BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034D23

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04035.1|  unnamed protein product                                254   1e-78   Coffea canephora [robusta coffee]
gb|KHG08105.1|  Root phototropism 2 -like protein                       252   2e-78   Gossypium arboreum [tree cotton]
gb|KJB26284.1|  hypothetical protein B456_004G235100                    252   8e-78   Gossypium raimondii
ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        252   9e-78   Sesamum indicum [beniseed]
ref|XP_008358916.1|  PREDICTED: root phototropism protein 2-like        237   9e-77   
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        249   1e-76   Solanum tuberosum [potatoes]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             249   1e-76   Solanum lycopersicum
emb|CBI15801.3|  unnamed protein product                                233   1e-74   Vitis vinifera
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             244   1e-74   Nicotiana tomentosiformis
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                244   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             243   2e-74   Eucalyptus grandis [rose gum]
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             243   3e-74   Nicotiana sylvestris
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         243   4e-74   
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    243   5e-74   Vitis vinifera
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         241   1e-73   Jatropha curcas
gb|AAB63085.1|  unknown protein                                         229   4e-73   Arabidopsis thaliana [mouse-ear cress]
gb|ADL36608.1|  BZIP domain class transcription factor                  239   1e-72   Malus domestica [apple tree]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        239   1e-72   
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    239   1e-72   
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        238   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_010094443.1|  Root phototropism protein 2                        238   2e-72   Morus notabilis
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   238   3e-72   Citrus sinensis [apfelsine]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             238   3e-72   Citrus clementina [clementine]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             238   3e-72   Fragaria vesca subsp. vesca
ref|NP_001280845.1|  root phototropism protein 2-like                   236   1e-71   Malus domestica [apple tree]
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    236   2e-71   Cucumis melo [Oriental melon]
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        236   2e-71   Cucumis sativus [cucumbers]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    235   3e-71   Prunus mume [ume]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    235   3e-71   Prunus mume [ume]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             235   4e-71   Prunus persica
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    235   2e-70   
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       233   3e-70   Cucumis sativus [cucumbers]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        231   4e-70   Glycine max [soybeans]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        232   4e-70   Pyrus x bretschneideri [bai li]
gb|KHN18647.1|  Root phototropism protein 2                             225   5e-70   Glycine soja [wild soybean]
ref|NP_001280895.1|  root phototropism protein 2-like                   230   2e-69   Malus domestica [apple tree]
ref|XP_006410156.1|  hypothetical protein EUTSA_v10016728mg             226   3e-69   
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        229   4e-69   Cicer arietinum [garbanzo]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 229   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             229   9e-69   Capsella rubella
dbj|BAF02185.1|  hypothetical protein                                   229   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAF33112.1|AF181683_1  RPT2                                          229   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           228   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        228   2e-68   Camelina sativa [gold-of-pleasure]
gb|AFK45576.1|  unknown                                                 225   2e-68   Medicago truncatula
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             228   3e-68   
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        228   3e-68   Populus euphratica
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        227   4e-68   Populus euphratica
emb|CDY10743.1|  BnaA05g11930D                                          227   4e-68   Brassica napus [oilseed rape]
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        227   5e-68   Glycine max [soybeans]
gb|KFK22949.1|  root phototropism protein 2                             227   6e-68   Arabis alpina [alpine rockcress]
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             227   6e-68   Brassica rapa
dbj|BAJ33924.1|  unnamed protein product                                227   6e-68   Eutrema halophilum
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 226   8e-68   
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             226   8e-68   Nelumbo nucifera [Indian lotus]
ref|XP_003600550.1|  Root phototropism protein                          226   1e-67   Medicago truncatula
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        226   1e-67   Populus euphratica
dbj|BAF01791.1|  hypothetical protein                                   226   2e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02075.1|  BnaC04g14260D                                          225   2e-67   
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    226   2e-67   
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             225   3e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        225   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             223   2e-66   Phaseolus vulgaris [French bean]
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             223   2e-66   Tarenaya hassleriana [spider flower]
emb|CDY23992.1|  BnaC03g16990D                                          222   3e-66   Brassica napus [oilseed rape]
gb|KJB26282.1|  hypothetical protein B456_004G235100                    221   4e-66   Gossypium raimondii
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        221   9e-66   Glycine max [soybeans]
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             218   1e-64   
ref|XP_003616056.1|  Root phototropism protein                          216   5e-64   Medicago truncatula
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             216   7e-64   Phaseolus vulgaris [French bean]
gb|ABI34691.1|  bZIP transcription factor bZIP84                        202   5e-63   Glycine max [soybeans]
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             213   5e-63   Sesamum indicum [beniseed]
emb|CDX84827.1|  BnaA03g14030D                                          212   1e-62   
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          212   1e-62   Amborella trichopoda
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        212   2e-62   Brassica rapa
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        210   1e-61   Cicer arietinum [garbanzo]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        207   1e-60   Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     207   1e-60   Eucalyptus grandis [rose gum]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        201   2e-58   Tarenaya hassleriana [spider flower]
gb|EPS73802.1|  hypothetical protein M569_00954                         187   5e-53   Genlisea aurea
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             185   3e-52   Phoenix dactylifera
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    180   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    179   3e-50   Gossypium raimondii
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    177   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             174   3e-48   
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   174   3e-48   Citrus sinensis [apfelsine]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    170   5e-47   
gb|KGN61975.1|  hypothetical protein Csa_2G277660                       164   2e-46   Cucumis sativus [cucumbers]
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g             169   4e-46   Phaseolus vulgaris [French bean]
ref|NP_001031446.1|  Root phototropism protein 2                        167   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-45   Cicer arietinum [garbanzo]
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...    167   1e-45   Cicer arietinum [garbanzo]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             166   2e-45   Elaeis guineensis
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...    166   3e-45   Glycine max [soybeans]
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...    165   8e-45   
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg                164   9e-45   Erythranthe guttata [common monkey flower]
ref|XP_010086959.1|  BTB/POZ domain-containing protein                  164   1e-44   
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-44   Citrus sinensis [apfelsine]
gb|KHG27515.1|  hypothetical protein F383_13864                         163   1e-44   Gossypium arboreum [tree cotton]
gb|KDO78973.1|  hypothetical protein CISIN_1g006971mg                   162   1e-44   Citrus sinensis [apfelsine]
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   Vitis vinifera
emb|CBI33715.3|  unnamed protein product                                163   2e-44   Vitis vinifera
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   Glycine max [soybeans]
gb|KHN36285.1|  BTB/POZ domain-containing protein                       164   2e-44   Glycine soja [wild soybean]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-44   Cucumis melo [Oriental melon]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein         164   2e-44   
emb|CAN71562.1|  hypothetical protein VITISV_007563                     163   3e-44   Vitis vinifera
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...    163   3e-44   Sesamum indicum [beniseed]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg             162   5e-44   Citrus clementina [clementine]
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                   162   5e-44   Citrus sinensis [apfelsine]
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...    164   7e-44   
gb|KJB48680.1|  hypothetical protein B456_008G080700                    160   8e-44   Gossypium raimondii
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g             162   8e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...    162   9e-44   Populus euphratica
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-43   Populus euphratica
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...    161   2e-43   Nicotiana tomentosiformis
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...    161   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...    161   2e-43   Eucalyptus grandis [rose gum]
gb|KJB48677.1|  hypothetical protein B456_008G080700                    160   3e-43   Gossypium raimondii
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...    160   3e-43   Nicotiana sylvestris
emb|CDP02580.1|  unnamed protein product                                160   3e-43   Coffea canephora [robusta coffee]
ref|XP_003597110.1|  Root phototropism protein                          160   4e-43   
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...    160   4e-43   Solanum tuberosum [potatoes]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600          160   5e-43   Amborella trichopoda
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980             159   8e-43   Selaginella moellendorffii
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227             159   9e-43   Selaginella moellendorffii
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...    159   9e-43   Nelumbo nucifera [Indian lotus]
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529             159   9e-43   
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843             159   1e-42   Selaginella moellendorffii
gb|KDP32052.1|  hypothetical protein JCGZ_12513                         159   1e-42   Jatropha curcas
ref|XP_002533158.1|  Root phototropism protein, putative                158   2e-42   Ricinus communis
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...    158   2e-42   Glycine max [soybeans]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...    158   2e-42   
gb|KJB43881.1|  hypothetical protein B456_007G221600                    155   4e-42   Gossypium raimondii
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...    157   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_003608469.1|  BTB/POZ domain-containing protein                  155   4e-42   
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...    157   5e-42   Solanum lycopersicum
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...    157   7e-42   Fragaria vesca subsp. vesca
gb|AES90666.2|  phototropic-responsive NPH3 family protein              156   1e-41   Medicago truncatula
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg             156   1e-41   Prunus persica
gb|AES70802.2|  root phototropism-like protein                          155   1e-41   Medicago truncatula
gb|KJB43880.1|  hypothetical protein B456_007G221600                    155   2e-41   Gossypium raimondii
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...    155   3e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...    155   4e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN12984.1|  BTB/POZ domain-containing protein                       154   9e-41   Glycine soja [wild soybean]
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...    153   1e-40   Elaeis guineensis
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...    152   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...    152   2e-40   
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...    152   2e-40   Cicer arietinum [garbanzo]
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...    152   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040             152   2e-40   Selaginella moellendorffii
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979             152   2e-40   Selaginella moellendorffii
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...    152   3e-40   
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...    151   8e-40   
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...    151   9e-40   
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g             150   1e-39   Phaseolus vulgaris [French bean]
ref|XP_009630230.1|  PREDICTED: BTB/POZ domain-containing protein...    149   1e-39   
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...    149   2e-39   Solanum tuberosum [potatoes]
gb|EPS72379.1|  hypothetical protein M569_02379                         149   3e-39   Genlisea aurea
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...    149   4e-39   
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...    149   5e-39   Nicotiana tomentosiformis
ref|XP_008352542.1|  PREDICTED: BTB/POZ domain-containing protein...    147   5e-39   
gb|KEH28209.1|  root phototropism-like protein                          148   6e-39   Medicago truncatula
ref|XP_008372448.1|  PREDICTED: BTB/POZ domain-containing protein...    147   8e-39   
ref|XP_002866705.1|  signal transducer                                  148   9e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...    147   2e-38   Nicotiana sylvestris
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...    146   3e-38   Elaeis guineensis
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g             147   3e-38   
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...    145   5e-38   Eucalyptus grandis [rose gum]
gb|AAU05485.1|  At5g67385                                               144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_680473.2|  phototropic-responsive NPH3-like protein              144   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                    144   3e-37   Arabis alpina [alpine rockcress]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...    143   5e-37   Pyrus x bretschneideri [bai li]
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg             142   7e-37   Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                                142   7e-37   Eutrema halophilum
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...    142   8e-37   Glycine max [soybeans]
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...    142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006844655.1|  hypothetical protein AMTR_s00016p00237490          141   2e-36   Amborella trichopoda
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...    141   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...    141   2e-36   Glycine max [soybeans]
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg             140   3e-36   Capsella rubella
ref|XP_007050812.1|  Phototropic-responsive NPH3 family protein i...    140   4e-36   Theobroma cacao [chocolate]
ref|XP_002533880.1|  Root phototropism protein, putative                140   5e-36   
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...    140   5e-36   Phoenix dactylifera
gb|EYU46717.1|  hypothetical protein MIMGU_mgv1a003257mg                140   6e-36   Erythranthe guttata [common monkey flower]
ref|XP_011079726.1|  PREDICTED: BTB/POZ domain-containing protein...    139   2e-35   Sesamum indicum [beniseed]
emb|CDY57436.1|  BnaAnng14510D                                          138   2e-35   Brassica napus [oilseed rape]
gb|KJB47066.1|  hypothetical protein B456_008G009400                    137   2e-35   Gossypium raimondii
gb|KHG21965.1|  hypothetical protein F383_08186                         139   2e-35   Gossypium arboreum [tree cotton]
emb|CDY43566.1|  BnaC02g16630D                                          134   3e-35   Brassica napus [oilseed rape]
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...    137   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK07863.1|  predicted protein                                      137   4e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651150.1|  PREDICTED: BTB/POZ domain-containing protein...    137   4e-35   
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...    137   4e-35   Brassica rapa
gb|KJB47067.1|  hypothetical protein B456_008G009400                    137   5e-35   Gossypium raimondii
ref|XP_007050813.1|  Phototropic-responsive NPH3 family protein i...    137   5e-35   Theobroma cacao [chocolate]
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg             136   8e-35   Eutrema salsugineum [saltwater cress]
ref|XP_002521098.1|  protein binding protein, putative                  137   9e-35   Ricinus communis
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...    137   9e-35   Nicotiana tomentosiformis
gb|KHG27924.1|  hypothetical protein F383_10949                         137   1e-34   Gossypium arboreum [tree cotton]
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    136   1e-34   Brassica rapa
emb|CDY37857.1|  BnaAnng05180D                                          136   1e-34   Brassica napus [oilseed rape]
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...    136   1e-34   Sesamum indicum [beniseed]
ref|XP_009414870.1|  PREDICTED: BTB/POZ domain-containing protein...    136   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY68489.1|  BnaCnng59210D                                          135   2e-34   Brassica napus [oilseed rape]
ref|XP_004240632.1|  PREDICTED: BTB/POZ domain-containing protein...    135   2e-34   Solanum lycopersicum
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...    135   3e-34   Fragaria vesca subsp. vesca
ref|XP_011089690.1|  PREDICTED: BTB/POZ domain-containing protein...    134   3e-34   Sesamum indicum [beniseed]
ref|XP_004247452.1|  PREDICTED: BTB/POZ domain-containing protein...    135   3e-34   Solanum lycopersicum
ref|XP_006359421.1|  PREDICTED: BTB/POZ domain-containing protein...    135   3e-34   Solanum tuberosum [potatoes]
ref|XP_009599429.1|  PREDICTED: BTB/POZ domain-containing protein...    135   3e-34   Nicotiana tomentosiformis
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg                135   3e-34   Erythranthe guttata [common monkey flower]
emb|CDY12841.1|  BnaC07g15920D                                          135   3e-34   Brassica napus [oilseed rape]
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933              135   3e-34   
gb|KHG21966.1|  hypothetical protein F383_08186                         135   4e-34   Gossypium arboreum [tree cotton]
gb|EMT21744.1|  BTB/POZ domain-containing protein                       134   4e-34   
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...    135   4e-34   Brachypodium distachyon [annual false brome]
ref|XP_010112756.1|  BTB/POZ domain-containing protein                  135   4e-34   Morus notabilis
ref|XP_002877714.1|  predicted protein                                  134   4e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_011082488.1|  PREDICTED: BTB/POZ domain-containing protein...    135   4e-34   Sesamum indicum [beniseed]
gb|KJB47065.1|  hypothetical protein B456_008G009400                    135   4e-34   Gossypium raimondii
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...    135   4e-34   Sesamum indicum [beniseed]
gb|KJB23203.1|  hypothetical protein B456_004G086600                    135   4e-34   Gossypium raimondii
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...    135   5e-34   Nicotiana sylvestris
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470          134   5e-34   
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...    134   5e-34   Sesamum indicum [beniseed]
ref|XP_009766799.1|  PREDICTED: BTB/POZ domain-containing protein...    134   6e-34   Nicotiana sylvestris
ref|XP_010241864.1|  PREDICTED: BTB/POZ domain-containing protein...    135   6e-34   Nelumbo nucifera [Indian lotus]
dbj|BAC41926.1|  non-phototropic hypocotyl-like protein                 131   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...    134   7e-34   Sesamum indicum [beniseed]
dbj|BAJ33928.1|  unnamed protein product                                134   7e-34   Eutrema halophilum
ref|XP_001763717.1|  predicted protein                                  134   9e-34   
ref|XP_004170411.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    135   9e-34   
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg             134   9e-34   
ref|XP_004136051.1|  PREDICTED: BTB/POZ domain-containing protein...    135   9e-34   Cucumis sativus [cucumbers]
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...    134   9e-34   
ref|XP_008451623.1|  PREDICTED: BTB/POZ domain-containing protein...    134   1e-33   Cucumis melo [Oriental melon]
ref|XP_011082489.1|  PREDICTED: BTB/POZ domain-containing protein...    134   1e-33   
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...    134   1e-33   
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...    133   1e-33   Populus euphratica
gb|KJB41979.1|  hypothetical protein B456_007G130600                    134   1e-33   Gossypium raimondii
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...    133   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006359422.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-33   Solanum tuberosum [potatoes]
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g             133   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-33   Vitis vinifera
ref|XP_001770455.1|  predicted protein                                  133   2e-33   
ref|XP_009151678.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-33   Brassica rapa
ref|XP_010326604.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-33   Solanum lycopersicum
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg             133   2e-33   Prunus persica
emb|CDX85365.1|  BnaC07g26760D                                          133   2e-33   
emb|CDX86278.1|  BnaA06g29950D                                          133   2e-33   
ref|XP_009595976.1|  PREDICTED: BTB/POZ domain-containing protein...    133   2e-33   Nicotiana tomentosiformis
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...    134   2e-33   Pyrus x bretschneideri [bai li]
ref|NP_001049321.2|  Os03g0206700                                       131   3e-33   
gb|KHN13450.1|  BTB/POZ domain-containing protein                       132   3e-33   Glycine soja [wild soybean]
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...    132   3e-33   Solanum tuberosum [potatoes]
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...    132   3e-33   Prunus mume [ume]
gb|KDP26391.1|  hypothetical protein JCGZ_17549                         132   4e-33   Jatropha curcas
ref|NP_199691.1|  phototropic-responsive NPH3 protein                   132   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320358.1|  hypothetical protein POPTR_0014s12800g             132   5e-33   Populus trichocarpa [western balsam poplar]
gb|KHG22134.1|  hypothetical protein F383_09600                         132   5e-33   Gossypium arboreum [tree cotton]
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...    132   5e-33   Cicer arietinum [garbanzo]
gb|KJB26098.1|  hypothetical protein B456_004G225600                    132   5e-33   Gossypium raimondii
ref|XP_008451624.1|  PREDICTED: BTB/POZ domain-containing protein...    132   5e-33   Cucumis melo [Oriental melon]
gb|AAN77296.1|  Hypothetical protein                                    132   6e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74727.1|  hypothetical protein OsI_10455                          132   6e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_002863924.1|  phototropic-responsive NPH3 family protein         132   6e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...    132   6e-33   Glycine max [soybeans]
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...    132   6e-33   Solanum lycopersicum
gb|KFK31290.1|  hypothetical protein AALP_AA6G093300                    132   7e-33   Arabis alpina [alpine rockcress]
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...    132   7e-33   Populus euphratica
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...    132   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_010241873.1|  PREDICTED: BTB/POZ domain-containing protein...    131   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_003604967.1|  BTB/POZ domain-containing protein                  132   7e-33   Medicago truncatula
ref|XP_003600551.1|  Root phototropism protein                          130   7e-33   
ref|XP_010482146.1|  PREDICTED: BTB/POZ domain-containing protein...    131   8e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...    132   8e-33   
ref|XP_010439675.1|  PREDICTED: BTB/POZ domain-containing protein...    131   8e-33   
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...    131   1e-32   
gb|KDO87367.1|  hypothetical protein CISIN_1g038941mg                   131   1e-32   
ref|XP_006479889.1|  PREDICTED: BTB/POZ domain-containing protein...    131   1e-32   
ref|XP_008386633.1|  PREDICTED: BTB/POZ domain-containing protein...    131   1e-32   
dbj|BAJ96209.1|  predicted protein                                      131   1e-32   
gb|KEH31205.1|  phototropic-responsive NPH3 family protein              130   1e-32   
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...    131   1e-32   
gb|KHG21232.1|  hypothetical protein F383_08117                         130   1e-32   
ref|XP_010109730.1|  BTB/POZ domain-containing protein                  130   2e-32   
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein         130   2e-32   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg             130   2e-32   
ref|XP_006281736.1|  hypothetical protein CARUB_v10027892mg             130   2e-32   
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...    130   2e-32   
gb|KJB41980.1|  hypothetical protein B456_007G130600                    130   2e-32   
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg             130   3e-32   
ref|XP_003608415.1|  Root phototropism protein                          130   3e-32   
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...    129   3e-32   
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...    130   3e-32   
emb|CDP03534.1|  unnamed protein product                                130   3e-32   
gb|KDP28100.1|  hypothetical protein JCGZ_13871                         129   3e-32   
ref|XP_009405608.1|  PREDICTED: BTB/POZ domain-containing protein...    130   4e-32   
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...    129   4e-32   
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g             129   4e-32   
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    129   4e-32   
ref|XP_009626458.1|  PREDICTED: BTB/POZ domain-containing protein...    129   4e-32   
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                    129   5e-32   
gb|KHG00255.1|  hypothetical protein F383_19997                         129   5e-32   
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...    129   5e-32   
gb|KJB42465.1|  hypothetical protein B456_007G154300                    129   5e-32   
ref|XP_009776597.1|  PREDICTED: BTB/POZ domain-containing protein...    129   5e-32   
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...    129   5e-32   
ref|XP_010921839.1|  PREDICTED: BTB/POZ domain-containing protein...    130   5e-32   
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...    129   6e-32   
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g             129   7e-32   
ref|XP_006404279.1|  hypothetical protein EUTSA_v10010186mg             129   7e-32   
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...    129   7e-32   
emb|CDX83030.1|  BnaA01g20300D                                          128   8e-32   
gb|KHN43539.1|  BTB/POZ domain-containing protein                       129   8e-32   
emb|CDY30615.1|  BnaAnng03900D                                          127   1e-31   
emb|CDY57361.1|  BnaC08g48680D                                          127   1e-31   
ref|XP_011015142.1|  PREDICTED: BTB/POZ domain-containing protein...    128   1e-31   
ref|XP_006583767.1|  PREDICTED: root phototropism protein 3-like ...    127   1e-31   
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...    128   1e-31   
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...    127   1e-31   
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...    127   1e-31   
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...    127   1e-31   
emb|CAN74119.1|  hypothetical protein VITISV_002050                     130   1e-31   
ref|XP_006479890.1|  PREDICTED: BTB/POZ domain-containing protein...    128   1e-31   
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg                127   2e-31   
ref|XP_010684491.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-31   
ref|XP_007159131.1|  hypothetical protein PHAVU_002G211400g             128   2e-31   
ref|XP_008660160.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-31   
gb|KHN09117.1|  Root phototropism protein 3                             128   2e-31   
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
ref|XP_009626459.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
ref|XP_011033590.1|  PREDICTED: BTB/POZ domain-containing protein...    128   2e-31   
emb|CAN78287.1|  hypothetical protein VITISV_008137                     127   2e-31   
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    127   2e-31   
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
ref|XP_009776604.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
ref|XP_008386634.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-31   
gb|KHN28223.1|  BTB/POZ domain-containing protein                       127   3e-31   
emb|CBI37309.3|  unnamed protein product                                127   3e-31   
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...    127   3e-31   
ref|XP_010069979.1|  PREDICTED: BTB/POZ domain-containing protein...    127   3e-31   
gb|KGN58361.1|  hypothetical protein Csa_3G627720                       127   4e-31   
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                   126   4e-31   
ref|NP_001152299.1|  transposon protein Mutator sub-class               127   4e-31   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...    126   4e-31   
gb|ACL52494.1|  unknown                                                 127   4e-31   
ref|XP_003528390.2|  PREDICTED: root phototropism protein 3-like ...    128   4e-31   
ref|XP_006444252.1|  hypothetical protein CICLE_v10019309mg             127   4e-31   
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560          127   5e-31   
ref|XP_004485981.1|  PREDICTED: BTB/POZ domain-containing protein...    126   5e-31   
ref|XP_010098595.1|  BTB/POZ domain-containing protein                  126   5e-31   
emb|CDY52208.1|  BnaC01g42530D                                          127   5e-31   
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg             126   6e-31   
ref|XP_001769248.1|  predicted protein                                  126   6e-31   
ref|XP_009151299.1|  PREDICTED: BTB/POZ domain-containing protein...    127   6e-31   
ref|XP_011095171.1|  PREDICTED: BTB/POZ domain-containing protein...    126   6e-31   
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750          126   6e-31   
ref|XP_010038174.1|  PREDICTED: BTB/POZ domain-containing protein...    126   7e-31   
ref|XP_004984397.1|  PREDICTED: BTB/POZ domain-containing protein...    127   7e-31   
emb|CDY32491.1|  BnaA09g51050D                                          121   7e-31   
ref|XP_010264099.1|  PREDICTED: BTB/POZ domain-containing protein...    125   7e-31   
ref|XP_010684492.1|  PREDICTED: BTB/POZ domain-containing protein...    126   8e-31   
ref|XP_008776569.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    125   9e-31   
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...    125   9e-31   
ref|XP_011092443.1|  PREDICTED: root phototropism protein 3             126   1e-30   
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...    125   1e-30   
ref|XP_006584970.1|  PREDICTED: root phototropism protein 3-like        126   1e-30   
gb|KHN46271.1|  Root phototropism protein 3                             126   1e-30   
ref|XP_002880327.1|  phototropic-responsive NPH3 family protein         125   1e-30   
ref|XP_002520669.1|  protein binding protein, putative                  125   1e-30   
ref|XP_006846819.1|  hypothetical protein AMTR_s00148p00085230          125   1e-30   
ref|XP_006341291.1|  PREDICTED: BTB/POZ domain-containing protein...    125   1e-30   
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g             125   1e-30   
ref|XP_009631478.1|  PREDICTED: root phototropism protein 3-like        125   2e-30   
ref|XP_010264098.1|  PREDICTED: BTB/POZ domain-containing protein...    125   2e-30   
gb|ADV56692.1|  NPH3 family protein                                     126   2e-30   
gb|KDO42274.1|  hypothetical protein CISIN_1g005842mg                   124   2e-30   
ref|XP_002863056.1|  phototropic-responsive NPH3 family protein         125   2e-30   
ref|NP_182307.1|  phototropic-responsive NPH3 family protein SETH6      125   2e-30   
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...    125   2e-30   
ref|XP_003518959.1|  PREDICTED: BTB/POZ domain-containing protein...    125   2e-30   
ref|XP_009803877.1|  PREDICTED: root phototropism protein 3-like        125   2e-30   
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...    124   3e-30   
ref|XP_006841237.1|  hypothetical protein AMTR_s00135p00069650          125   3e-30   
ref|XP_011015143.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-30   
ref|XP_009419001.1|  PREDICTED: BTB/POZ domain-containing protein...    124   3e-30   
ref|XP_009419048.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-30   
ref|XP_002522618.1|  hypothetical protein RCOM_0884570                  125   3e-30   
ref|XP_010909076.1|  PREDICTED: BTB/POZ domain-containing protein...    125   3e-30   
ref|XP_007033472.1|  Phototropic-responsive NPH3 family protein i...    124   3e-30   
ref|XP_002988207.1|  hypothetical protein SELMODRAFT_183709             124   3e-30   
ref|XP_002963496.1|  hypothetical protein SELMODRAFT_166345             124   3e-30   
ref|XP_011023032.1|  PREDICTED: root phototropism protein 3-like        125   3e-30   
ref|XP_011012727.1|  PREDICTED: root phototropism protein 3-like        125   3e-30   
ref|XP_006363693.1|  PREDICTED: BTB/POZ domain-containing protein...    124   4e-30   
gb|KCW49991.1|  hypothetical protein EUGRSUZ_K03448                     124   4e-30   
ref|XP_002310495.1|  hypothetical protein POPTR_0007s03550g             124   4e-30   
ref|XP_007033473.1|  Phototropic-responsive NPH3 family protein i...    124   5e-30   
ref|XP_010038175.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
gb|KDP40950.1|  hypothetical protein JCGZ_24949                         124   5e-30   
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
ref|XP_008235006.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g             124   5e-30   
ref|XP_004246916.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...    124   5e-30   
ref|XP_004249834.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-30   
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-30   
gb|KDO42273.1|  hypothetical protein CISIN_1g005842mg                   124   6e-30   
ref|XP_006494598.1|  PREDICTED: root phototropism protein 3-like ...    124   6e-30   
ref|XP_006420844.1|  hypothetical protein CICLE_v10004479mg             124   6e-30   
ref|XP_002323684.2|  hypothetical protein POPTR_0016s14670g             123   6e-30   
ref|XP_010507839.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-30   
ref|XP_004504830.1|  PREDICTED: root phototropism protein 3-like ...    124   6e-30   
ref|XP_010518503.1|  PREDICTED: BTB/POZ domain-containing protein...    124   6e-30   
ref|XP_002889431.1|  phototropic-responsive NPH3 family protein         124   7e-30   
ref|XP_004504832.1|  PREDICTED: root phototropism protein 3-like ...    124   7e-30   
ref|XP_009766095.1|  PREDICTED: root phototropism protein 3-like ...    122   8e-30   
ref|XP_009605138.1|  PREDICTED: BTB/POZ domain-containing protein...    123   8e-30   
ref|XP_004504829.1|  PREDICTED: root phototropism protein 3-like ...    124   8e-30   
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...    123   8e-30   
emb|CBI38224.3|  unnamed protein product                                123   9e-30   
ref|XP_009605134.1|  PREDICTED: BTB/POZ domain-containing protein...    123   9e-30   
ref|XP_010545039.1|  PREDICTED: BTB/POZ domain-containing protein...    123   9e-30   
emb|CDY37449.1|  BnaC08g45870D                                          122   1e-29   
ref|XP_010506827.1|  PREDICTED: BTB/POZ domain-containing protein...    123   1e-29   
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...    123   1e-29   
ref|XP_011001651.1|  PREDICTED: BTB/POZ domain-containing protein...    123   1e-29   
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...    123   1e-29   
ref|XP_009775884.1|  PREDICTED: BTB/POZ domain-containing protein...    123   1e-29   
gb|EYU19133.1|  hypothetical protein MIMGU_mgv1a004464mg                122   1e-29   
gb|KDP34960.1|  hypothetical protein JCGZ_09248                         123   1e-29   
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...    123   1e-29   
ref|XP_002465279.1|  hypothetical protein SORBIDRAFT_01g035480          123   1e-29   
ref|XP_003593874.1|  BTB/POZ domain-containing protein                  122   1e-29   
ref|XP_010457308.1|  PREDICTED: BTB/POZ domain-containing protein...    122   1e-29   
ref|XP_010065706.1|  PREDICTED: root phototropism protein 3             123   1e-29   
ref|XP_001764279.1|  predicted protein                                  122   1e-29   
ref|XP_009620326.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-29   
gb|KCW63332.1|  hypothetical protein EUGRSUZ_G00960                     123   2e-29   
emb|CAN60915.1|  hypothetical protein VITISV_002200                     123   2e-29   
gb|KFK42661.1|  hypothetical protein AALP_AA1G023400                    122   2e-29   
gb|KJB79559.1|  hypothetical protein B456_013G057300                    121   2e-29   
ref|XP_010457307.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-29   
ref|XP_004495986.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-29   
ref|XP_002269380.1|  PREDICTED: root phototropism protein 3             123   2e-29   
ref|XP_009119585.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-29   
ref|XP_003593245.1|  Root phototropism protein                          123   2e-29   
emb|CDX89922.1|  BnaA10g01600D                                          122   2e-29   
ref|XP_006351743.1|  PREDICTED: root phototropism protein 3-like        122   2e-29   
ref|XP_006595174.1|  PREDICTED: root phototropism protein 3-like ...    121   2e-29   
ref|XP_008660159.1|  PREDICTED: BTB/POZ domain-containing protein...    122   2e-29   
ref|XP_006595180.1|  PREDICTED: root phototropism protein 3-like ...    121   2e-29   
ref|XP_006418277.1|  hypothetical protein EUTSA_v10007049mg             122   2e-29   
ref|XP_011014242.1|  PREDICTED: root phototropism protein 3-like ...    122   2e-29   
ref|XP_009118726.1|  PREDICTED: BTB/POZ domain-containing protein...    121   3e-29   
ref|XP_010457305.1|  PREDICTED: BTB/POZ domain-containing protein...    122   3e-29   
ref|XP_004230550.1|  PREDICTED: root phototropism protein 3-like        122   3e-29   
emb|CDO97399.1|  unnamed protein product                                122   3e-29   
ref|XP_009766094.1|  PREDICTED: root phototropism protein 3-like ...    122   3e-29   
gb|KHN31896.1|  Root phototropism protein 3                             121   3e-29   
emb|CDY18140.1|  BnaC05g01630D                                          122   3e-29   
gb|KJB10961.1|  hypothetical protein B456_001G234000                    120   3e-29   
ref|XP_002526612.1|  Root phototropism protein, putative                122   3e-29   
ref|XP_006354400.1|  PREDICTED: BTB/POZ domain-containing protein...    121   3e-29   
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg             122   4e-29   
ref|NP_171800.1|  phototropic-responsive NPH3 family protein            121   4e-29   
ref|XP_009118723.1|  PREDICTED: BTB/POZ domain-containing protein...    121   4e-29   
ref|XP_009608450.1|  PREDICTED: root phototropism protein 3 isofo...    120   4e-29   
ref|XP_011014241.1|  PREDICTED: root phototropism protein 3-like ...    122   4e-29   
gb|KHG29755.1|  Root phototropism 3 -like protein                       122   4e-29   
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...    121   4e-29   
emb|CDY32492.1|  BnaA09g51040D                                          121   4e-29   
gb|KHG15697.1|  hypothetical protein F383_22812                         121   4e-29   
emb|CAN72130.1|  hypothetical protein VITISV_002335                     122   5e-29   
gb|KHN03742.1|  BTB/POZ domain-containing protein                       121   5e-29   
gb|KJB79558.1|  hypothetical protein B456_013G057300                    121   5e-29   
gb|KJB35735.1|  hypothetical protein B456_006G125900                    121   5e-29   
ref|XP_007200957.1|  hypothetical protein PRUPE_ppa002411mg             122   5e-29   
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...    121   5e-29   
ref|XP_003536250.1|  PREDICTED: BTB/POZ domain-containing protein...    121   5e-29   
ref|XP_002531804.1|  Root phototropism protein, putative                121   5e-29   
gb|KEH43247.1|  phototropic-responsive NPH3 family protein              121   5e-29   
ref|XP_010094827.1|  Root phototropism protein 3                        121   5e-29   
ref|XP_004248794.1|  PREDICTED: root phototropism protein 3-like        121   5e-29   
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...    121   5e-29   
ref|XP_007015158.1|  BZIP domain class transcription factor             121   5e-29   
gb|EMT31899.1|  BTB/POZ domain-containing protein                       119   6e-29   
gb|KHN33549.1|  Root phototropism protein 3                             121   6e-29   
ref|XP_006594679.1|  PREDICTED: root phototropism protein 3-like        121   6e-29   
ref|XP_003545709.1|  PREDICTED: root phototropism protein 3-like        121   7e-29   
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g             120   7e-29   
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...    120   8e-29   
gb|KHN19000.1|  Root phototropism protein 3                             121   8e-29   



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + ++RLSLAMERTGQWVFSQEIPTDV+VEVG+A+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MASPLVNNSSRLSLAMERTGQWVFSQEIPTDVLVEVGKATFSLHKFMLVAKSNCIRKLIL  60

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESKEADLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  121  NLAGRTEDFLSQ  132



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  120  NLAGRTEDFLSQ  131



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL+S  +RLS AMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  120  NLAGRTEDFLSQ  131



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            A RLSLAMERTGQWVFSQEIPTDVIVEVGEA+FSLHKFMLVAKSN+IRKLI+DSKEADLT
Sbjct  2    ANRLSLAMERTGQWVFSQEIPTDVIVEVGEANFSLHKFMLVAKSNHIRKLILDSKEADLT  61

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED
Sbjct  62   RIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  121

Query  425  FLSQ  436
            FLSQ
Sbjct  122  FLSQ  125



>ref|XP_008358916.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=175

 Score =   237 bits (605),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLTGRTEDFLSQ  131



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLA RTEDFL+Q
Sbjct  120  NLASRTEDFLAQ  131



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PLK+   RLSLAMERTGQWVFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            D+KE+D++RINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   DTKESDVSRINLSDIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLA RTEDFL+Q
Sbjct  120  NLASRTEDFLAQ  131



>emb|CBI15801.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   233 bits (593),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            MERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKEADLT I+LS I
Sbjct  1    MERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKEADLTNIDLSDI  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            PGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD NL+GRTEDFL Q
Sbjct  61   PGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDGNLSGRTEDFLKQ  117



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 126/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAAPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLA RTEDFL+Q
Sbjct  120  NLASRTEDFLAQ  131



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            A R +LAMERTGQWVFSQE+PTDVIVEVGEASFSLHKFMLVAKSN IRKLI+DSKEADLT
Sbjct  2    ANRHNLAMERTGQWVFSQEVPTDVIVEVGEASFSLHKFMLVAKSNLIRKLILDSKEADLT  61

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            RINLSGIPGG EIFE++AKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDNNLAGRTED
Sbjct  62   RINLSGIPGGAEIFEKSAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDNNLAGRTED  121

Query  425  FLSQ  436
            FLSQ
Sbjct  122  FLSQ  125



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 126/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P++ A  RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFML+AKSNYIRKLI+
Sbjct  1    MATPVR-ANERLSIAMERTGQWVFSQEIPTDVVVRVGEANFSLHKFMLLAKSNYIRKLII  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++KEADL RI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD+YCDN
Sbjct  60   ETKEADLARIDLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDQYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRT+DFL+Q
Sbjct  120  NLAGRTDDFLTQ  131



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA P+K+   RLSLAMERTGQWVFSQEIPTDV+VEVGEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MAVPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE ++TRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAA+YLQMTDKYCDN
Sbjct  60   ESKETEVTRINLSEIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAADYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLA RTEDFL+Q
Sbjct  120  NLASRTEDFLAQ  131



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P+ S  +R+S AMERTGQWVFSQEIPTDV+VE GEA+F+LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPVMSN-SRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFMLVAKSNYIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++KEADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD+
Sbjct  60   ETKEADLTRINLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDNYCDS  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  120  NLAGRTEDFLSQ  131



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ LK    R SLAMERTGQWVFSQEIPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MAASLK-GNNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD 
Sbjct  60   ESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDG  119

Query  401  NLAGRTEDFLSQ  436
            NL+GRTEDFL Q
Sbjct  120  NLSGRTEDFLKQ  131



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL++  +RLS+AMERTGQWVFSQEIPTDV+V VGEA+FSLHKFMLV+KSN IRKLIM
Sbjct  1    MATPLRNN-SRLSIAMERTGQWVFSQEIPTDVVVVVGEANFSLHKFMLVSKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDLYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRT+DFLSQ
Sbjct  120  NLAGRTDDFLSQ  131



>gb|AAB63085.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score =   229 bits (583),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLTGRTEDFLSQ  131



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLTGRTEDFLSQ  131



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKKPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTEKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLTGRTEDFLSQ  131



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL + + RLSLAMERTGQW+FSQ+IP+DV+V+VGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS +PGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MT+KYCDN
Sbjct  60   ESKQPDLTRIDLSDVPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTNKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLIGRTEDFLSQ  131



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ +K   +RLSLAMERTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MAASVK-GNSRLSLAMERTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIV  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAE+LQM +KYC N
Sbjct  60   ESNEPDLTRINLSNIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMIEKYCPN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFL+Q
Sbjct  120  NLAGRTEDFLTQ  131



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  118  NLAGRTEDFLSQ  129



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+PL     R S A ERTGQWVFSQEIPTD++V VGEA+F LHKFMLVAKSNYIRKLI+
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFMLVAKSNYIRKLII  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRCAAE+LQMTDKYC+N
Sbjct  58   ESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRCAAEFLQMTDKYCEN  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  118  NLAGRTEDFLSQ  129



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS  ++ + RLS+AMERTGQW+FSQ+IP DV+VEVGEA+FSLHKFMLVAKSN IR+LI+
Sbjct  1    MASLAQNNSRRLSIAMERTGQWIFSQDIPADVVVEVGEANFSLHKFMLVAKSNRIRQLIL  60

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  61   ESDEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  120

Query  401  NLAGRTEDFLSQ  436
            NL+GRTEDFL+Q
Sbjct  121  NLSGRTEDFLTQ  132



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRINLS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKYC+N
Sbjct  60   ESKQPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYCEN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFL+Q
Sbjct  120  NLTGRTEDFLAQ  131



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLVGRTEDFLSQ  131



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM
Sbjct  1    MSSSMK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN
Sbjct  60   ESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFLSQ
Sbjct  120  NLIGRTEDFLSQ  131



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFL+Q
Sbjct  120  NLTGRTEDFLTQ  131



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFL+Q
Sbjct  120  NLTGRTEDFLTQ  131



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +K   +RLS+AMERTGQW+FSQEIP+DV+VEVGEA+FSLHKFMLVAKSN+IRKL++
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFMLVAKSNHIRKLVL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E DLTRINLS IPGGPE FE+AAKFCYGVNFEITV NVAALRCAAEYL+MTDKYCDN
Sbjct  60   ESTEPDLTRINLSDIPGGPETFEKAAKFCYGVNFEITVQNVAALRCAAEYLEMTDKYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFL+Q
Sbjct  120  NLTGRTEDFLTQ  131



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            +M+S +K    R+S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLI
Sbjct  84   SMSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLI  142

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
            M+S EADLTRI+L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD
Sbjct  143  MESTEADLTRIDLTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  202

Query  398  NNLAGRTEDFLSQ  436
            NNL GRTEDFLSQ
Sbjct  203  NNLVGRTEDFLSQ  215



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S+AMERTGQW+FSQ+IPTDV+V VGEA F LHKFMLVAKSNYIRKLIM+S EADLTRI+
Sbjct  1    MSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFMLVAKSNYIRKLIMESTEADLTRID  60

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L+ IPGG EIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL GRTEDFLS
Sbjct  61   LTDIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLIGRTEDFLS  120

Query  434  Q  436
            Q
Sbjct  121  Q  121



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 3/136 (2%)
 Frame = +2

Query  38   NMASPLKSAAT---RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIR  208
            N   P K  AT   RLSLAMERTGQWVFSQ+IPTDVIVEVGE +FSLHKFMLVAKSNYIR
Sbjct  27   NQNKPHKFMATPNNRLSLAMERTGQWVFSQDIPTDVIVEVGETTFSLHKFMLVAKSNYIR  86

Query  209  KLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDK  388
            KLI++S E++LTRI+LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+
Sbjct  87   KLILESDESELTRIDLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQ  146

Query  389  YCDNNLAGRTEDFLSQ  436
            YC+NNLAGRTE+FL+Q
Sbjct  147  YCENNLAGRTEEFLTQ  162



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASPL S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+F LHKFMLVAKSN IRKLIM
Sbjct  1    MASPL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFPLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCA EYL+MTDKYC+N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCATEYLEMTDKYCNN  119

Query  401  NLAGRTEDFLSQ  436
            NL  RTEDFL+Q
Sbjct  120  NLTSRTEDFLTQ  131



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 4/130 (3%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDFL  430
            NLAGRTE+FL
Sbjct  117  NLAGRTEEFL  126



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS L S   RLSLAMERTGQW+ SQ+IP+DV+VEVGEA+FSLHKFMLVAKSN IRKLIM
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFMLVAKSNRIRKLIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ DLTRI+LS IPGGPE FE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDKY +N
Sbjct  60   ESKQPDLTRIDLSDIPGGPETFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKYYEN  119

Query  401  NLAGRTEDFLSQ  436
            NL GRTEDFL+Q
Sbjct  120  NLTGRTEDFLAQ  131



>ref|XP_006410156.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
 gb|ESQ51609.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
Length=412

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 4/132 (3%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQW+FSQEIPTDVIVEVGEA FSLHKFMLVAKSNYIRKLIM
Sbjct  1    MATP----PNRLSLAMERTGQWIFSQEIPTDVIVEVGEACFSLHKFMLVAKSNYIRKLIM  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +++E +LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDN
Sbjct  57   EAEETELTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDN  116

Query  401  NLAGRTEDFLSQ  436
            NLAGRT++FLS+
Sbjct  117  NLAGRTDEFLSK  128



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHKFML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKFMLLAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RI+LSGIPGGPEIF +AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELARIDLSGIPGGPEIFVKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDTYCDN  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDF +Q
Sbjct  118  NLAGRTEDFFAQ  129



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SKE+D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKESDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  431  SQ  436
            S+
Sbjct  127  SK  128



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/121 (85%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDVIVEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLARTGQWVFSQDIPTDVIVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 122/133 (92%), Gaps = 1/133 (1%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            +MA+P++S  +RLSL MERT +WVFSQ+IPTDV+V V EA+FSLHKFMLVAKSNYIRKLI
Sbjct  17   DMATPVRSN-SRLSLTMERTDRWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNYIRKLI  75

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
            ++SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD
Sbjct  76   LESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCD  135

Query  398  NNLAGRTEDFLSQ  436
             NLAGRTEDFL+Q
Sbjct  136  YNLAGRTEDFLAQ  148



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCDN
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDLYCDN  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDF +Q
Sbjct  118  NLAGRTEDFFAQ  129



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 117/132 (89%), Gaps = 4/132 (3%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE  FSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S E +LTRI LS IPGGP IFE+ AKFCYGVNFEITVHNVA LRCAAE+LQMTD+YC+N
Sbjct  57   ESNEGELTRIYLSDIPGGPSIFEKTAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDFLSQ  436
            NLAGRTE+FL+Q
Sbjct  117  NLAGRTEEFLTQ  128



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P++S  +RLSLAMERT QWVFSQ+IPTDV+V V EA+FSLHKFMLVAKSN IRKLI+
Sbjct  1    MATPVRSN-SRLSLAMERTDQWVFSQDIPTDVVVVVCEATFSLHKFMLVAKSNCIRKLIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE  LT+I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  60   ESKEPALTKIDLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDVYCDY  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFL+Q
Sbjct  120  NLAGRTEDFLAQ  131



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+ +K++ +R+SLAMERTGQWVFSQEIP+DV++E+GEA+F+LHKFMLVAKS YIR+ IM
Sbjct  1    MATTVKNS-SRVSLAMERTGQWVFSQEIPSDVVIEIGEANFALHKFMLVAKSGYIRRKIM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE DLTRI+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRCAAEYL+MTDK  ++
Sbjct  60   ESKEPDLTRIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLEMTDKCSES  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLS 
Sbjct  120  NLAGRTEDFLSH  131



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            RLSLAMERTGQWVFSQE+PTDVIVEVGEA F LHKFMLVAKSNYIRKLIM+S E  LTRI
Sbjct  7    RLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFMLVAKSNYIRKLIMESDETHLTRI  66

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            +LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRCAAE+LQMTD+YCDNNLAGRT++FL
Sbjct  67   DLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRCAAEFLQMTDQYCDNNLAGRTDEFL  126

Query  431  SQ  436
            S+
Sbjct  127  SK  128



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MASP++S   RLSLAMERTG+WVFS++IPTDV+V V EASFSLHK ML+AKSNYIRKLI 
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSMLMAKSNYIRKLIF  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKE +L RINLSGIPGGPEIF +AAKFCYG NFEITVHNVAALRCAAEYLQMTD YCD 
Sbjct  58   ESKEPELDRINLSGIPGGPEIFVKAAKFCYGFNFEITVHNVAALRCAAEYLQMTDVYCDY  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFL+Q
Sbjct  118  NLAGRTEDFLAQ  129



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S ++ RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRIN
Sbjct  14   MSSSLARTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRIN  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPG PEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGDPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK+ D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDIDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +S IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   ISDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLI++SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIIESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
            A+ERTGQWVFSQEIPTD++++VGEA+FSLHKFMLVAKSNYIR+LI++SKE+DL R++L+ 
Sbjct  23   ALERTGQWVFSQEIPTDIVIQVGEAAFSLHKFMLVAKSNYIRRLILESKESDLGRLDLTD  82

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            IPGGPEIFE+AAKFCYGVNFEIT+HNVAALRCAAEYLQMTDK CDNNLA RTEDFL Q
Sbjct  83   IPGGPEIFEKAAKFCYGVNFEITIHNVAALRCAAEYLQMTDKSCDNNLANRTEDFLCQ  140



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGGPEIFE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYC+NNLAGRT+DFLS
Sbjct  74   LSDMPGGPEIFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCNNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 4/132 (3%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P      RLSLAMERTGQWVFSQ+IPTDVIVEVGE SFSLHKFMLVAKSNYIRKLI+
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETSFSLHKFMLVAKSNYIRKLIL  56

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ E ++TRI+LS IPGGP IFE+ AKFCYGVNFEITV+NVA LRCAAE+LQMTD+YC+N
Sbjct  57   EANENEVTRIDLSDIPGGPAIFEKTAKFCYGVNFEITVNNVAVLRCAAEFLQMTDQYCEN  116

Query  401  NLAGRTEDFLSQ  436
            NL GRTE+FL+Q
Sbjct  117  NLTGRTEEFLTQ  128



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AMERT QWVFSQ+IPTDV+VEV EA+FSLHKFMLVAKSNYIRKLIM+SK+ DLTRI+
Sbjct  12   MSSAMERTDQWVFSQDIPTDVVVEVCEANFSLHKFMLVAKSNYIRKLIMESKDTDLTRID  71

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTDKYCD+NLAGRT+DFLS
Sbjct  72   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDKYCDSNLAGRTQDFLS  131

Query  434  Q  436
            Q
Sbjct  132  Q  132



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S  ++RTGQWVFSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSTLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGRT+DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRTQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            VFSQEIPTDVIVEVGEA+F+LHKFMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIF
Sbjct  6    VFSQEIPTDVIVEVGEANFNLHKFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIF  65

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            E+AAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ
Sbjct  66   EKAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  115



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 116/132 (88%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VGE++FSLHKF+L AKSNYIRK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGESTFSLHKFILAAKSNYIRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISNIPGGQEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  118  NLAGRTEDFLSQ  129



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P     TR SLAMERTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI +S IPGG E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIEISDIPGGSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  118  NLAGRTEDFLSQ  129



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  68   TRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTR  247
            +RLSLAMERTGQW+FSQEIP+DVIV +GEA++SLHKFMLVAKSNYIRKLIM+S E++LTR
Sbjct  7    SRLSLAMERTGQWIFSQEIPSDVIVTIGEATYSLHKFMLVAKSNYIRKLIMESNESELTR  66

Query  248  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  427
            ++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMTD+YCD NLAGRTE F
Sbjct  67   LDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHCAAMFLQMTDEYCDGNLAGRTEGF  126

Query  428  LSQ  436
            LSQ
Sbjct  127  LSQ  129



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 3/132 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MA+P   + TRLSLAMERTGQW+FS EIPTDVIV VGEA+FSLHKF+L AKSN IRK+IM
Sbjct  1    MATP---SPTRLSLAMERTGQWIFSPEIPTDVIVAVGEANFSLHKFILAAKSNSIRKVIM  57

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +S+E+DLTRI+L+ IPGG E FE+  KFCYGVNFEITVHNVA L CAA +LQMTD+YCD 
Sbjct  58   ESEESDLTRIDLTNIPGGQEAFEKVVKFCYGVNFEITVHNVAPLHCAAVFLQMTDEYCDG  117

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFLSQ
Sbjct  118  NLAGRTEDFLSQ  129



>gb|ABI34691.1| bZIP transcription factor bZIP84 [Glycine max]
Length=183

 Score =   202 bits (515),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +2

Query  92   RTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPG  271
            RTGQWVFS EIPTDVIV VG+ +FSLHKF+L AKSNY+RK+IM+S+E+DLTRI +S IPG
Sbjct  1    RTGQWVFSPEIPTDVIVAVGQTNFSLHKFILAAKSNYVRKVIMESEESDLTRIEISDIPG  60

Query  272  GPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            G E FE+AAKFCYGVNFEITVHNVAAL CAA +LQMTD+YCD NLAGRTEDFLSQ
Sbjct  61   GSEAFEKAAKFCYGVNFEITVHNVAALHCAAVFLQMTDEYCDGNLAGRTEDFLSQ  115



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            M +P+K  +  +SLAMER GQWVFSQE+PTDV+VEVGE SFSLHKFMLV KSN+IR+LI+
Sbjct  1    MPNPIKHNSN-ISLAMERAGQWVFSQELPTDVVVEVGEMSFSLHKFMLVGKSNHIRELIL  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SK+ D  RI+LSG+PGG E FE  A FCYG NFEITVHNVAALRCAAEYLQMTD YC N
Sbjct  60   ESKDVDCARIDLSGVPGGAETFETVANFCYGFNFEITVHNVAALRCAAEYLQMTDSYCKN  119

Query  401  NLAGRTEDFLSQ  436
            + AGRTEDFLSQ
Sbjct  120  SFAGRTEDFLSQ  131



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  59   SAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            S   RLSLAMERTG+WVFSQEIPTDV+VEVGEA+FSLHKFMLVAKS YIRKLIM+SKEAD
Sbjct  4    STKNRLSLAMERTGKWVFSQEIPTDVVVEVGEANFSLHKFMLVAKSGYIRKLIMESKEAD  63

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            L+RI L  IPGGPE FE+AAKFCYG +FEITV NVAAL CAAEYL+M++KYC+ NL  R 
Sbjct  64   LSRIELPDIPGGPETFEKAAKFCYGASFEITVKNVAALLCAAEYLEMSEKYCEGNLISRA  123

Query  419  EDFL  430
            EDFL
Sbjct  124  EDFL  127



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S +++RTGQ  FSQ+IPTDV+VEVGEA+FSLHKFMLVAKSNYIRKLIM+SK++D+TRI+
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFMLVAKSNYIRKLIMESKDSDVTRID  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGG E+FE+AAKFCYGV+FEITV NVAAL+CAAE+LQMTDKYCDNNLAGR +DFLS
Sbjct  74   LSDIPGGAEMFEKAAKFCYGVSFEITVQNVAALQCAAEFLQMTDKYCDNNLAGRIQDFLS  133

Query  434  Q  436
            Q
Sbjct  134  Q  134



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            ++RLSLAMERTGQW+ SQE+P+DVIV VGEAS+SLHKFMLVAKSNYIRKLI++S +++LT
Sbjct  6    SSRLSLAMERTGQWISSQELPSDVIVTVGEASYSLHKFMLVAKSNYIRKLIIESNDSELT  65

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
            RI+LS IPGG E FE+AAKFCYGVNFEITV+NVA+L CAA +LQMT++YCD NLAGRTE 
Sbjct  66   RIDLSDIPGGKEAFEKAAKFCYGVNFEITVNNVASLHCAALFLQMTEEYCDGNLAGRTEG  125

Query  425  FLSQ  436
            FLSQ
Sbjct  126  FLSQ  129



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFL Q
Sbjct  120  NLAGRTEDFLVQ  131



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  41   MASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            MAS +KS     S+AMERT QW+ S++ PTDV V V +A+FSLHKFMLVAKSNY+RK++M
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFMLVAKSNYMRKMVM  59

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            +SKEADLTRI+LS  PGGPEIFE+AA FCY ++FEITV NVAALRCAAEYL+MTD+YCDN
Sbjct  60   ESKEADLTRIDLSDFPGGPEIFEKAANFCYNIDFEITVKNVAALRCAAEYLEMTDQYCDN  119

Query  401  NLAGRTEDFLSQ  436
            NLAGRTEDFL Q
Sbjct  120  NLAGRTEDFLVQ  131



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            + +AMERT QWV SQ+ P DV+V+V EASFSLHKF+LV KSNYIRKLIM+SK+ DLT I+
Sbjct  10   MDMAMERTDQWVSSQDTPADVVVDVCEASFSLHKFLLVGKSNYIRKLIMESKDTDLTIID  69

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS IPGGPE+FE+AAKFCYGVNFEITV NVAAL CAAE+LQMTD+YC++NLA RT DFLS
Sbjct  70   LSDIPGGPEMFEKAAKFCYGVNFEITVQNVAALHCAAEFLQMTDEYCESNLASRTLDFLS  129

Query  434  Q  436
            Q
Sbjct  130  Q  130



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +2

Query  62   AATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE-AD  238
            A  RLS AMERTGQWV SQ+IPTDV+V VG A FSLHKF L+AKSN +R LI++S+E +D
Sbjct  2    ADDRLSHAMERTGQWVLSQQIPTDVVVAVGTARFSLHKFTLIAKSNLLRTLILESEELSD  61

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
             T I+LS IPGG EIFERAAKFCYGVNFEITV+NVAALRCAAEYLQMT    D  L GRT
Sbjct  62   PTTIDLSEIPGGSEIFERAAKFCYGVNFEITVNNVAALRCAAEYLQMT----DGTLGGRT  117

Query  419  EDFLSQ  436
            EDFLS+
Sbjct  118  EDFLSK  123



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFS-QEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            L  A ERTGQWV S Q+IPTD+I+ VG+ SF LHKFMLVAKS YIR+ IMDS   ++ RI
Sbjct  10   LPSATERTGQWVPSDQDIPTDIIIHVGDVSFPLHKFMLVAKSGYIRRKIMDSDRTNVARI  69

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            +LS +PGG E FE+AAKFCYGVNFEI+V+NV ALRCAAEYL+MT+KYC+ NL GRTE+FL
Sbjct  70   DLSEVPGGVEAFEKAAKFCYGVNFEISVYNVVALRCAAEYLEMTEKYCEGNLEGRTEEFL  129

Query  431  SQ  436
            +Q
Sbjct  130  AQ  131



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  59   SAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            + ++RL  AME+T QWV SQ+IP+D+IV+VG+ +F LHKFMLVA S YIR+ +M+S+ A+
Sbjct  5    TPSSRLCAAMEKTSQWVLSQDIPSDIIVQVGDDTFRLHKFMLVANSGYIRRKVMESERAN  64

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            L  I+LS +PGG E+FE+AAKFCYG+NFEI+VHNV ALRCAAEYLQMT+ Y   NLA R 
Sbjct  65   LGCIDLSDVPGGAEVFEKAAKFCYGMNFEISVHNVTALRCAAEYLQMTEDYSRGNLAERA  124

Query  419  EDFLSQ  436
            E+F++Q
Sbjct  125  EEFINQ  130



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  173  KFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAAL  352
            +FMLVAKSNYIRKLIM++ EADLTRINLS IPGGPEIFE+AAKFCYGVNFEITVHNVAAL
Sbjct  2    QFMLVAKSNYIRKLIMETNEADLTRINLSEIPGGPEIFEKAAKFCYGVNFEITVHNVAAL  61

Query  353  RCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            RCAAEYLQMTDKYCDNNLAGRTEDFLSQ
Sbjct  62   RCAAEYLQMTDKYCDNNLAGRTEDFLSQ  89



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  65   ATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLT  244
            ++RLS AME T  W FSQ+IP+D++V++G+A+F LHKF+L AKS YIR+ +M+S+ A+L+
Sbjct  10   SSRLSAAMETTSHWDFSQDIPSDIVVQIGDATFQLHKFVLAAKSGYIRRKVMESESANLS  69

Query  245  RINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTED  424
             I+LS +  G E+FER AKFCYGVNFEI+V NVAALRCAAEYLQMT++YC  NLA RTE+
Sbjct  70   CIDLSDLSIGAEVFERVAKFCYGVNFEISVRNVAALRCAAEYLQMTEEYCRGNLAARTEE  129

Query  425  FLSQ  436
            F++Q
Sbjct  130  FINQ  133



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AAE+LQMTDKYC+NNLAGRTEDFLSQ
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQ  86



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLI++SKEADLTRINLS IPGGPE+FE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIIESKEADLTRINLSNIPGGPEMFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AAE+LQMTDKYC+NNLAGRTEDFLSQ
Sbjct  61   AAEFLQMTDKYCENNLAGRTEDFLSQ  86



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/86 (91%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+SKEADLT I+LS IPGGPEIFE+AAKFCYGVNFEITVHNVAALRC
Sbjct  1    MLVAKSNYIRKLIMESKEADLTNIDLSDIPGGPEIFEKAAKFCYGVNFEITVHNVAALRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AAEYLQMTDKYCD NL+GRTEDFL Q
Sbjct  61   AAEYLQMTDKYCDGNLSGRTEDFLKQ  86



>gb|KGN61975.1| hypothetical protein Csa_2G277660 [Cucumis sativus]
Length=299

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFLSQ  436
               NL GRTE ++++
Sbjct  130  AVGNLVGRTEAYINE  144



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGE SFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVNVQVGEDSFSLHKFPLVSKCGYIRKLVSESNDADVSSIE  82

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  83   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  142

Query  434  Q  436
            +
Sbjct  143  E  143



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+SK++D+TRINLS IPGGPEIFE+AAKFCYGVNFEITV NVAAL C
Sbjct  1    MLVAKSNYIRKLIMESKDSDVTRINLSDIPGGPEIFEKAAKFCYGVNFEITVQNVAALHC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AAE+LQMTDKYCDNNLAGRT+DFLSQ
Sbjct  61   AAEFLQMTDKYCDNNLAGRTQDFLSQ  86



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  143



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            L S+++RL  AMERTGQW+ SQ+I TD+I+++G+ SF LHKF+LVAKS YIR+ IMDS  
Sbjct  3    LSSSSSRLPSAMERTGQWILSQDIQTDIIIDIGDVSFPLHKFILVAKSGYIRRKIMDS--  60

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
             D  RINLS +PGG E FE+AAKFCYGVNFEI+VHNV  LRCAAEYL+MT++YC+ NLAG
Sbjct  61   -DDGRINLSEVPGGVEAFEKAAKFCYGVNFEISVHNVVVLRCAAEYLEMTERYCEGNLAG  119

Query  413  RTEDFLSQ  436
            RTE+FL+Q
Sbjct  120  RTEEFLAQ  127



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGNLVGRTDAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
             S AMERT +W+FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + 
Sbjct  9    FSTAMERTSEWIFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L+
Sbjct  69   LPDVPGGEEAFELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLN  128

Query  434  Q  436
            +
Sbjct  129  E  129



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+ +S +ADL  + 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVNAGGTSFSLHKFPLVSKCGYIRKLVTESTDADLAVVE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +   PGGPE FE AA FCYG+NFEIT  N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  69   IPDFPGGPEGFELAANFCYGINFEITTENIATLRCAAEYLEMTEEYSVGNLVGRTESYVN  128

Query  434  Q  436
            +
Sbjct  129  E  129



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS A++RT +W+FSQEIP+DV ++VG  SFSLHKF LV+K  YIRKL+ +S ++DL+ I 
Sbjct  24   LSTALKRTSEWIFSQEIPSDVTIDVGGVSFSLHKFPLVSKCGYIRKLVSESNDSDLSIIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L+ IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LADIPGGAEAFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVGRTDAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+ +S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSESSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS Y+RK++ +S +AD + I 
Sbjct  23   LSTAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGYVRKVVTESNDADHSIIE  82

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L+
Sbjct  83   IPNVPGGADSFELAAKFCYGINFEISSENIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLN  142

Query  434  Q  436
            +
Sbjct  143  E  143



>gb|KDO78973.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=457

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFLSQ  436
               NL GRTE ++++
Sbjct  130  AVGNLVGRTEAYINE  144



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL+ I +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SESSDADLSVIEVHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSV  131

Query  398  NNLAGRTEDFLSQ  436
             NL GR E +L++
Sbjct  132  GNLVGRAEAYLNE  144



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  434  Q  436
            +
Sbjct  129  E  129



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHKF LV+K  YIRKL+ +S +AD++ I 
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPLVSKCGYIRKLVSESNDADVSFIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NFEI V N+A L C AEYL+MT+ Y   NL GRT+ +L+
Sbjct  84   LPDVPGGAEAFELAAKFCYGINFEINVENIATLCCVAEYLEMTEDYSVGNLMGRTDAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +ADL  + 
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTDADLATVE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  81   LPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVGRTEAYIN  140

Query  434  Q  436
            +
Sbjct  141  E  141



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRKL+ +S +ADL  + 
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRKLVSESTDADLATVE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y   NL GRTE +++
Sbjct  81   LPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEYAVGNLVGRTEAYIN  140

Query  434  Q  436
            +
Sbjct  141  E  141



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V+VG ASFSLHKF LV+K  +IRK++
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPLVSKCGFIRKVV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +AD++ I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y  
Sbjct  72   SESNDADVSVIEIPDVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAV  131

Query  398  NNLAGRTEDFLSQ  436
             NL GRTE +L++
Sbjct  132  GNLVGRTEAYLNE  144



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  GE SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPLVSKCGYIRKLVSESSDADLSVIE  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  69   VHDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYSVGNLVGRAEAYLN  128

Query  434  Q  436
            +
Sbjct  129  E  129



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+D+ V  G  SFSLHKF LV+K  YIRKL+ +S +ADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDITVNAGGTSFSLHKFPLVSKCGYIRKLVSESSDADLSAIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEISTENIARLRCVAEYLEMTEDYAVGNLVGRTEAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V VG  SFSLHKF LV+K  YIRKL+  S EADL+ I 
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPLVSKCGYIRKLVSVSSEADLSVIE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   NVA LRC AEYL+MT+ Y   NL GR E +L+
Sbjct  84   IPDVPGGAEAFELAAKFCYGINFEINTENVAGLRCVAEYLEMTEDYAVGNLVGRAEAYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 2/135 (1%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRK  211
             ++S L  +A +  LS AM+RT +W+FSQEIP+DV V VGEASFSLHKF LV+K  +IRK
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPLVSKCGHIRK  69

Query  212  LIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKY  391
            L+ +S +ADL  + L   PGG E FE AA FCYG+NFEI   N+A LRCAAEYL+MT++Y
Sbjct  70   LVSESTDADLATVELPNCPGGAEAFELAAMFCYGINFEIGTENIAMLRCAAEYLEMTEEY  129

Query  392  CDNNLAGRTEDFLSQ  436
               NL GRTE ++++
Sbjct  130  AVGNLVGRTEAYINE  144



>gb|KJB48680.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=447

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  413  RTEDFLSQ  436
            RTE +L++
Sbjct  136  RTEAYLNE  143



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +
Sbjct  10   STAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKI  69

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
              +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++
Sbjct  70   PNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNE  129



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +ADL+ I 
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSDADLSEIK  67

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  68   IPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAAGNLVSRTDAYLN  127

Query  434  Q  436
            +
Sbjct  128  E  128



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRK++ +S +ADL+ I 
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKMVSESSDADLSEIK  67

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  68   IPNVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLN  127

Query  434  Q  436
            +
Sbjct  128  E  128



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSTVE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  434  Q  436
            +
Sbjct  141  E  141



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  MERT  W+FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I 
Sbjct  21   LSTVMERTSAWIFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIE  80

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L GIPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L 
Sbjct  81   LVGIPGGAEAFELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLK  140

Query  434  Q  436
            +
Sbjct  141  E  141



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            + S    LS AM+RT +W+FSQEIP+DV V+VG  SFSLHKF L++KS ++RK++ +S +
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPLISKSGFVRKVVSESND  75

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
            AD + I +  +PGG + FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL G
Sbjct  76   ADHSIIEIPNVPGGADSFELAAKFCYGINFEISTENIAMLRCAAEYLEMTEDYAVGNLVG  135

Query  413  RTEDFLSQ  436
            RTE +L++
Sbjct  136  RTEAYLNE  143



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G ++FSLHKF LV+KS YIRK+I +S +AD++ + 
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPLVSKSGYIRKIISESNDADVSIVE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG + FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  86   IPDIPGGSDAFELAAKFCYGINFEISTENIALLRCTAEYLEMTEDYAVGNLVGRTEAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DVIV  G   FSLHKF LV+K  YIRKL+
Sbjct  16   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVIVHAGGTPFSLHKFPLVSKCGYIRKLV  72

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL+ I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT++   
Sbjct  73   SESNDADLSEIEVPDIPGGAEAFELAAKFCYGINFEISTENIAMLRCGAEYLGMTEECAI  132

Query  398  NNLAGRTEDFLSQ  436
             NL GRTE +L++
Sbjct  133  GNLVGRTEAYLNE  145



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V++GE+SF+LHK+ LV+K  YIRKL+ +S ++D++ + 
Sbjct  24   LSSAMKRTSDWIFSQEIPSDVNVQIGESSFTLHKYPLVSKCGYIRKLVSESNDSDVSFVE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            LS +PGG E FE AAKFCYG+NFEI V N+A LRC AEYL+MT+ Y   NL  RT+ +L+
Sbjct  84   LSDVPGGAEAFELAAKFCYGINFEINVENIAMLRCVAEYLEMTEDYSVGNLVARTDAYLN  143



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKL+ +S +AD++ IN
Sbjct  9    LSSAMKRTSDWIFSQEIPSDVTVNAGGTSFALHKFPLVSKSGYIRKLVSESNDADVSTIN  68

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL  RTE + +
Sbjct  69   IPDIPGGGEAFELAAKFCYGINFEISTENIALLRCAAEYLEMTEDYAVANLVERTEAYFN  128

Query  434  Q  436
            +
Sbjct  129  E  129



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+FSQEIP+DV V+ G A+FSLHKF LV+K  Y+RKL+ ++ +ADL+ I 
Sbjct  20   LSSAMKRTSEWIFSQEIPSDVTVQAGGATFSLHKFPLVSKCGYMRKLVSEANDADLSMIE  79

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL+MT+ Y   NL  RTE +++
Sbjct  80   IPDIPGGAEAFELAAKFCYGINFEISTENVAMLRCVAEYLEMTEDYTTGNLVNRTEAYVT  139

Query  434  Q  436
            +
Sbjct  140  E  140



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  56   KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  235
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  236  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  415
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  416  TEDFLSQ  436
            TE F+++
Sbjct  131  TEAFVNE  137



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  56   KSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA  235
            K   +R S   +RTGQW+ S ++PTDV+VE    SFSLHKF LVA+   IR+ + +++E 
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPLVARCGRIRRAVAEAREM  70

Query  236  DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGR  415
            DL+RI    +PGG E FE AAKFCYG+NFEIT  NVAALRCAAEYL+M D+Y   NL GR
Sbjct  71   DLSRIEFPDVPGGAETFELAAKFCYGINFEITTANVAALRCAAEYLEMKDEYGQGNLLGR  130

Query  416  TEDFLSQ  436
            TE F+++
Sbjct  131  TEAFVNE  137



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS AM+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+
Sbjct  15   NMSSKKKQL---LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPLVSKCGYIRKLV  71

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             ++ +A ++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y  
Sbjct  72   SEASDAAVSVIELPDVPGG-EAFELAAKFCYGINFEISTENIAMLRCMAEYLEMTEDYAV  130

Query  398  NNLAGRTEDFLSQ  436
             NL GRTED+L++
Sbjct  131  GNLVGRTEDYLNE  143



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  250
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  6    VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  65

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  66   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  125

Query  431  SQ  436
             +
Sbjct  126  DE  127



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM-DSKEADLTRI  250
            +S A +RT +WV S ++PTDV+VE G  SF+LHKF LV++S  IRKL+  DS+E D++ I
Sbjct  18   VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPLVSRSGKIRKLVAGDSRELDVSFI  77

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             LS +PGGPE FE AAKFCYG+NFEI+V NVA LRCAAEYL MT+ Y D NL  RTE F+
Sbjct  78   KLSDLPGGPEAFELAAKFCYGINFEISVTNVATLRCAAEYLDMTEDYGDGNLVARTEAFI  137

Query  431  SQ  436
             +
Sbjct  138  DE  139



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+FSQEIP+DV V  G ASFSLHKF LV+K  YIRKL+ +  +ADLT I+
Sbjct  25   LSTVMKRTSEWIFSQEIPSDVTVLAGGASFSLHKFPLVSKCGYIRKLVSECNDADLTEIH  84

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL  RTE +L+
Sbjct  85   IPDIPGGGEAFELAAKFCYGINFEIGTENIAMLRCVAEYLEMTEDYAVGNLVARTEAYLN  144

Query  434  Q  436
            +
Sbjct  145  E  145



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     L+ AM+RT +W+FSQEIP+DV V  G  SFSLHKF LV+K  YIRKL+
Sbjct  20   NMSSKKKEL---LTTAMKRTSEWIFSQEIPSDVTVHAGGVSFSLHKFPLVSKCGYIRKLV  76

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S +ADL  I +  IPGG E FE AAKFCYG+NFEI+  N+A LRC A+YL+MT+ Y  
Sbjct  77   SESSDADLGEIEIPDIPGGAEAFELAAKFCYGINFEISTENIALLRCGADYLEMTEDYAV  136

Query  398  NNLAGRTEDFLSQ  436
             NL  R+E +L++
Sbjct  137  GNLVARSESYLNE  149



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 96/131 (73%), Gaps = 10/131 (8%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHK----------FMLVAKSNYIRKLIMD  223
            LS AM+RT +W+FSQEIP+DV V+VGEASFSLHK          F LV+K  YIRKL+ +
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKVANQFKYDSLFPLVSKCGYIRKLVSE  83

Query  224  SKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNN  403
            S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AEYL+MT+ Y   N
Sbjct  84   SNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAEYLEMTEDYSVGN  143

Query  404  LAGRTEDFLSQ  436
            L GRT+ +L++
Sbjct  144  LVGRTDAYLNE  154



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI +S +ADL+ I 
Sbjct  26   LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLISESSDADLSVIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ +   NL GRT+ +L+
Sbjct  86   LPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDHAVGNLVGRTDAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>gb|KJB43881.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=437

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            +S AM+RT +W+ SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ I
Sbjct  9    MSSAMKRTSEWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +L
Sbjct  69   GIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_003608469.1| BTB/POZ domain-containing protein [Medicago truncatula]
Length=424

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  259
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  260  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNE  119



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
            AM+RT  W+FSQEIP+DV V  G  SF+LHKF LV+KS YIRKLI +S EAD++ I++  
Sbjct  12   AMKRTSDWIFSQEIPSDVTVNAGGTSFTLHKFPLVSKSGYIRKLISESNEADVSTIDIPD  71

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RTE + ++
Sbjct  72   IPGGGEAFELAAKFCYGINFEISTENIALLRCVAEYLEMTEDYAVANLVERTEAYFNE  129



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     L+ A++RT +W+FSQEIP+DV V VGE SFSLHKF LV+K  YIRKL+
Sbjct  18   NMSSKKKEL---LTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLV  74

Query  218  MDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCD  397
             +S + +++ I L  +PGG E FE AAKFCYG+NFEI+  N+A LRC +EYL MT++Y  
Sbjct  75   SESTDDEISVIELPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVSEYLLMTEEYAI  134

Query  398  NNLAGRTEDFLSQ  436
             NL GRT+ +L++
Sbjct  135  GNLVGRTDAYLNE  147



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA--DLTRINLS  259
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRKLI +S +A  D+  I L 
Sbjct  1    MKRTSEWNYSQEIPSDVAIQIGEASYSLHKFPLISKSGYIRKLISESSDAVDDVPLIELI  60

Query  260  GIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
             +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++
Sbjct  61   DVPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNE  119



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS A++RT +W+FSQEIP+DV + VG  SFSLHKF L++K  YIRKLI +S +ADL+ I 
Sbjct  26   LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPLISKCGYIRKLISESSDADLSVIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+     NL GRT+ +L+
Sbjct  86   LPDVPGGAEAFELAAKFCYGINFEISTENIAMLRCVAEYLVMTEDNAVGNLVGRTDAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+S E  LTRI+LS IPGG  IFE+AAKFCYGVNFEITVHNVA LRC
Sbjct  1    MLVAKSNYIRKLIMESDETHLTRIDLSDIPGGSGIFEKAAKFCYGVNFEITVHNVAVLRC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AAE+LQMTD+YCDNNLAGRT++FLS+
Sbjct  61   AAEFLQMTDQYCDNNLAGRTDEFLSK  86



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            +S AM+RT +W+FSQEIP+DV V+V   SFSLHKF LV+K  YIRK++ +S +AD++ I 
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPLVSKCGYIRKVVSESNDADVSVIV  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEI   N+AALRC AEYL+MT+ Y   +L  RTE FL+
Sbjct  84   IPDVPGGAESFELAAKFCYGINFEINTENIAALRCVAEYLEMTEDYAVGSLVERTEAFLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>ref|XP_010679598.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679599.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679600.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679601.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679602.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679603.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679604.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=624

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  14   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  74   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  133

Query  434  Q  436
            +
Sbjct  134  E  134



>ref|XP_010679597.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            L+ AM+RT +W+ SQEIP+DV + + +ASFSLHKF LV+KS YI+KL+ +S ++++  + 
Sbjct  24   LTSAMKRTSEWIISQEIPSDVTINIDDASFSLHKFPLVSKSGYIKKLLSESNDSEICNLE  83

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI   N+A LRC AEYL+MT+ Y   NL GRTE +L+
Sbjct  84   IHDIPGGAEAFELAAKFCYGINFEICTENIAMLRCVAEYLEMTEDYAVGNLVGRTETYLN  143

Query  434  Q  436
            +
Sbjct  144  E  144



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 22/143 (15%)
 Frame = +2

Query  74   LSLAMERTGQW----------------------VFSQEIPTDVIVEVGEASFSLHKFMLV  187
            LS AM+RT +W                      +FSQEIP+DV V+VGEASFSLHKF LV
Sbjct  24   LSSAMKRTSEWYASCPLNETNTLVAFMSNVHNLIFSQEIPSDVNVQVGEASFSLHKFPLV  83

Query  188  AKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAE  367
            +K  YIRKL+ +S +AD++ I L  +PGG E FE AAKFCYG+NF+I V N+A LRC AE
Sbjct  84   SKCGYIRKLVSESNDADVSFIELPEVPGGAEAFELAAKFCYGINFDINVENIATLRCVAE  143

Query  368  YLQMTDKYCDNNLAGRTEDFLSQ  436
            YL+MT+ Y   NL GRT+ +L++
Sbjct  144  YLEMTEDYSVGNLVGRTDAYLNE  166



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS AM+RT +W+ SQEIP+D+ +  G ++F+LHKF LV+K  YIR+L+ ++ +++++ I 
Sbjct  22   LSTAMKRTSEWILSQEIPSDITIHAGGSTFALHKFPLVSKCGYIRRLVSEANDSNMSVIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  +PGG E FE AAKFCYG+NFEIT+ N+A LRCAAE+L+MT+ Y   NL  RTED+L 
Sbjct  82   IPDVPGGSEAFELAAKFCYGINFEITMENIAMLRCAAEHLEMTEDYAAGNLVNRTEDYLE  141

Query  434  Q  436
            +
Sbjct  142  E  142



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI  217
            NM+S  K     LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI
Sbjct  21   NMSSKKKEL---LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLI  77

Query  218  MDSKEA-DLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYC  394
             +S +A DL+ I LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y 
Sbjct  78   SESSDAADLSIIELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYA  137

Query  395  DNNLAGRTEDFLSQ  436
              NL GR + +L++
Sbjct  138  VGNLVGRADAYLNE  151



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQ+IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGGPE FE AAKFCY +NFEI+  N+A +RC AEYL+MTD Y   NL G TE +L+
Sbjct  82   IPDIPGGPEAFELAAKFCYEINFEISPENIALIRCVAEYLEMTDDYAVGNLVGLTETYLT  141

Query  434  Q  436
            +
Sbjct  142  E  142



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRINLSG  262
            M+RT +W +SQEIP+DV +++GEAS+SLHKF L++KS YIRK I + S  A++  I L  
Sbjct  1    MKRTSEWNYSQEIPSDVTIQIGEASYSLHKFPLISKSGYIRKFISEYSDAAEVPTIELFD  60

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            +PGG E FE AAKFCYG+NFEI+V N+A LRC AEYL+MT+ Y   NL GRT+ +L++
Sbjct  61   VPGGSEAFELAAKFCYGINFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRTDSYLNE  118



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +2

Query  74   LSLAMERTGQW-VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTR  247
            +S AM+RT +W + SQEIP+DV   VGEASFSLHKF LV+KS +IRKL+ +S  E+D++ 
Sbjct  9    MSSAMKRTSEWWISSQEIPSDVTAHVGEASFSLHKFPLVSKSGFIRKLVSESNNESDISV  68

Query  248  INLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDF  427
            I +  IPGG E FE AAKFCYG+NFEIT  N+A LRCAAEYL+MT+++   NL GR E +
Sbjct  69   IGIHEIPGGAEAFEMAAKFCYGINFEITTENIAMLRCAAEYLEMTEEHSVGNLLGRAEAY  128

Query  428  LSQ  436
            L++
Sbjct  129  LNE  131



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +M RT  WV S ++PTD+ V++   SF+LHKF LV++S  +RKL+ +++++DL+R+
Sbjct  11   RNSFSMRRTNDWVMSTDVPTDITVDICGTSFALHKFPLVSRSGRLRKLVAEARDSDLSRV  70

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
              + IPGGPE FE AAKFCYG+NFEIT  NVA LRC AEYL+MTD +   NLA R+E F+
Sbjct  71   EFNDIPGGPEGFEMAAKFCYGINFEITASNVAILRCVAEYLEMTDDFGQANLASRSEAFI  130



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEA-DLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S +A DL+ I
Sbjct  27   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSDAADLSVI  86

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             LS +PGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  87   ELSDVPGGSEAFELAAKFCYGINFEISTENIAMLRCVAEYLLMTEDYGVGNLVGRADAYL  146

Query  431  SQ  436
            ++
Sbjct  147  NE  148



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  194



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V VGEASFS+HKF LV+K  YIRKL+ +S +AD+  I LS +PGG E F
Sbjct  86   IFSQEIPSDVKVRVGEASFSIHKFPLVSKCGYIRKLVSESGDADVPLIELSDVPGGAEAF  145

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            E AAKFCYG+NFEI V N+A LRC AEYL+MT++Y   NL GRT+ +L+
Sbjct  146  ELAAKFCYGINFEINVENIATLRCVAEYLEMTEEYAVGNLVGRTDAYLN  194



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+RT  W FS EIP+DV V+VGE SFSLHKF LV+K  YI KL+ +S   D++ I L  +
Sbjct  1    MKRTSGWAFSHEIPSDVTVQVGEVSFSLHKFPLVSKCGYIEKLVSESSGEDVSFIELYDV  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            PGG E FE A KFCYGVNFEI+V N+A LRC AEYL+MT+ Y   NL GR + +L++
Sbjct  61   PGGAEAFELATKFCYGVNFEISVENIAMLRCVAEYLEMTEDYSVGNLVGRADSYLNE  117



>ref|XP_009630230.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nicotiana tomentosiformis]
Length=446

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQ+IP+D+ + VG  SFSLHKF LV+K  YIRKL+  S +A L+ I 
Sbjct  22   LSNVMKRTSEWILSQDIPSDITIHVGRTSFSLHKFPLVSKCGYIRKLVSKSSDAKLSAIE  81

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCY +NFEI   N+A +RC AEYL+MTD+Y   NL G TE +L+
Sbjct  82   IPDIPGGAEAFELAAKFCYDINFEINPENIALIRCVAEYLEMTDEYAVGNLVGLTEAYLN  141

Query  434  Q  436
            +
Sbjct  142  E  142



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD-LTRIN  253
            S AM+RT +W+FSQEIP+D+ ++VG+ SFSLHKF LV+K  YIR+ + +S EAD  T + 
Sbjct  14   STAMKRTSEWIFSQEIPSDITIKVGDNSFSLHKFPLVSKCGYIRRFVSESDEADDPTTLE  73

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E F+ AAKFCYG+NFE+   N+AA+RCAAE+L+MT+ Y   NL  R E ++S
Sbjct  74   IDDIPGGAESFDYAAKFCYGINFEMNAGNIAAIRCAAEFLEMTEDYAVGNLVSRAESYIS  133

Query  434  Q  436
            +
Sbjct  134  E  134



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+D+ V  G ASFSLHKF LV+K  YIRKL+ +  +AD++ + L  +PGG E F
Sbjct  9    IFSQEIPSDITVHAGGASFSLHKFPLVSKCGYIRKLVSEDSDADVSVVELPDVPGGEEAF  68

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL GRTED+L++
Sbjct  69   ELAAKFCYGINFEISTENIATLRCVAEYLEMTEDYAVGNLVGRTEDYLNE  118



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+ I 
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSEIE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI+  N+A LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNIALLRCVAEYLDMTDYYAVGNLVGLSEAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>ref|XP_008352542.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIKKLISESSYAADLSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  179  MLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRC  358
            MLVAKSNYIRKLIM+S E++LTR++LS IPGG E FE+AAKFCYGVNFEITV+NVA+L C
Sbjct  1    MLVAKSNYIRKLIMESNESELTRLDLSDIPGGQEAFEKAAKFCYGVNFEITVNNVASLHC  60

Query  359  AAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            AA +LQMTD+YCD NLAGRTE FLSQ
Sbjct  61   AAMFLQMTDEYCDGNLAGRTEGFLSQ  86



>ref|XP_008372448.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L+ K  +I+KLI +S   ADL+ I
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLIXKCGHIKKLISESSYAADLSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             LS +PGG E FE AA+FCYG+NFE++  N+A LRC AEYL MT+ Y   NL GR + +L
Sbjct  69   ELSDVPGGSEAFELAARFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVGRADAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESNKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            N++ IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   NITDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAESYL  128

Query  431  SQ  436
             +
Sbjct  129  DE  130



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRIN  253
            LS  M+RT +W+ SQEIP+D+ V V   SF+LHKF LV+K  YIRKL+  S +A+L+   
Sbjct  26   LSNVMKRTSEWILSQEIPSDITVHVAGTSFALHKFPLVSKCGYIRKLVAKSNDANLSVFE  85

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            +  IPGG E FE AAKFCYG+NFEI+  NVA LRC AEYL MTD Y   NL G +E +L+
Sbjct  86   IPDIPGGAEAFEFAAKFCYGINFEISSGNVALLRCVAEYLDMTDDYAVGNLVGLSEAYLN  145

Query  434  Q  436
            +
Sbjct  146  E  146



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  47   SPLKSAATR--LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM  220
            SP  +A  +  LS  M+RT +W+ SQE+P+D+ V  G A+F+LHKF L++K  YIR+L+ 
Sbjct  9    SPPSAAIKKELLSTTMKRTSEWILSQEVPSDITVHAGGATFALHKFPLISKCGYIRRLVS  68

Query  221  DSKEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDN  400
            ++ +++++ I +  +PGG E F  AAKFCYG+NFEIT  N+A LRC AEYL+MT+ Y   
Sbjct  69   EANDSNISLIEIPDVPGGAEAFGFAAKFCYGINFEITTENIAMLRCVAEYLEMTEDYVVG  128

Query  401  NLAGRTEDFLSQ  436
            NL  RTE FL +
Sbjct  129  NLVSRTEIFLEE  140



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V  G ASFSLHKF LV+KS YIRK++ +S +ADL+ I +  +PGG E F
Sbjct  62   IFSQEIPSDVTVHAGGASFSLHKFPLVSKSGYIRKMVSESSDADLSEIKIPNVPGGAEAF  121

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            E AAKFCYG+NFEI+  N+A LRC AEYL+MT+ Y   NL  RT+ +L++
Sbjct  122  ELAAKFCYGINFEISTENIAMLRCVAEYLEMTEDYAVGNLVSRTDAYLNE  171



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIF  286
            +FSQEIP+DV V     SF+LHKF LV++   IRKL+ +S EADL+ I L GIPGG E F
Sbjct  14   IFSQEIPSDVTVHAAGTSFALHKFPLVSRCGCIRKLVSESSEADLSNIELVGIPGGAEAF  73

Query  287  ERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            E AAKFCYG+NFEI+  N+A LRCAAEYL+MT+ Y   NL GRTE +L +
Sbjct  74   ELAAKFCYGINFEISTKNIAMLRCAAEYLEMTEDYAVGNLVGRTEAYLKE  123



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLMSKCGFIKKLVSESSKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
             S AM+RT +W+ SQE+ +DV V +GEASFSLHKF L++K  +I+KL+ +SK +AD T +
Sbjct  9    FSSAMKRTSEWISSQEVSSDVTVHIGEASFSLHKFPLLSKCGFIKKLVSESKTDADSTIV  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF++   N+A LRCAAEYL+MT+++   NL  RTE +L
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMGTENIAMLRCAAEYLEMTEEHSVENLVVRTEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS A++RT +W+FSQEIP+D+ + VG  SFSLHKF L++K  +IRKLI +S   ADL+ I
Sbjct  29   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPLISKCGHIRKLISESSYAADLSVI  88

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             L  +PGG E FE AAKFCYG+NFE++  N+A LRC AEYL MT+ Y   NL  R + +L
Sbjct  89   ELFDVPGGSEAFEFAAKFCYGINFELSTGNIAMLRCVAEYLLMTEDYAVGNLVERADAYL  148

Query  431  SQ  436
            ++
Sbjct  149  NE  150



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  253
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L+
Sbjct  70   LPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYLN  129

Query  434  Q  436
            +
Sbjct  130  E  130



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRIN  253
            S AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +SK ++D T I 
Sbjct  10   SSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLVSESKSDSDATVIK  69

Query  254  LSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            L  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L+
Sbjct  70   LPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYLN  129

Query  434  Q  436
            +
Sbjct  130  E  130



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 3/117 (3%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+R  +W +S EIP+DV ++VGE SFSLHKF LV+KS YI KL+ +S +A    I L  +
Sbjct  1    MKRASEWAYSHEIPSDVTIQVGEVSFSLHKFPLVSKSGYIGKLVSESSDA---FIELYDV  57

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            PGG E FE A KFCYG+NFEI++ N+A LRC AEYL MT+ Y   NL GR + +L++
Sbjct  58   PGGAEAFELATKFCYGINFEISIENIAMLRCVAEYLDMTEDYSVGNLVGRADSYLNE  114



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 92/122 (75%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+  S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSGSNKDSDSSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MTD++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTDEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_006844655.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
 gb|ERN06330.1| hypothetical protein AMTR_s00016p00237490 [Amborella trichopoda]
Length=616

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
             M++T  W+ + ++P+D+ VEVG  +FSLHKF L ++S  IRKL+   K+  +T+INLS 
Sbjct  25   TMQKTSDWLLT-DVPSDLTVEVGSKNFSLHKFPLASQSGRIRKLLAQPKDVKITKINLSD  83

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            IPGGPE FE AAKFCYGV+ EIT  NVA LRCAA+YL+MT++Y   +L  RTE  L++
Sbjct  84   IPGGPEAFEHAAKFCYGVSLEITASNVAMLRCAADYLEMTEEYGQGSLESRTERHLNE  141



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K  +I+KL+ +S K++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGFIKKLMSESNKDSDSSVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KILDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+R  +W +S EI +DV V+VGE SFSLHKF LV+KS YI KL+ +S + D++ I L  +
Sbjct  1    MKRASEWAYSHEILSDVTVQVGEVSFSLHKFPLVSKSGYIGKLVSESSD-DVSFIELYDV  59

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            PGG E FE A KFCYG+NFEI+V N+A LRC AEYL MT+ Y   NL GR + +L++
Sbjct  60   PGGAEAFELATKFCYGINFEISVENIATLRCVAEYLDMTEDYSVGNLVGRADSYLNE  116



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            L+ AM+RT +W+ SQE+ +D+ V VGEASFSLHKF L++K  +I+KL+ +S K++D T I
Sbjct  9    LTSAMKRTSEWISSQEVSSDITVHVGEASFSLHKFPLLSKCGFIKKLMSESTKDSDSTVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE AAKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E ++
Sbjct  69   KIPDIPGGSEAFELAAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYV  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_007050812.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX94969.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma 
cacao]
Length=631

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 92/120 (77%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRV  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            N+S +PGGPE FE AAKFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L
Sbjct  79   NISSVPGGPEAFELAAKFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYL  138



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            E DLTRINLSGIPGGPE+FE+AAKFCYGVNFEITV NVAALRCAAEYLQMTD YCDNNLA
Sbjct  38   ETDLTRINLSGIPGGPEMFEKAAKFCYGVNFEITVQNVAALRCAAEYLQMTDLYCDNNLA  97

Query  410  GRTEDFLSQ  436
            GRT+DFL Q
Sbjct  98   GRTDDFLGQ  106



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT +W+ SQEIP+D+ +  G ++F+LHK  LV+K  YIR+L+ ++  ++++ I +
Sbjct  23   STAMKRTSEWILSQEIPSDITIHAGGSAFALHKLPLVSKCGYIRRLVSEANGSNISVIEI  82

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
              +PGG E F+ AAKFCYG+NFEIT  N+A LRC A YL+MT+ Y   NL  RTE +L +
Sbjct  83   PDVPGGAEAFKFAAKFCYGINFEITTENIAMLRCVAGYLEMTEDYAAGNLVNRTEGYLEE  142



>gb|EYU46717.1| hypothetical protein MIMGU_mgv1a003257mg [Erythranthe guttata]
Length=596

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG ASF+LHKF LV++S  IRKL+M+SK++ ++R+NLSG+PGGP  FE+AA
Sbjct  7    DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLMESKDSKISRLNLSGVPGGPHTFEQAA  66

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYGVN +I++ N+A LRCAA +L+M ++Y + NL  RTE +L
Sbjct  67   KFCYGVNIDISLSNIATLRCAAHFLEMNEEYSEKNLESRTEAYL  110



>ref|XP_011079726.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 [Sesamum 
indicum]
Length=632

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +     +W  S ++ +D+ +EVG ASF+LHKF LV++S  IRKL+ ++K++ ++R+
Sbjct  20   RPSSSARHVTEWPLS-DVSSDLTIEVGTASFALHKFPLVSRSGRIRKLVSEAKDSKISRL  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLSG+PGG + FE AAKFCYGVN EITV NV  LRCAA +L+MT+++ D NL  RTE +L
Sbjct  79   NLSGVPGGSQAFELAAKFCYGVNIEITVSNVGMLRCAAHFLEMTEEFSDKNLEARTEVYL  138



>emb|CDY57436.1| BnaAnng14510D [Brassica napus]
Length=603

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL MT+++   NL  R E +L
Sbjct  69   KIPDIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLDMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>gb|KJB47066.1| hypothetical protein B456_008G009400 [Gossypium raimondii]
Length=462

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  101  QWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  280
            +W  S ++ +DV +E+G +SF+LHKF LV++S  IR+L++++K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEAKDATISRMNLSLIPGGPE  89

Query  281  IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             FE AAKFCYG+N EIT+ NVA LRCAA +L+MT+++   NL  RTE +L
Sbjct  90   AFELAAKFCYGINIEITLSNVAMLRCAAHFLEMTEEFVQKNLEARTEAYL  139



>gb|KHG21965.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=632

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+  ++RI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRI  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLS  PGGPE FE AAKFCYG+N EIT+ NVA LRC + YL+M +++ +NNL  RTE +L
Sbjct  79   NLSSAPGGPEAFELAAKFCYGINVEITLSNVAMLRCISHYLEMAEEFAENNLEARTEAYL  138



>emb|CDY43566.1| BnaC02g16630D [Brassica napus]
Length=295

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPG  E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGSSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +2

Query  86   MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGI  265
            M+RTG+W++S E+P+D+ V+VG + F LHK++LV+K  YIRKL  ++ + + + I +  +
Sbjct  1    MKRTGEWIYSPEVPSDIDVKVGGSIFPLHKYLLVSKCGYIRKLASEANQPNTSAIEIPDV  60

Query  266  PGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            PGG E FE   K+CYGVNFEIT  N+A LRC AEYL+MT+ Y   NL  R E +L +
Sbjct  61   PGGAEAFELVTKYCYGVNFEITAENIAMLRCVAEYLEMTEDYTVGNLVSRAEAYLEE  117



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT  W+ SQE P+D+ ++VGE+SF+LHK  L +K  YIRKL+  +  + +T + +
Sbjct  9    SAAMKRTSDWIRSQEFPSDITIQVGESSFNLHKLPLASKCGYIRKLVSGANGSRVTHLEI  68

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            +G+PG  + F+   KFCYGVNFEIT  NVA LRCAAE+L+MT++    NL GRTE +L +
Sbjct  69   TGMPGDAKAFDLVIKFCYGVNFEITADNVAMLRCAAEHLEMTEECKPGNLVGRTEAYLEE  128



>ref|XP_006651150.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like, 
partial [Oryza brachyantha]
Length=458

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  53   LKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKE  232
            +++ A   S AM+RTG W+ SQE+P+D+ ++V +A+F+LHK  L ++  YI+K +     
Sbjct  2    MQAEARLFSPAMKRTGDWILSQELPSDITIKVDDAAFNLHKLPLASRCGYIKKQVTGVGG  61

Query  233  ADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAG  412
            + +T + ++G+PGG + FE   KFCYGVNFEI V NVA LRCAAE+L+MT++    NL G
Sbjct  62   SKVTHLEITGMPGGTKAFELVIKFCYGVNFEIAVDNVAMLRCAAEHLEMTEECKPRNLVG  121

Query  413  RTEDFLSQ  436
            RTE +L +
Sbjct  122  RTEAYLEE  129



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K   I+KL+ +SK ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLIKKLMSESKNDSDASVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL MT+++   NL  R E +L
Sbjct  69   KIPDIPGGFEAFELTAKFCYGINFDMSTENIAMLRCAAEYLDMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>gb|KJB47067.1| hypothetical protein B456_008G009400 [Gossypium raimondii]
Length=581

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  101  QWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  280
            +W  S ++ +DV +E+G +SF+LHKF LV++S  IR+L++++K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEAKDATISRMNLSLIPGGPE  89

Query  281  IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             FE AAKFCYG+N EIT+ NVA LRCAA +L+MT+++   NL  RTE +L
Sbjct  90   AFELAAKFCYGINIEITLSNVAMLRCAAHFLEMTEEFVQKNLEARTEAYL  139



>ref|XP_007050813.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
 gb|EOX94970.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma 
cacao]
Length=626

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+A ++R+N+S +PGGPE FE AA
Sbjct  30   DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLIDAKDAKISRVNISSVPGGPEAFELAA  89

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYG+N EIT+ NVA LRCA+ +L+MT+++ + NL  RTE +L
Sbjct  90   KFCYGINVEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYL  133



>ref|XP_006404081.1| hypothetical protein EUTSA_v10010248mg [Eutrema salsugineum]
 gb|ESQ45534.1| hypothetical protein EUTSA_v10010248mg [Eutrema salsugineum]
Length=566

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMD-SKEADLTRI  250
            +SLAM+RT +W+ SQEIP D+ V +GE SFSLHKF +V+K  +++KL  + S ++++  I
Sbjct  8    MSLAMKRTSEWISSQEIPCDIAVHIGETSFSLHKFTVVSKCGFLKKLASETSNDSNIAVI  67

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +   PGG E FE A KFCYG+NFE+   N+A LRCAAEYL+MT+++  +NL   TE +L
Sbjct  68   KIPDFPGGAEAFELATKFCYGINFEMNTENIAMLRCAAEYLEMTEEHSVSNLVETTEVYL  127

Query  431  SQ  436
            ++
Sbjct  128  NE  129



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    +R  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KQQQQQLSLAKCSRQRCNEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGGPE FE AAKFCYG+NFEIT  NVA L C ++YL+MT+++  +NL
Sbjct  62   RDADISRVELLNLPGGPETFELAAKFCYGINFEITSTNVAQLCCVSDYLEMTEEFSKDNL  121

Query  407  AGRTEDFL  430
              R E+++
Sbjct  122  GSRAEEYV  129



>ref|XP_009611132.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=606

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +2

Query  68   TRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEAD  238
            ++LSLA    +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D
Sbjct  6    SQLSLAKCSRQRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSD  64

Query  239  LTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRT  418
            ++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R 
Sbjct  65   ISRIELLSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRA  124

Query  419  EDFL  430
            E++L
Sbjct  125  EEYL  128



>gb|KHG27924.1| hypothetical protein F383_10949 [Gossypium arboreum]
Length=633

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +2

Query  101  QWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  280
            +W  S ++ +DV +E+G +SF+LHKF LV++S  IR+L+++ K+A ++R+NLS IPGGPE
Sbjct  31   EWPIS-DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEEKDATISRMNLSLIPGGPE  89

Query  281  IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             FE AAKFCYG+N EIT+ NVA LRCAA +L+MT+++   NL  RTE +L
Sbjct  90   AFELAAKFCYGINIEITLSNVAMLRCAAHFLEMTEEFVQKNLEARTEAYL  139



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSEWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLISRSEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+ +EV  A+FSLHKF LV++S  IRKL+ + +++D++ I L G+P
Sbjct  17   QRCSEWVF-RDVPSDITIEVDGAAFSLHKFPLVSRSGRIRKLVAEHRDSDISGIELPGLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG E FE AA+FCYGVNFEIT  NVA L C ++YL+MT++Y  NNL  R E++L
Sbjct  76   GGAESFELAAQFCYGVNFEITAANVAQLCCVSDYLEMTEEYSKNNLGLRCEEYL  129



>ref|XP_009414870.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=634

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R SL+  +  +W  S ++ +D+ VEVG +SF+LHKF LV++S  IRKLI D+K + +TRI
Sbjct  22   RSSLSTRQATEWPLS-DVSSDLTVEVGTSSFALHKFPLVSRSGRIRKLISDAKNSKVTRI  80

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NL G PGG E FE AAKFCYG+N E+   NVA LRCAA YL+MT+++ + NL  RTE +L
Sbjct  81   NLHGTPGGAEAFEIAAKFCYGINTELNPSNVAMLRCAAHYLEMTEEFAEKNLELRTEIYL  140

Query  431  SQ  436
             +
Sbjct  141  KE  142



>emb|CDY68489.1| BnaCnng59210D [Brassica napus]
Length=449

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS-KEADLTRI  250
            LS AM+RT  W+ SQE+ +DV V VGEASFSLHKF L++K    +KL+ +S  ++D T I
Sbjct  9    LSSAMKRTSVWISSQEVSSDVTVHVGEASFSLHKFPLLSKCGLFKKLVSESTNDSDATVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE   KFCYG+NF+++  N+A LRCA+EYL+MT+++   NL  R+E +L
Sbjct  69   KIPDIPGGSEAFELTTKFCYGINFDMSTENIAMLRCASEYLEMTEEHSVENLVSRSEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_004240632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Solanum 
lycopersicum]
Length=599

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 91/127 (72%), Gaps = 6/127 (5%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  +A+R     +R  +WVF +++P+D+ +EV  A FSLHKF LV++S  IR+L+ + +
Sbjct  12   PLTKSASR-----QRYNEWVF-RDVPSDITIEVDGAIFSLHKFPLVSRSGRIRRLVAEHR  65

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ +  NNL 
Sbjct  66   DSDISRIELVSLPGGSESFELAAKFCYGVNFEITSSNVAQLCCVSDYLEMSEDHSKNNLG  125

Query  410  GRTEDFL  430
             R E++L
Sbjct  126  SRAEEYL  132



>ref|XP_011468065.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Fragaria vesca subsp. vesca]
Length=583

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            EIP+DV V VGE SFSLHKF LV+K  YIRKL+ +S + +++ I L  +PGG E FE AA
Sbjct  2    EIPSDVSVRVGEVSFSLHKFPLVSKCGYIRKLVSESTDDEISVIELPDVPGGAEAFELAA  61

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            KFCYG+NFEI+  N+A LRC +EYL MT++Y   NL GRT+ +L++
Sbjct  62   KFCYGINFEISTENIAMLRCVSEYLLMTEEYAIGNLVGRTDAYLNE  107



>ref|XP_011089690.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X4 [Sesamum indicum]
Length=423

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYL  129



>ref|XP_004247452.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Solanum lycopersicum]
Length=629

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +     +W  S ++ +D+ +EVG ASF+LHKF LV++S  IRKL++D+K+  ++R+
Sbjct  20   RPSSSARHINEWPIS-DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLLDAKDTKISRL  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NL+G+PGG + FE AAKFCYGVN EIT+ NVA LRCAA++++MT+   + NL  RTE FL
Sbjct  79   NLTGLPGGSDAFELAAKFCYGVNIEITILNVALLRCAAKFMEMTEDISEKNLETRTEVFL  138



>ref|XP_006359421.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Solanum tuberosum]
Length=629

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +     +W  S ++ +D+ +EVG ASF+LHKF LV++S  IRKL++D+K+  ++R+
Sbjct  20   RPSSSARHITEWPIS-DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLLDAKDTKISRL  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NL+G+PGG + FE AAKFCYGVN EIT+ NVA LRCAA++++MT+   + NL  RTE FL
Sbjct  79   NLTGLPGGSDAFELAAKFCYGVNVEITISNVALLRCAAKFMEMTEDISEKNLETRTEVFL  138



>ref|XP_009599429.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
tomentosiformis]
Length=598

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IRKL+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRKLVAEHR  62

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGAESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  410  GRTEDFL  430
             R E++L
Sbjct  123  SRAEEYL  129



>gb|EYU40606.1| hypothetical protein MIMGU_mgv1a003057mg [Erythranthe guttata]
Length=611

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            ++  +WVF +++P+D+I+EV  A+FSLHKF LV++S  +RKL+ + +E+D++RI L  +P
Sbjct  20   QKCSEWVF-RDVPSDIIIEVDGATFSLHKFPLVSRSGRMRKLVAEHRESDISRIELLSLP  78

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLS  433
            GG   FE AA+FCYG+NFEI+  NVA L C ++YL+MT++Y +NNL+ R E++L+
Sbjct  79   GGAASFELAAQFCYGINFEISTSNVAHLCCVSDYLEMTEEYSNNNLSSRAEEYLN  133



>emb|CDY12841.1| BnaC07g15920D [Brassica napus]
Length=603

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS AM+RT +W+ SQE+ +DV V VGEASF LHKF L++K   I+KL+ ++K ++D + I
Sbjct  9    LSSAMKRTSEWISSQEVCSDVTVHVGEASFLLHKFPLLSKCGLIKKLVSETKNDSDASLI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  IPGG E FE  AKFCYG+NF+++  N+A LRCAAEYL+MT+++   NL  R E +L
Sbjct  69   KIPYIPGGSEAFELTAKFCYGINFDMSTENIAMLRCAAEYLEMTEEHSVENLVVRAEAYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_002961348.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
 ref|XP_002983215.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ15557.1| hypothetical protein SELMODRAFT_118052 [Selaginella moellendorffii]
 gb|EFJ38887.1| hypothetical protein SELMODRAFT_74933 [Selaginella moellendorffii]
Length=573

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  110  FSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFE  289
             + ++PTD+ VEV   SF+LHKF LV++S  IRKL++++++ D ++I L  IPGG E+FE
Sbjct  1    MTSDVPTDISVEVAGTSFALHKFPLVSRSGRIRKLVVETRDLDPSQIKLLEIPGGAEVFE  60

Query  290  RAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
              AKFCYG+NFEIT  NVA LRCAA YL+MTD Y + NL  RTE +L++
Sbjct  61   LVAKFCYGINFEITTANVAVLRCAAHYLEMTDDYGEGNLVVRTETYLNE  109



>gb|KHG21966.1| hypothetical protein F383_08186 [Gossypium arboreum]
Length=627

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+  ++RINLS  PGGPE FE AA
Sbjct  30   DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDTKDTKISRINLSSAPGGPEAFELAA  89

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYG+N EIT+ NVA LRC + YL+M +++ +NNL  RTE +L
Sbjct  90   KFCYGINVEITLSNVAMLRCISHYLEMAEEFAENNLEARTEAYL  133



>gb|EMT21744.1| BTB/POZ domain-containing protein [Aegilops tauschii]
Length=556

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT  W+ SQE P+D+ ++VG +SF+LHK  L +K  YIRKL+  +  + +T + +
Sbjct  9    SAAMKRTSDWIRSQEFPSDITIQVGGSSFNLHKLPLASKCGYIRKLVSGANGSRVTHLEI  68

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            +G+PG  + F+   KFCYGVNFEIT  NVA LRCAAE+L+MT++    NL GRTE +L +
Sbjct  69   TGMPGDAKAFDLVIKFCYGVNFEITADNVAMLRCAAEHLEMTEECKPGNLVGRTEAYLEE  128



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  77   SLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINL  256
            S AM+RT  W+ SQE P+D+ ++VG+ +F+LHK  L +K  YIRKL+  +  + +T + +
Sbjct  9    SAAMKRTSDWIRSQEFPSDITIQVGDGTFNLHKLPLASKCGYIRKLVSGANGSRVTHLEI  68

Query  257  SGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
             G+PGG + FE   KFCYG NFEIT  NVA LRCAAE+L+MT++    NL GR E +L +
Sbjct  69   PGLPGGAKAFELVIKFCYGANFEITADNVAMLRCAAEHLEMTEECKPGNLIGRAEAYLEE  128



>ref|XP_010112756.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXC34714.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=631

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ VEVG +SFSLHKF LV++S  IRKL++++K+  +TRI
Sbjct  20   RPSSSIRHATEWPIS-DVSSDLTVEVGTSSFSLHKFPLVSRSGRIRKLLLEAKDTKITRI  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NL+ +PGGPE FE AAKFCYGVN EIT  NVA L CAA +L+MT+ + + NL  R E +L
Sbjct  79   NLATVPGGPEAFELAAKFCYGVNVEITQSNVAMLCCAAHFLEMTEDFAEKNLEARVEAYL  138

Query  431  SQ  436
             +
Sbjct  139  KE  140



>ref|XP_002877714.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53973.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI-MDSKEADLTRI  250
            LS AMERT +W+ SQ+IP+DV V VGE SFSLHKF LV+K  +I+KL    S ++++T I
Sbjct  8    LSSAMERTSEWISSQKIPSDVTVHVGETSFSLHKFPLVSKCGFIKKLASKSSNDSNITVI  67

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             L   PGG E FE A KFCY ++FEI   N+A LRCAAEYL+MT+++   NL    E +L
Sbjct  68   KLPDFPGGAEAFELAIKFCYDISFEINTENIAMLRCAAEYLEMTEEHSVENLVETIEVYL  127

Query  431  SQ  436
            ++
Sbjct  128  NE  129



>ref|XP_011082488.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Sesamum indicum]
Length=634

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +2

Query  101  QWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPE  280
            +W  S ++ +D+ VEVG ASF+LHKF LV++S  IRKL++++K+  ++R+NL+G+PGG +
Sbjct  30   EWPIS-DVSSDLTVEVGTASFALHKFPLVSRSGRIRKLLLETKDPKVSRLNLAGVPGGSQ  88

Query  281  IFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
             FE AAKFCYGVN EIT  NVA LRCAA +L+MT+++ + NL  RTE +L +
Sbjct  89   AFELAAKFCYGVNIEITTSNVAMLRCAAHFLEMTEEFSEKNLESRTEVYLKE  140



>gb|KJB47065.1| hypothetical protein B456_008G009400 [Gossypium raimondii]
Length=653

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +DV +E+G +SF+LHKF LV++S  IR+L++++K+A ++R+NLS IPGGPE FE AA
Sbjct  108  DVSSDVTIEIGASSFALHKFPLVSRSGRIRRLLIEAKDATISRMNLSLIPGGPEAFELAA  167

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYG+N EIT+ NVA LRCAA +L+MT+++   NL  RTE +L
Sbjct  168  KFCYGINIEITLSNVAMLRCAAHFLEMTEEFVQKNLEARTEAYL  211



>ref|XP_011089687.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
 ref|XP_011089688.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X2 [Sesamum indicum]
Length=607

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYL  129



>gb|KJB23203.1| hypothetical protein B456_004G086600 [Gossypium raimondii]
Length=630

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG +SF+LHKF LV++S  IRKL++D+K+  ++RINLS  PGGPE FE AA
Sbjct  30   DVSSDLKIEVGTSSFALHKFPLVSRSGRIRKLLIDAKDTKISRINLSSAPGGPEAFELAA  89

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYG+N EIT+ NVA LRC + YL+M +++ +NNL  RTE +L
Sbjct  90   KFCYGINVEITLSNVAMLRCISHYLEMAEEFAENNLEARTEAYL  133



>ref|XP_009792130.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Nicotiana 
sylvestris]
Length=606

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+ +EV   +FSLHKF LV++S  IRKL+   +++D++RI L  +P
Sbjct  16   QRYSEWVF-RDVPSDITIEVDGGTFSLHKFPLVSRSGRIRKLVAGHRDSDISRIELLSLP  74

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG E FE AAKFCYGVNFEIT  NVA L C ++YL+MT+ Y  NNL  R E++L
Sbjct  75   GGVESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMTEDYSKNNLGSRAEEYL  128



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +2

Query  83   AMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSG  262
            AM R   W+ SQE P+D+ ++VGEA+F+LHK  L ++ +YIRK +     + +T I+L+G
Sbjct  10   AMRRISDWIMSQEFPSDITIQVGEATFNLHKLPLASRCDYIRKQVSGINGSRVTHIDLTG  69

Query  263  IPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            +PGG   FE   KFCYG NFEIT  NVA LRCAAE+L+MTD     NLA RTE +L
Sbjct  70   MPGGAAAFELVIKFCYGENFEITEDNVAMLRCAAEHLEMTDDSMGGNLAARTEAYL  125



>ref|XP_011089689.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X3 [Sesamum indicum]
Length=603

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYL  129



>ref|XP_009766799.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Nicotiana sylvestris]
Length=598

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +2

Query  50   PLKSAATRLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK  229
            PL  + +R     +R  +WVF +++P+D+ +EV    FSLHKF LV++S  IR+L+ + +
Sbjct  9    PLTKSTSR-----QRYNEWVF-RDVPSDITIEVDGGIFSLHKFPLVSRSGRIRRLVAEHR  62

Query  230  EADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLA  409
            ++D++RI L  +PGG E FE AAKFCYGVNFEIT  NVA L C ++YL+M++ Y  NNL 
Sbjct  63   DSDISRIELVSLPGGTESFELAAKFCYGVNFEITAANVAQLCCVSDYLEMSEDYSKNNLG  122

Query  410  GRTEDFL  430
             R E++L
Sbjct  123  SRAEEYL  129



>ref|XP_010241864.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X1 [Nelumbo nucifera]
Length=630

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   TGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGG  274
            T +W  S ++ +D+IVEVG  +F +HKF LV++S  IRKL++++K++ ++RINL  +PGG
Sbjct  28   TTEWPIS-DVSSDLIVEVGAVTFPIHKFPLVSRSGKIRKLLLEAKDSKVSRINLPSVPGG  86

Query  275  PEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
             E FE AAKFCYGVN EIT+ NVA LRCAA YL+MT+++ + NL  RTE ++ +
Sbjct  87   SEAFELAAKFCYGVNIEITLSNVAMLRCAAHYLEMTEEFSEKNLEYRTEIYIKE  140



>dbj|BAC41926.1| non-phototropic hypocotyl-like protein [Arabidopsis thaliana]
Length=321

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  22   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  80

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  81   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  140

Query  422  DFL  430
            ++L
Sbjct  141  EYL  143



>ref|XP_011089686.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like isoform 
X1 [Sesamum indicum]
Length=620

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +2

Query  89   ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIP  268
            +R  +WVF +++P+D+I++V   +FSLHKF LV++S  IRKL+ + +++D++RI L  +P
Sbjct  17   QRCSEWVF-RDVPSDIIIDVDGGTFSLHKFPLVSRSGRIRKLVAEHRDSDISRIELLSLP  75

Query  269  GGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            GG + FE AA+FCYG+NFEIT  NVA L C ++YL+MT++Y  NNL  R E++L
Sbjct  76   GGAKSFELAAQFCYGINFEITAANVAQLCCVSDYLEMTEEYSKNNLGSRAEEYL  129



>dbj|BAJ33928.1| unnamed protein product [Thellungiella halophila]
Length=617

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFL  430
            ++L
Sbjct  140  EYL  142



>ref|XP_001763717.1| predicted protein [Physcomitrella patens]
 gb|EDQ71359.1| predicted protein [Physcomitrella patens]
Length=599

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 85/113 (75%), Gaps = 5/113 (4%)
 Frame = +2

Query  107  VFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLI---MDSKEADLTRINLSGIPGGP  277
            V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+   +D++  +L R  L+ +PGG 
Sbjct  22   VLTTDVPSDLVVEAGGMNFSLHKFPLVARSGRIRKLVPNLVDNENPNLLR--LTDVPGGA  79

Query  278  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            E F+ AAKFCYG+NFEIT  NVA LRCAAEYL+MT+ Y +NNL  RTE FLS+
Sbjct  80   EAFDLAAKFCYGINFEITTSNVAVLRCAAEYLEMTEPYGENNLVARTETFLSE  132



>ref|XP_004170411.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At1g03010-like [Cucumis sativus]
Length=675

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++++K++  +R+
Sbjct  63   RPSSSIRHATEWPIS-DVSSDLAIEVGGSSFALHKFPLVSRSGKIRKLLLEAKDSKTSRV  121

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLS IPGG E FE  AKFCYG+N EIT+ NVA LRCA+ YL+MT+++ D NL  RTE +L
Sbjct  122  NLSTIPGGSEAFELTAKFCYGINVEITLSNVAMLRCASHYLEMTEEFADRNLETRTEAYL  181

Query  431  SQ  436
             +
Sbjct  182  KE  183



>ref|XP_006395119.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
 gb|ESQ32405.1| hypothetical protein EUTSA_v10003813mg [Eutrema salsugineum]
Length=640

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +2

Query  71   RLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG EIFE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAEIFELAAKFCYGINFEITSSNVAQLFCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFL  430
            ++L
Sbjct  140  EYL  142



>ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Cucumis 
sativus]
 gb|KGN44895.1| hypothetical protein Csa_7G394640 [Cucumis sativus]
Length=675

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++++K++  +R+
Sbjct  63   RPSSSIRHATEWPIS-DVSSDLAIEVGGSSFALHKFPLVSRSGKIRKLLLEAKDSKTSRV  121

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLS IPGG E FE  AKFCYG+N EIT+ NVA LRCA+ YL+MT+++ D NL  RTE +L
Sbjct  122  NLSTIPGGSEAFELTAKFCYGINVEITLSNVAMLRCASHYLEMTEEFADRNLETRTEAYL  181

Query  431  SQ  436
             +
Sbjct  182  KE  183



>ref|XP_010317168.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Solanum lycopersicum]
Length=570

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            +IP+D+ + VG  SF+LHKF LV+K  YIRKL+  S +A L+ I +  IPGGPE FE AA
Sbjct  2    DIPSDITIHVGRTSFALHKFPLVSKCGYIRKLVSKSNDAKLSTIEIPDIPGGPEAFELAA  61

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            KFCY +NFEI+  N+A +RC AEYL+MTD Y   NL G TE +L++
Sbjct  62   KFCYEINFEISPENIALIRCVAEYLEMTDDYAVGNLVGLTETYLTE  107



>ref|XP_008451623.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Cucumis melo]
Length=674

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++++K++  +R+
Sbjct  62   RPSSSIRHATEWPIS-DVSSDLAIEVGGSSFALHKFPLVSRSGKIRKLLLEAKDSKTSRV  120

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLS IPGG E FE  AKFCYG+N EIT+ NVA LRCA+ YL+MT+++ D NL  RTE +L
Sbjct  121  NLSTIPGGSEAFELTAKFCYGINVEITLSNVAMLRCASHYLEMTEEFADRNLETRTEAYL  180

Query  431  SQ  436
             +
Sbjct  181  KE  182



>ref|XP_011082489.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X2 [Sesamum indicum]
Length=608

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  98   GQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGP  277
            G  V   ++ +D+ VEVG ASF+LHKF LV++S  IRKL++++K+  ++R+NL+G+PGG 
Sbjct  2    GILVPISDVSSDLTVEVGTASFALHKFPLVSRSGRIRKLLLETKDPKVSRLNLAGVPGGS  61

Query  278  EIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFLSQ  436
            + FE AAKFCYGVN EIT  NVA LRCAA +L+MT+++ + NL  RTE +L +
Sbjct  62   QAFELAAKFCYGVNIEITTSNVAMLRCAAHFLEMTEEFSEKNLESRTEVYLKE  114



>ref|XP_008382632.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Malus 
domestica]
Length=621

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +2

Query  74   LSLA----MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            LSLA     +R  +W+F +++P+D+ ++V   +FSLHKF LV++S  IR+L+ + +++D+
Sbjct  18   LSLAKSSRQQRYNEWIF-RDVPSDITIQVNGGAFSLHKFPLVSRSGRIRRLVAEHRDSDI  76

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L CA++YL+MT+++  +NL  RTE
Sbjct  77   SRVELLNLPGGAESFELAAKFCYGINFEITSSNVAQLCCASDYLEMTEEFSKDNLGSRTE  136

Query  422  DFL  430
            ++L
Sbjct  137  EYL  139



>ref|XP_011024680.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Populus 
euphratica]
Length=610

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  407  AGRTEDFL  430
              R E++L
Sbjct  122  GSRAEEYL  129



>gb|KJB41979.1| hypothetical protein B456_007G130600 [Gossypium raimondii]
Length=633

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S ++    +W  S ++ +D+ +EVG +SF+LHKF LV++S  I+KL++D+K++ ++ I
Sbjct  20   RQSSSIRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIKKLLVDTKDSKISHI  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            NLS IPGG E FE AAKFCYG+N EI + NVA LRCA+ +L+MT+++ D NL  RTE ++
Sbjct  79   NLSSIPGGSEAFELAAKFCYGINVEIMLSNVAMLRCASNFLEMTEEFADKNLEARTEAYM  138



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 87/122 (71%), Gaps = 1/122 (1%)
 Frame = +2

Query  74   LSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSK-EADLTRI  250
            LS AM+RT +W+ SQ+IP+DV V VGE  FSLHKF LV+K  +I+KL  +S  ++++T I
Sbjct  9    LSSAMKRTSEWISSQDIPSDVTVHVGETLFSLHKFPLVSKCGFIKKLASESSNDSNITVI  68

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +   PGG E FE A KFCY ++FEI   N+A LRCAAEYL+MT+++   NL   TE +L
Sbjct  69   KIPDFPGGAEAFELAIKFCYDISFEINTENIAVLRCAAEYLEMTEEHSVENLVETTEVYL  128

Query  431  SQ  436
            ++
Sbjct  129  NE  130



>ref|XP_006359422.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like isoform 
X2 [Solanum tuberosum]
Length=599

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG ASF+LHKF LV++S  IRKL++D+K+  ++R+NL+G+PGG + FE AA
Sbjct  5    DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLLDAKDTKISRLNLTGLPGGSDAFELAA  64

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYGVN EIT+ NVA LRCAA++++MT+   + NL  RTE FL
Sbjct  65   KFCYGVNVEITISNVALLRCAAKFMEMTEDISEKNLETRTEVFL  108



>ref|XP_002301784.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
 gb|EEE81057.2| hypothetical protein POPTR_0002s24380g [Populus trichocarpa]
Length=610

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 91/128 (71%), Gaps = 4/128 (3%)
 Frame = +2

Query  56   KSAATRLSLA---MERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDS  226
            K    +LSLA    ++  +W+F +++P+D+ +EV   +F+LHKF LV++S  IRKL+ + 
Sbjct  3    KHQQQQLSLAKCSRQKYSEWIF-RDVPSDITIEVSGGTFALHKFPLVSRSGRIRKLVAEH  61

Query  227  KEADLTRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNL  406
            ++AD++R+ L  +PGG E FE AAKFCYG+NFEIT  NVA L C +EYL+MT+ +  +NL
Sbjct  62   RDADISRVELLNLPGGAEAFELAAKFCYGINFEITSSNVAQLCCVSEYLEMTEDFSKDNL  121

Query  407  AGRTEDFL  430
              R E++L
Sbjct  122  GSRAEEYL  129



>ref|XP_002267241.2| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Vitis vinifera]
 ref|XP_010652065.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X1 [Vitis vinifera]
 emb|CBI32255.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +2

Query  71   RLSLAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRI  250
            R S +     +W  S ++ +D+ +EVG +SF+LHKF LV++S  IRKL++++K++ ++RI
Sbjct  20   RPSSSTRHATEWPIS-DVSSDLTIEVGASSFALHKFPLVSRSGRIRKLLLEAKDSKVSRI  78

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             +  +PGGPE FE AAKFCYGVN EIT+ NVA LRC A +L+MT+++ + NL  RTE +L
Sbjct  79   AIPSVPGGPEAFELAAKFCYGVNIEITLSNVAMLRCVAHFLEMTEEFAEKNLETRTEGYL  138

Query  431  SQ  436
             +
Sbjct  139  KE  140



>ref|XP_001770455.1| predicted protein [Physcomitrella patens]
 gb|EDQ64792.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = +2

Query  80   LAMERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIM---DSKEADLTRI  250
            L +  T   V + ++P+D++VE G  +FSLHKF LVA+S  IRKL+    DS+  +L  +
Sbjct  18   LIVSHTWCRVLTTDVPSDIVVEAGGMNFSLHKFPLVARSGRIRKLVANLADSENPNL--L  75

Query  251  NLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
             L+ +PGG E F+ AAKFCYG+NFEIT  NVA LRCAAEYL MT+ Y +NNL  RTE FL
Sbjct  76   QLTDVPGGAEAFDLAAKFCYGINFEITTSNVAVLRCAAEYLDMTESYGENNLVARTEAFL  135

Query  431  SQ  436
            S+
Sbjct  136  SE  137



>ref|XP_009151678.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Brassica 
rapa]
Length=620

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +2

Query  71   RLSLAM---ERTGQWVFSQEIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADL  241
            +LSLA    +   +W+F +++P+D+ +EV   +F+LHKF LV++S  IR+++ + +++D+
Sbjct  21   KLSLAKSSRQSCSEWIF-RDVPSDITIEVNGGNFALHKFPLVSRSGRIRRIVAEHRDSDI  79

Query  242  TRINLSGIPGGPEIFERAAKFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTE  421
            +++ L  +PGG E FE AAKFCYG+NFEIT  NVA L C ++YL+MT++Y  +NLA RTE
Sbjct  80   SKVELLNLPGGAETFELAAKFCYGINFEITSSNVAQLLCVSDYLEMTEEYSKDNLASRTE  139

Query  422  DFL  430
            ++L
Sbjct  140  EYL  142



>ref|XP_010326604.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform 
X2 [Solanum lycopersicum]
Length=599

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  119  EIPTDVIVEVGEASFSLHKFMLVAKSNYIRKLIMDSKEADLTRINLSGIPGGPEIFERAA  298
            ++ +D+ +EVG ASF+LHKF LV++S  IRKL++D+K+  ++R+NL+G+PGG + FE AA
Sbjct  5    DVSSDLTIEVGSASFALHKFPLVSRSGRIRKLLLDAKDTKISRLNLTGLPGGSDAFELAA  64

Query  299  KFCYGVNFEITVHNVAALRCAAEYLQMTDKYCDNNLAGRTEDFL  430
            KFCYGVN EIT+ NVA LRCAA++++MT+   + NL  RTE FL
Sbjct  65   KFCYGVNIEITILNVALLRCAAKFMEMTEDISEKNLETRTEVFL  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820