELTYSFRV  448
            F S  TYSF V
Sbjct  92   FQSNFTYSFPV  102



>emb|CDP21458.1| unnamed protein product [Coffea canephora]
Length=132

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  284  DGRDWDTDNHYLQFMPTNTAELSSPAIA-EQGPLASQVPFTTARVFTSELTYSFRVS  451
            DGR WD D    +F P + A +SS   A E GP  S+ PF++AR+  S+ +Y+F VS
Sbjct  47   DGRKWDGDVGS-KFSPNDMANISSAVTATELGPSVSRAPFSSARIIRSQFSYTFPVS  102



>emb|CBI27305.3| unnamed protein product [Vitis vinifera]
Length=762

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPT--NTAELSSPAIAEQGPLASQVPFTTA  409
            E   L CG+   ST+ DGR W +D    +F+ +  N + +S  +  +  PL   VP+ TA
Sbjct  143  ENIALDCGSHGHSTAPDGRKWTSDTGS-KFICSQLNASSISMASTQDSVPL---VPYMTA  198

Query  410  RVFTSELTYSFRVSP  454
            R+FTS+ TY+F +SP
Sbjct  199  RIFTSQFTYAFPLSP  213



>ref|XP_002273707.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=924

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPT--NTAELSSPAIAEQGPLASQVPFTTA  409
            E   L CG+   ST+ DGR W +D    +F+ +  N + +S  +  +  PL   VP+ TA
Sbjct  99   ENIALDCGSHGHSTAPDGRKWTSDTGS-KFICSQLNASSISMASTQDSVPL---VPYMTA  154

Query  410  RVFTSELTYSFRVSP  454
            R+FTS+ TY+F +SP
Sbjct  155  RIFTSQFTYAFPLSP  169



>ref|XP_004976623.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=509

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/69 (41%), Positives = 36/69 (52%), Gaps = 6/69 (9%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            ++CGA   +   DGR WD D       P+    +++ A  E   L S VP+ TARVF S 
Sbjct  37   VNCGASVSAADSDGRTWDRD------APSVGGGVAAGAPYEDPSLPSAVPYMTARVFGSA  90

Query  428  LTYSFRVSP  454
             TYSF V P
Sbjct  91   HTYSFPVRP  99



>gb|KJB80425.1| hypothetical protein B456_013G096400 [Gossypium raimondii]
Length=519

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPS-KSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTAR  412
            E  LL CG+ + ++ S DGR+W  D+ +     + ++   S A  E+  +A +VP+ TAR
Sbjct  28   ETILLDCGSSALRALSYDGRNWTNDSSHFGASNSESSFAMSRASLEETSVA-EVPYMTAR  86

Query  413  VFTSELTYSFRVSP  454
            +F S  TY+F V+P
Sbjct  87   LFHSRFTYTFNVTP  100



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 35/71 (49%), Gaps = 2/71 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL CGA  +    DGR W  D       P N A ++S   + Q P   QVP+ TARV  
Sbjct  33   ILLDCGAKGQGNDTDGRVWTGDAGSKFAPPDNLASVAS--ASGQDPSVPQVPYLTARVSA  90

Query  422  SELTYSFRVSP  454
            S  TYSF + P
Sbjct  91   SPFTYSFPLGP  101



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S     D R W +D    +F+ ++    +SPA A Q P  SQVP+ TARVF 
Sbjct  37   ILLNCGGASDLVDTDNRTWISDVKS-KFLSSSGDSKTSPA-ATQDPSVSQVPYMTARVFR  94

Query  422  SELTYSFRVS  451
            S  TY F V+
Sbjct  95   SPFTYPFPVA  104



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 36/71 (51%), Gaps = 1/71 (1%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL+CG  S+ T  D R W  D      +   T  + S A A Q P   +VP+ TARV
Sbjct  33   EKILLNCGEKSELTDDDNRKWTPDVGSKFLVGGGTNSVPSQA-ATQDPAVPEVPYLTARV  91

Query  416  FTSELTYSFRV  448
            F S  TYSF V
Sbjct  92   FLSNFTYSFPV  102



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P +ST  DG+ W +D        +     +SPA A Q P   + PF TARVF 
Sbjct  28   IFLNCGGPQESTDADGQKWTSD--VGSKFASGANSTTSPA-ATQDPSVPETPFMTARVFH  84

Query  422  SELTYSFRVS  451
            S+ TY F V+
Sbjct  85   SDYTYKFPVA  94



>ref|NP_198719.1| putative receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q9FID5.1|Y5393_ARATH RecName: Full=Probable receptor-like protein kinase At5g39030; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10827.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AED94389.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=806

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 37/73 (51%), Gaps = 0/73 (0%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + FL++CG         GR W  +   +    ++ A  SS    ++     QVP+ TAR+
Sbjct  25   DVFLINCGETDVPFDNHGRTWTQEEKNILPKNSDNASFSSVVSYKEESGIPQVPYMTARI  84

Query  416  FTSELTYSFRVSP  454
            F S+ TYSF VSP
Sbjct  85   FRSDFTYSFPVSP  97



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 7/71 (10%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            +  LL CGA  ++T  +GR W  D+ + Y  F+  N    ++P      P   QVP+ TA
Sbjct  38   DHILLDCGASGQATDANGRSWTADSGSKYAPFL--NGGGFTAPLQDSSVP---QVPYLTA  92

Query  410  RVFTSELTYSF  442
            RVFTS  TYSF
Sbjct  93   RVFTSPYTYSF  103



>ref|XP_006285765.1| hypothetical protein CARUB_v10007239mg [Capsella rubella]
 gb|EOA18663.1| hypothetical protein CARUB_v10007239mg [Capsella rubella]
Length=888

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNT--AELSSPAIAEQGPLASQVPFTTA  409
            + F ++CGA S      GR W  + + L   P+N+  A  +S A+ ++  + SQVP+  A
Sbjct  29   DVFFINCGATSND-ENGGRTWTPERNIL---PSNSESASFTSDALYQESGV-SQVPYMVA  83

Query  410  RVFTSELTYSFRVSP  454
            R+F SE TYSF +SP
Sbjct  84   RLFRSEFTYSFPLSP  98



>gb|KHN37921.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=855

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E F ++CG+ S  +++DGR+W  D   ++F+  N   +++PA+    P   + P+T AR 
Sbjct  35   ELFSINCGSNSSLSTRDGRNWTAD---IKFLSENKDSVAAPALT---PSILEGPYTDARF  88

Query  416  FTSELTYSFRVS  451
              S+ TYSF VS
Sbjct  89   SHSQFTYSFPVS  100



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 36/72 (50%), Gaps = 5/72 (7%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPA-IAEQGPLASQVPFTTARVF  418
              LSCG  S+ T  D R W  D +     P +    S PA  A Q P   QVPF TAR+F
Sbjct  41   IFLSCGESSQRTDSDQRQWIPDVNSKFLSPGS----SKPAKAATQDPGVPQVPFMTARIF  96

Query  419  TSELTYSFRVSP  454
             S  TYSF V P
Sbjct  97   HSAFTYSFPVEP  108



>emb|CDY37884.1| BnaC04g31220D [Brassica napus]
Length=867

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 3/74 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            + FL +CG  S      GR+W  +      +P+N A  S  + A  QG    QVP+ TAR
Sbjct  48   DIFLFNCGETSNQMDISGRNWMAEQP--NILPSNAAIASFVSHASFQGSGVPQVPYMTAR  105

Query  413  VFTSELTYSFRVSP  454
            +F  + TYSF VSP
Sbjct  106  IFRHDFTYSFPVSP  119



>ref|XP_010230703.1| PREDICTED: receptor-like protein kinase ANXUR1 [Brachypodium 
distachyon]
Length=1610

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 1/72 (1%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVF  418
             LL+CG+ +     DGR W  D N+ +    +  + + + A      L S +P+ TARVF
Sbjct  761  LLLNCGSTADGLDADGRKWLADTNNNMWLGDSGKSSIMAAADELDSSLPSTIPYMTARVF  820

Query  419  TSELTYSFRVSP  454
            T E  Y+F V+P
Sbjct  821  TVEAVYNFTVNP  832



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P ++T  DG  W +D    +F     +  +S A A Q P    VPF TARVF 
Sbjct  33   IFLNCGGPPETTDSDGLKWTSDVGS-KFASGGNSSTTSAA-ATQDPAVPDVPFMTARVFR  90

Query  422  SELTYSFRVS  451
            S+ TY F V+
Sbjct  91   SKFTYKFPVA  100



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA S  T  + R W +D+   +F+  +   +++ A ++   L S +P+ TAR+F 
Sbjct  36   YVLACGASSDGTDSNDRKWTSDS---KFLTNSGNSITATAQSQDSSLPSTIPYMTARIFK  92

Query  422  SELTYSFRVS  451
            S  +Y F VS
Sbjct  93   STSSYKFTVS  102



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = +2

Query  152  SFPIIIFHFlalrladttaaaaplykatEFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMP  331
            SFP+ +  FL+L L       A  Y  TE  LL+CG  S+ T  D R W  D      + 
Sbjct  8    SFPMSVIIFLSLLLLLFQLVLAADYVPTEKILLNCGEKSELTDNDNRKWTPDFGSKFLVG  67

Query  332  TNTAELSSPAIAEQGPLASQVPFTTARVFTSELTYSFRV  448
            T  + +S  A   Q P   +VP+ TARVF S  TYSF V
Sbjct  68   TGNSVISRAAT--QDPAVPEVPYLTARVFRSNFTYSFPV  104



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA S  T  + R W +D+   +F+  +   +++ A ++   L S +P+ TAR+F 
Sbjct  36   YVLACGASSDGTDSNDRKWTSDS---KFLTNSGNSITATAQSQDSSLPSTIPYMTARIFK  92

Query  422  SELTYSFRVS  451
            S  +Y F VS
Sbjct  93   STSSYKFTVS  102



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 41/70 (59%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            ++L+CGA S  T  + R W +D+   +F+  +   +++ A ++   L S +P+ TAR+F 
Sbjct  36   YVLACGASSDGTDSNDRKWTSDS---KFLTNSGNSITATAQSQDSSLPSTIPYMTARIFK  92

Query  422  SELTYSFRVS  451
            S  +Y F VS
Sbjct  93   STSSYKFTVS  102



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
              L+CG P ++T  +G  W +D        +     +SPA A Q P   +VPF TARVF 
Sbjct  35   IFLNCGGPPETTDSNGLKWTSD--IGSKFASGANSTTSPA-ATQDPAVPEVPFMTARVFR  91

Query  422  SELTYSFRVS  451
            SE TY F V+
Sbjct  92   SEYTYKFPVA  101



>ref|XP_011099030.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=886

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 2/72 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAE-QGPLASQVPFTTAR  412
            +  LL+CG+ S       R WD+D     + P N A +S  ++A    P   QVP+ TAR
Sbjct  33   DLILLNCGSLSNLNDTSSRSWDSDERS-SYAPPNAASISLSSMASTMAPSVFQVPYQTAR  91

Query  413  VFTSELTYSFRV  448
            VF S  TY+F V
Sbjct  92   VFRSSFTYAFPV  103



>ref|XP_007151356.1| hypothetical protein PHAVU_004G039600g [Phaseolus vulgaris]
 gb|ESW23350.1| hypothetical protein PHAVU_004G039600g [Phaseolus vulgaris]
Length=865

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDW--DTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTA  409
            + F +SCG   KS S   R W  D D  YL F   + +E ++     Q P  +Q+P++TA
Sbjct  24   DIFTISCGTTGKS-SDAQRRWTGDEDTKYLSFKEGSVSEKAT----RQSPSTNQIPYSTA  78

Query  410  RVFTSELTYSFRVSP  454
            R+  S+  YSF VSP
Sbjct  79   RLSRSQFNYSFPVSP  93



>ref|XP_010441032.1| PREDICTED: probable receptor-like protein kinase At5g39030 isoform 
X2 [Camelina sativa]
Length=769

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL-ASQVPFTTAR  412
            +  L++CG PS +    GR W  ++   + +P N+   S  + A    L   QVP+  AR
Sbjct  30   DVILINCGEPSVTIDTGGRTWMPEDKK-KILPLNSDNTSFSSDASYKELRIPQVPYMNAR  88

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF +SP
Sbjct  89   IFRSDFTYSFPLSP  102



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 2/71 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  LL CGA S     DGRDW +D        +++A  S+   + Q P   QVP+ TAR+
Sbjct  31   EKILLDCGANSDQPDSDGRDWTSDRG--SSFLSSSANSSTATASTQDPSVPQVPYLTARI  88

Query  416  FTSELTYSFRV  448
            F S  TYSF V
Sbjct  89   FRSNFTYSFPV  99



>ref|XP_009419820.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +++S DGR W  D    ++ P+   +        Q P  S VP++TARVFT
Sbjct  37   ILLNCGASGQASSFDGRSWTGDTG-TRYAPSLNGD--GFDALRQDPSVSTVPYSTARVFT  93

Query  422  SELTYSFRVS  451
            S  TY F +S
Sbjct  94   SPFTYRFPLS  103



>ref|XP_002439522.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
 gb|EES17952.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
Length=870

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  L+ CG+  +    DGR W TD      +    + + + A  +   L S VP+ +ARV
Sbjct  31   ESILVDCGSAKEGQDADGRKWVTDQGSNWLIDGGKSSIMADADVQDPSLPSPVPYMSARV  90

Query  416  FTSELTYSFRVS  451
            FT E  Y+F + 
Sbjct  91   FTKEAVYNFSIG  102



>ref|XP_010441031.1| PREDICTED: probable receptor-like protein kinase At5g39030 isoform 
X1 [Camelina sativa]
Length=812

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 2/74 (3%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPL-ASQVPFTTAR  412
            +  L++CG PS +    GR W  ++   + +P N+   S  + A    L   QVP+  AR
Sbjct  30   DVILINCGEPSVTIDTGGRTWMPEDKK-KILPLNSDNTSFSSDASYKELRIPQVPYMNAR  88

Query  413  VFTSELTYSFRVSP  454
            +F S+ TYSF +SP
Sbjct  89   IFRSDFTYSFPLSP  102



>ref|XP_009419819.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=545

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 3/70 (4%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CGA  +++S DGR W  D    ++ P+   +        Q P  S VP++TARVFT
Sbjct  51   ILLNCGASGQASSFDGRSWTGDTG-TRYAPSLNGD--GFDALRQDPSVSTVPYSTARVFT  107

Query  422  SELTYSFRVS  451
            S  TY F +S
Sbjct  108  SPFTYRFPLS  117



>dbj|BAK06468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMP-------TNTAELSSPAIAEQGPLASQVPF  400
             L+ CG+  +   +DGR W +D    +F+P       T TA+++ P+      L S VP+
Sbjct  35   ILVDCGSDKEGQDEDGRKWTSDKDS-KFLPDGGKSSITATADINDPS------LPSSVPY  87

Query  401  TTARVFTSELTYSFRVS  451
             TARVF  E  Y+F VS
Sbjct  88   MTARVFPKETAYTFPVS  104



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 34/69 (49%), Gaps = 2/69 (3%)
 Frame = +2

Query  248  LSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFTSE  427
            L CGA  +    DGR W  D       P N A ++S   + Q P   QVP+ TARV  S 
Sbjct  35   LDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVAS--ASGQDPSVPQVPYLTARVSASP  92

Query  428  LTYSFRVSP  454
             TYSF + P
Sbjct  93   FTYSFPLGP  101



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             LL+CG  S S   D R W  D    +F+ ++    +SPA A Q P   +VPF TAR+F 
Sbjct  37   ILLNCGGSSDSADTDNRTWIPDVKS-KFLSSSGDSKTSPA-ATQDPSVPEVPFMTARIFR  94

Query  422  SELTYSFRVS  451
            S  TY+F V+
Sbjct  95   SPFTYTFPVA  104



>ref|XP_004962493.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Setaria 
italica]
Length=869

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 36/71 (51%), Gaps = 0/71 (0%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            E  L++CG+  +    DGR W TD      +    + + + A  +   L S VP+ +ARV
Sbjct  30   ESILVNCGSAKEGLDADGRKWMTDQDSKWLIDGGKSSIMADADVQDPSLPSPVPYMSARV  89

Query  416  FTSELTYSFRV  448
            FT E  Y+F V
Sbjct  90   FTKETVYNFSV  100



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 3/73 (4%)
 Frame = +2

Query  236  EFFLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            ++ LL+CGA  K+   D + W  D         N    ++P   +Q     +VP+ TARV
Sbjct  32   DYILLNCGASGKAIDTDSQTWTGDAGSKYGPSLNAVGFTAP---QQDSSVPEVPYLTARV  88

Query  416  FTSELTYSFRVSP  454
            FTS  TYSF V P
Sbjct  89   FTSPYTYSFPVGP  101



>ref|XP_004967845.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=886

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 36/71 (51%), Gaps = 1/71 (1%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            LL+CG+ + S   DGR W  D N       +  + L   A      L S +P+ TARVFT
Sbjct  34   LLNCGSATDSLDGDGRKWMADTNDDTWLTDSGKSSLMMAADRMDNGLPSTIPYMTARVFT  93

Query  422  SELTYSFRVSP  454
             E  Y+F V+P
Sbjct  94   MEAVYNFTVNP  104



>ref|XP_010694005.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=910

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKS--TSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + ++CG P  +  +S+DG  W +D++   F P +  ++SS  I          P+T AR+
Sbjct  25   YFIACGLPKSTAHSSEDGSTWRSDDN-PAFTPPDINKISSSVIGH----GDDYPYTRARI  79

Query  416  FTSELTYSFRVSP  454
            F S +TYSF VSP
Sbjct  80   FESAVTYSFEVSP  92



>ref|XP_010694013.1| PREDICTED: putative receptor-like protein kinase At5g39000 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=908

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 7/73 (10%)
 Frame = +2

Query  242  FLLSCGAPSKS--TSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARV  415
            + ++CG P  +  +S+DG  W +D++   F P +  ++SS  I          P+T AR+
Sbjct  23   YFIACGLPKSTAHSSEDGSTWRSDDN-PAFTPPDINKISSSVIGH----GDDYPYTRARI  77

Query  416  FTSELTYSFRVSP  454
            F S +TYSF VSP
Sbjct  78   FESAVTYSFEVSP  90



>ref|XP_002457574.1| hypothetical protein SORBIDRAFT_03g009660 [Sorghum bicolor]
 gb|EES02694.1| hypothetical protein SORBIDRAFT_03g009660 [Sorghum bicolor]
Length=882

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +2

Query  245  LLSCGAPSKSTSQDGRDWDTD-NHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
            LL+CG+ +     DGR W  D N       +  + L   A      L S +P+ TARVFT
Sbjct  34   LLNCGSTTDGLDADGRKWVADTNDNTWLTDSGKSSLLMAADKVDNGLPSTIPYMTARVFT  93

Query  422  SELTYSFRVSP  454
            +E  Y+F V P
Sbjct  94   TEAVYNFSVKP  104



>ref|XP_010025009.1| PREDICTED: receptor-like protein kinase ANXUR1 [Eucalyptus grandis]
Length=860

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 4/69 (6%)
 Frame = +2

Query  242  FLLSCGAPSKSTSQDGRDWDTDNHYLQFMPTNTAELSSPAIAEQGPLASQVPFTTARVFT  421
             +LSCG+       DG+ WD+D+ Y     T+    S  A+ +   L S VP+ +AR+FT
Sbjct  31   LILSCGSTGGGKDADGQKWDSDSKYF----TSNNSTSEKAMFQDPSLPSDVPYMSARIFT  86

Query  422  SELTYSFRV  448
            S  TY   V
Sbjct  87   SVGTYQLPV  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105