BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034C17

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                160   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            160   4e-50   Sesamum indicum [beniseed]
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  153   3e-48   Citrus sinensis [apfelsine]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         164   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         155   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            150   6e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            170   6e-47   Solanum lycopersicum
gb|EPS71160.1|  hypothetical protein M569_03591                         157   8e-47   Genlisea aurea
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    157   1e-46   Arabis alpina [alpine rockcress]
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            169   1e-46   Nicotiana tomentosiformis
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       169   2e-46   Solanum tuberosum [potatoes]
gb|KDP38716.1|  hypothetical protein JCGZ_04069                         147   2e-46   Jatropha curcas
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            153   2e-46   Elaeis guineensis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            167   6e-46   Nicotiana sylvestris
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            147   6e-46   Eucalyptus grandis [rose gum]
gb|AFK34623.1|  unknown                                                 154   7e-46   Lotus japonicus
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       147   7e-46   Eucalyptus grandis [rose gum]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             156   8e-46   Capsella rubella
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            150   1e-45   Cucumis melo [Oriental melon]
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    149   2e-45   
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       149   3e-45   
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         154   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         154   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             154   5e-45   
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    148   5e-45   Cucumis sativus [cucumbers]
emb|CDX72270.1|  BnaC07g42920D                                          153   8e-45   
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         154   1e-44   Camelina sativa [gold-of-pleasure]
emb|CDY13387.1|  BnaA03g51050D                                          153   2e-44   Brassica napus [oilseed rape]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         153   2e-44   Brassica rapa
emb|CDY23258.1|  BnaA08g12880D                                          152   2e-44   Brassica napus [oilseed rape]
emb|CDY55623.1|  BnaC03g77560D                                          151   5e-44   Brassica napus [oilseed rape]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       151   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         152   1e-43   
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                151   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             151   3e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  159   8e-43   Ricinus communis
emb|CDP02851.1|  unnamed protein product                                157   3e-42   Coffea canephora [robusta coffee]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             155   4e-42   
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         156   7e-42   
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             156   7e-42   
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            156   8e-42   Fragaria vesca subsp. vesca
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    155   1e-41   Populus euphratica
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             143   2e-41   Phaseolus vulgaris [French bean]
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       142   2e-41   Cicer arietinum [garbanzo]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       150   2e-41   Setaria italica
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       155   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    154   3e-41   Phoenix dactylifera
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    154   3e-41   Citrus sinensis [apfelsine]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             154   3e-41   Citrus clementina [clementine]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            154   4e-41   Vitis vinifera
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             154   4e-41   Citrus clementina [clementine]
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    154   4e-41   Populus euphratica
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          148   4e-41   Zea mays [maize]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            154   5e-41   Pyrus x bretschneideri [bai li]
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    147   5e-41   
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    154   7e-41   Phoenix dactylifera
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            154   7e-41   
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            154   7e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         154   8e-41   Brassica rapa
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          153   8e-41   Amborella trichopoda
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         153   9e-41   Jatropha curcas
emb|CDX68696.1|  BnaC01g07570D                                          152   2e-40   
emb|CDY28216.1|  BnaA01g06330D                                          152   3e-40   Brassica napus [oilseed rape]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         152   3e-40   Brassica rapa
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             149   4e-40   
emb|CDY28217.1|  BnaA01g06320D                                          151   5e-40   Brassica napus [oilseed rape]
emb|CDY32091.1|  BnaC04g44750D                                          137   6e-40   Brassica napus [oilseed rape]
emb|CDX68695.1|  BnaC01g07580D                                          151   7e-40   
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       150   8e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       139   8e-40   Medicago truncatula
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         137   9e-40   Brassica rapa
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             150   9e-40   Prunus persica
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            150   9e-40   Prunus mume [ume]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    129   1e-39   Glycine max [soybeans]
emb|CDY40438.1|  BnaA04g20790D                                          136   1e-39   Brassica napus [oilseed rape]
gb|KJB76660.1|  hypothetical protein B456_012G098600                    149   2e-39   Gossypium raimondii
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    149   2e-39   Hordeum vulgare [barley]
dbj|BAJ99024.1|  predicted protein                                      149   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         134   3e-39   Sesamum indicum [beniseed]
dbj|BAK02147.1|  predicted protein                                      149   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       149   3e-39   Oryza brachyantha
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            149   3e-39   Brachypodium distachyon [annual false brome]
emb|CBI36578.3|  unnamed protein product                                149   4e-39   Vitis vinifera
gb|AES66787.2|  serine carboxypeptidase-like protein                    139   5e-39   Medicago truncatula
ref|XP_003596536.1|  Serine carboxypeptidase                            139   5e-39   
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            149   6e-39   Vitis vinifera
gb|KJB76659.1|  hypothetical protein B456_012G098600                    149   6e-39   Gossypium raimondii
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    132   6e-39   Glycine max [soybeans]
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         131   8e-39   Gossypium arboreum [tree cotton]
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    148   9e-39   Theobroma cacao [chocolate]
ref|NP_001057009.1|  Os06g0186400                                       148   1e-38   
ref|NP_181121.1|  serine carboxypeptidase-like 26                       135   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002534550.1|  serine carboxypeptidase, putative                  137   1e-38   
gb|KJB78940.1|  hypothetical protein B456_013G026200                    130   1e-38   Gossypium raimondii
gb|KEH38195.1|  serine carboxypeptidase-like protein                    133   2e-38   Medicago truncatula
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    134   2e-38   Arabis alpina [alpine rockcress]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    130   2e-38   Gossypium raimondii
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       132   2e-38   Medicago truncatula
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         138   2e-38   Pyrus x bretschneideri [bai li]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    130   2e-38   Gossypium raimondii
gb|KJB78942.1|  hypothetical protein B456_013G026200                    130   2e-38   Gossypium raimondii
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             134   2e-38   Eutrema salsugineum [saltwater cress]
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         147   2e-38   Gossypium arboreum [tree cotton]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             133   3e-38   Capsella rubella
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         124   3e-38   Glycine soja [wild soybean]
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             135   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             135   4e-38   
gb|KHN02055.1|  Serine carboxypeptidase II-2                            146   4e-38   Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       146   4e-38   Glycine max [soybeans]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         129   5e-38   Glycine soja [wild soybean]
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         134   6e-38   Populus euphratica
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             129   6e-38   Phaseolus vulgaris [French bean]
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             134   7e-38   
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          134   7e-38   Arabidopsis lyrata subsp. petraea
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               132   7e-38   Medicago truncatula
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         131   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             127   8e-38   Eutrema salsugineum [saltwater cress]
gb|ABK24285.1|  unknown                                                 145   9e-38   Picea sitchensis
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    129   1e-37   Glycine max [soybeans]
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         134   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         129   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    133   1e-37   Cucumis sativus [cucumbers]
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         135   1e-37   Brassica rapa
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         131   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         131   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         131   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         134   2e-37   Populus euphratica
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         133   2e-37   Cucumis melo [Oriental melon]
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          129   2e-37   
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          129   3e-37   
emb|CDY40439.1|  BnaA04g20780D                                          134   3e-37   Brassica napus [oilseed rape]
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         134   4e-37   Malus domestica [apple tree]
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    135   4e-37   
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    123   4e-37   Arabis alpina [alpine rockcress]
gb|AFK37459.1|  unknown                                                 130   4e-37   Lotus japonicus
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         134   5e-37   Eucalyptus grandis [rose gum]
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                132   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         133   6e-37   Nicotiana tomentosiformis
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          130   6e-37   Amborella trichopoda
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         132   6e-37   Nicotiana sylvestris
emb|CBI31484.3|  unnamed protein product                                131   7e-37   Vitis vinifera
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         131   7e-37   Vitis vinifera
gb|KJB76572.1|  hypothetical protein B456_012G095000                    134   8e-37   Gossypium raimondii
gb|KJB76571.1|  hypothetical protein B456_012G095000                    134   9e-37   Gossypium raimondii
gb|AES62200.2|  serine carboxypeptidase-like protein                    123   1e-36   Medicago truncatula
gb|AFK43035.1|  unknown                                                 122   2e-36   Medicago truncatula
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               122   2e-36   
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               122   2e-36   Medicago truncatula
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    135   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    134   2e-36   Nelumbo nucifera [Indian lotus]
gb|EPS66906.1|  hypothetical protein M569_07869                         130   2e-36   Genlisea aurea
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    125   2e-36   Brassica rapa
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    125   2e-36   
ref|NP_187456.1|  serine carboxypeptidase-like 27                       127   3e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35977.1|  BnaA05g29730D                                          125   3e-36   Brassica napus [oilseed rape]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         129   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY28004.1|  BnaC05g44060D                                          125   4e-36   Brassica napus [oilseed rape]
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         140   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         125   4e-36   Camelina sativa [gold-of-pleasure]
emb|CDP11023.1|  unnamed protein product                                140   5e-36   Coffea canephora [robusta coffee]
gb|KJB77375.1|  hypothetical protein B456_012G134700                    131   5e-36   Gossypium raimondii
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    140   5e-36   
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         129   7e-36   Camelina sativa [gold-of-pleasure]
ref|NP_181120.2|  serine carboxypeptidase-like 28                       128   8e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75200.1|  hypothetical protein VITISV_014887                     140   9e-36   Vitis vinifera
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         126   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         126   1e-35   Camelina sativa [gold-of-pleasure]
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         132   1e-35   Jatropha curcas
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         132   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             129   2e-35   
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         129   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               123   3e-35   Medicago truncatula
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             128   3e-35   Capsella rubella
emb|CBI21207.3|  unnamed protein product                                129   4e-35   Vitis vinifera
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         129   4e-35   Vitis vinifera
gb|ABR16028.1|  unknown                                                 123   4e-35   Picea sitchensis
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         128   4e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    124   5e-35   Cicer arietinum [garbanzo]
gb|KJB07560.1|  hypothetical protein B456_001G032600                    130   5e-35   Gossypium raimondii
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    124   5e-35   
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             124   5e-35   
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         137   6e-35   
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             124   6e-35   
gb|KJB07564.1|  hypothetical protein B456_001G032600                    130   6e-35   Gossypium raimondii
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             128   6e-35   Eutrema salsugineum [saltwater cress]
gb|KJB07559.1|  hypothetical protein B456_001G032600                    130   7e-35   Gossypium raimondii
gb|KJB07562.1|  hypothetical protein B456_001G032600                    130   7e-35   Gossypium raimondii
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         137   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         133   7e-35   Elaeis guineensis
dbj|BAK05698.1|  predicted protein                                      127   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         137   9e-35   Fragaria vesca subsp. vesca
gb|KEH32355.1|  serine carboxypeptidase-like protein                    124   1e-34   Medicago truncatula
gb|AEX12772.1|  hypothetical protein 2_8315_02                          129   1e-34   Pinus taeda
gb|AEX12786.1|  hypothetical protein 2_8315_02                          129   1e-34   Pinus radiata
gb|AAM15112.1|  putative serine carboxypeptidase II                     128   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AEX12770.1|  hypothetical protein 2_8315_02                          129   1e-34   Pinus taeda
emb|CDO99728.1|  unnamed protein product                                127   1e-34   Coffea canephora [robusta coffee]
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          131   1e-34   Arabidopsis lyrata subsp. petraea
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         128   1e-34   Fragaria vesca subsp. vesca
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         125   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         136   2e-34   Eucalyptus grandis [rose gum]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             124   2e-34   Arabidopsis lyrata subsp. lyrata
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  125   2e-34   Citrus sinensis [apfelsine]
ref|XP_002520355.1|  serine carboxypeptidase, putative                  128   2e-34   
emb|CDO99730.1|  unnamed protein product                                135   2e-34   Coffea canephora [robusta coffee]
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    127   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    127   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         135   2e-34   Populus euphratica
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         126   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006467848.1|  PREDICTED: serine carboxypeptidase-like 31-like    124   3e-34   Citrus sinensis [apfelsine]
ref|XP_006449285.1|  hypothetical protein CICLE_v10015093mg             124   3e-34   Citrus clementina [clementine]
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         126   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          130   3e-34   Sorghum bicolor [broomcorn]
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                130   4e-34   Gossypium arboreum [tree cotton]
ref|XP_010501423.1|  PREDICTED: serine carboxypeptidase-like 31         125   4e-34   
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         122   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       124   4e-34   Glycine max [soybeans]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         135   4e-34   Populus trichocarpa [western balsam poplar]
dbj|BAO04184.1|  hypothetical protein                                   125   4e-34   Delphinium grandiflorum
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    132   4e-34   
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             124   5e-34   Phaseolus vulgaris [French bean]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         134   5e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       128   5e-34   Phoenix dactylifera
gb|KHN35601.1|  Serine carboxypeptidase II-3                            124   5e-34   Glycine soja [wild soybean]
emb|CBI18754.3|  unnamed protein product                                125   5e-34   Vitis vinifera
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          125   5e-34   
ref|XP_008801741.1|  PREDICTED: serine carboxypeptidase-like 33 i...    122   6e-34   Phoenix dactylifera
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    124   6e-34   
ref|XP_008801742.1|  PREDICTED: serine carboxypeptidase-like 33 i...    122   6e-34   Phoenix dactylifera
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         134   6e-34   Prunus mume [ume]
emb|CAN82217.1|  hypothetical protein VITISV_020424                     125   7e-34   Vitis vinifera
ref|XP_010645362.1|  PREDICTED: serine carboxypeptidase-like 31         125   7e-34   
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         125   7e-34   Nicotiana tomentosiformis
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         124   7e-34   Nicotiana sylvestris
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    134   7e-34   Fragaria vesca subsp. vesca
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             124   7e-34   Eutrema salsugineum [saltwater cress]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         134   8e-34   Populus euphratica
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    126   9e-34   Arabis alpina [alpine rockcress]
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         127   9e-34   Setaria italica
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   134   1e-33   Citrus sinensis [apfelsine]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    134   1e-33   Fragaria vesca subsp. vesca
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              125   1e-33   Sesamum indicum [beniseed]
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          127   1e-33   Amborella trichopoda
ref|XP_010458486.1|  PREDICTED: serine carboxypeptidase-like 31         124   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010278297.1|  PREDICTED: serine carboxypeptidase-like 31         122   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    130   1e-33   Glycine max [soybeans]
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       125   1e-33   Phoenix dactylifera
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             134   1e-33   Citrus clementina [clementine]
emb|CDY43258.1|  BnaC05g48510D                                          122   1e-33   Brassica napus [oilseed rape]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     134   1e-33   Eucalyptus grandis [rose gum]
gb|KEH32356.1|  serine carboxypeptidase-like protein                    120   1e-33   Medicago truncatula
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       126   1e-33   
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    126   2e-33   Vitis vinifera
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         126   2e-33   Glycine max [soybeans]
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         133   2e-33   Jatropha curcas
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         121   2e-33   Brassica rapa
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    120   2e-33   Solanum tuberosum [potatoes]
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    131   2e-33   
gb|KDP20920.1|  hypothetical protein JCGZ_21391                         124   2e-33   Jatropha curcas
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    131   2e-33   Elaeis guineensis
ref|XP_008806723.1|  PREDICTED: serine carboxypeptidase-like 33 i...    118   2e-33   Phoenix dactylifera
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              124   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          128   2e-33   
ref|XP_010914643.1|  PREDICTED: serine carboxypeptidase-like 33         119   2e-33   Elaeis guineensis
gb|ABR16596.1|  unknown                                                 130   2e-33   Picea sitchensis
ref|XP_008806724.1|  PREDICTED: serine carboxypeptidase-like 33 i...    118   2e-33   
gb|ABR16997.1|  unknown                                                 130   2e-33   Picea sitchensis
ref|XP_006392053.1|  hypothetical protein EUTSA_v10023955mg             124   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   125   3e-33   Populus trichocarpa [western balsam poplar]
dbj|BAJ92218.1|  predicted protein                                      127   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                125   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         123   3e-33   Citrus sinensis [apfelsine]
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    123   3e-33   Cicer arietinum [garbanzo]
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    129   3e-33   
gb|KHN42831.1|  Serine carboxypeptidase 24                              129   3e-33   Glycine soja [wild soybean]
emb|CAN79972.1|  hypothetical protein VITISV_010072                     125   3e-33   Vitis vinifera
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         132   3e-33   Eucalyptus grandis [rose gum]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    132   3e-33   Solanum tuberosum [potatoes]
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    129   3e-33   Nicotiana sylvestris
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    122   3e-33   
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         132   3e-33   
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       127   3e-33   
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    129   3e-33   
gb|AFW56972.1|  hypothetical protein ZEAMMB73_293605                    122   4e-33   
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         120   4e-33   
gb|ACN34203.1|  unknown                                                 127   4e-33   
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             123   4e-33   
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             123   5e-33   
gb|KJB07563.1|  hypothetical protein B456_001G032600                    124   5e-33   
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       123   5e-33   
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       130   5e-33   
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    132   5e-33   
ref|XP_003529505.1|  PREDICTED: serine carboxypeptidase-like 33-l...    123   5e-33   
ref|XP_006301480.1|  hypothetical protein CARUB_v10021903mg             123   5e-33   
ref|XP_008663967.1|  PREDICTED: serine carboxypeptidase-like 34         122   5e-33   
gb|KHN05141.1|  Serine carboxypeptidase II-3                            123   6e-33   
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    132   6e-33   
ref|XP_003550568.2|  PREDICTED: serine carboxypeptidase-like 33-like    120   6e-33   
gb|KHN03262.1|  Serine carboxypeptidase-like 33                         120   6e-33   
ref|XP_010108549.1|  Serine carboxypeptidase 24                         123   6e-33   
gb|KHN02864.1|  Serine carboxypeptidase-like 33                         123   7e-33   
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         124   7e-33   
emb|CDO99599.1|  unnamed protein product                                124   7e-33   
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             122   7e-33   
ref|NP_001047514.1|  Os02g0634700                                       124   7e-33   
ref|XP_002886559.1|  serine carboxypeptidase S10 family protein         121   7e-33   
ref|XP_007154418.1|  hypothetical protein PHAVU_003G118000g             122   7e-33   
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   130   7e-33   
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    125   7e-33   
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             131   8e-33   
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         121   8e-33   
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             131   8e-33   
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         125   9e-33   
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    123   9e-33   
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         123   9e-33   
gb|EEC69980.1|  hypothetical protein OsI_00486                          131   9e-33   
ref|XP_004967063.1|  PREDICTED: serine carboxypeptidase-like 34-like    124   9e-33   
ref|XP_010688683.1|  PREDICTED: serine carboxypeptidase-like 34         124   9e-33   
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    119   9e-33   
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         124   1e-32   
ref|XP_010533891.1|  PREDICTED: serine carboxypeptidase-like 31 i...    123   1e-32   
gb|KJB77374.1|  hypothetical protein B456_012G134700                    131   1e-32   
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    131   1e-32   
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       121   1e-32   
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    119   1e-32   
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       123   1e-32   
gb|KHN05312.1|  Serine carboxypeptidase II-3                            121   1e-32   
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         131   1e-32   
gb|AES71591.2|  serine carboxypeptidase-like protein                    123   1e-32   
ref|NP_001044713.1|  Os01g0833500                                       119   1e-32   
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    130   1e-32   
ref|XP_002892617.1|  hypothetical protein ARALYDRAFT_471242             124   1e-32   
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               123   1e-32   
gb|EAY76388.1|  hypothetical protein OsI_04319                          119   1e-32   
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         130   1e-32   
gb|AAQ63884.1|  putative serine carboxypeptidase                        123   1e-32   
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             130   1e-32   
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         125   1e-32   
ref|XP_009104389.1|  PREDICTED: serine carboxypeptidase-like 32         124   1e-32   
gb|EPS67442.1|  hypothetical protein M569_07330                         118   1e-32   
ref|XP_009393156.1|  PREDICTED: serine carboxypeptidase-like 33         118   1e-32   
ref|XP_006303173.1|  hypothetical protein CARUB_v10008980mg             125   1e-32   
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          126   1e-32   
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           122   1e-32   
ref|NP_001140896.1|  hypothetical protein precursor                     127   1e-32   
gb|KJB77373.1|  hypothetical protein B456_012G134700                    130   1e-32   
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          122   2e-32   
ref|XP_006303174.1|  hypothetical protein CARUB_v10008980mg             125   2e-32   
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    130   2e-32   
emb|CDX72256.1|  BnaC07g42780D                                          127   2e-32   
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         130   2e-32   
gb|KJB76564.1|  hypothetical protein B456_012G094900                    129   2e-32   
gb|KJB76565.1|  hypothetical protein B456_012G094900                    129   2e-32   
ref|NP_001150705.1|  LOC100284338 precursor                             127   2e-32   
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               125   2e-32   
ref|XP_006847849.1|  hypothetical protein AMTR_s00029p00064790          123   2e-32   
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    130   2e-32   
ref|XP_006301500.1|  hypothetical protein CARUB_v10021926mg             124   3e-32   
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             129   3e-32   
dbj|BAB08188.1|  unnamed protein product                                129   3e-32   
ref|NP_194790.1|  serine carboxypeptidase 24                            122   3e-32   
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    122   3e-32   
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         130   3e-32   
ref|NP_001042076.1|  Os01g0158200                                       129   3e-32   
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         126   3e-32   
ref|NP_001152245.1|  lysosomal protective protein precursor             130   3e-32   
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         130   3e-32   
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         130   3e-32   
emb|CBI29056.3|  unnamed protein product                                130   3e-32   
ref|XP_010468839.1|  PREDICTED: serine carboxypeptidase-like 40         130   3e-32   
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    115   3e-32   
ref|XP_003542771.1|  PREDICTED: serine carboxypeptidase-like 31-like    122   3e-32   
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             120   3e-32   
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    122   3e-32   
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         129   4e-32   
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    125   4e-32   
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         129   4e-32   
ref|XP_010512774.1|  PREDICTED: serine carboxypeptidase-like 40 i...    129   4e-32   
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       122   4e-32   
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    120   4e-32   
ref|NP_191906.1|  serine carboxypeptidase-like 40                       129   4e-32   
ref|XP_010418062.1|  PREDICTED: serine carboxypeptidase-like 32         121   4e-32   
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       123   4e-32   
gb|KEH30582.1|  serine carboxypeptidase-like protein                    124   4e-32   
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               124   4e-32   
ref|XP_010918382.1|  PREDICTED: serine carboxypeptidase-like 34 i...    122   4e-32   
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         117   4e-32   
gb|KJB79850.1|  hypothetical protein B456_013G069700                    129   4e-32   
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    129   4e-32   
ref|XP_010473313.1|  PREDICTED: serine carboxypeptidase-like 32         121   5e-32   
ref|XP_010475997.1|  PREDICTED: serine carboxypeptidase-like 31         124   5e-32   
ref|XP_011010904.1|  PREDICTED: serine carboxypeptidase-like 33         120   5e-32   
ref|XP_010431670.1|  PREDICTED: serine carboxypeptidase-like 32         121   5e-32   
ref|XP_010918383.1|  PREDICTED: serine carboxypeptidase-like 34 i...    122   5e-32   
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       124   5e-32   
ref|NP_172575.2|  serine carboxypeptidase-like 31                       124   5e-32   
ref|NP_001184957.1|  serine carboxypeptidase-like 31                    124   5e-32   
ref|XP_006292523.1|  hypothetical protein CARUB_v10018754mg             129   5e-32   
ref|XP_008802653.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    124   5e-32   
ref|XP_010229696.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    115   5e-32   
ref|XP_003543072.1|  PREDICTED: serine carboxypeptidase-like 31-l...    121   5e-32   
ref|XP_010473314.1|  PREDICTED: serine carboxypeptidase-like 32         118   5e-32   
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               120   6e-32   
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     127   6e-32   
ref|XP_011100722.1|  PREDICTED: serine carboxypeptidase-like 33         120   6e-32   
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       124   6e-32   
gb|AAB65475.1|  Serine carboxypeptidase isolog; 30227-33069             124   6e-32   
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     124   6e-32   
gb|ACL53740.1|  unknown                                                 127   6e-32   
gb|KJB76570.1|  hypothetical protein B456_012G095000                    117   6e-32   
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              129   7e-32   
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       124   7e-32   
ref|XP_003543073.1|  PREDICTED: serine carboxypeptidase-like 31-l...    121   7e-32   
ref|XP_010068956.1|  PREDICTED: serine carboxypeptidase-like 40         126   7e-32   
ref|XP_010270860.1|  PREDICTED: serine carboxypeptidase-like 33         119   8e-32   
ref|XP_002280311.1|  PREDICTED: serine carboxypeptidase-like 33 i...    121   8e-32   
ref|XP_010279511.1|  PREDICTED: serine carboxypeptidase-like 40 i...    129   8e-32   
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              119   8e-32   
ref|XP_002521402.1|  serine carboxypeptidase, putative                  124   9e-32   
ref|XP_003593500.1|  Serine carboxypeptidase-like protein               123   9e-32   
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    125   9e-32   
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    125   9e-32   
ref|XP_010315499.1|  PREDICTED: serine carboxypeptidase II-3-like       121   9e-32   
gb|KJB69468.1|  hypothetical protein B456_011G025000                    120   9e-32   
ref|XP_009592799.1|  PREDICTED: serine carboxypeptidase-like 40         125   9e-32   
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       120   1e-31   
gb|KJB76567.1|  hypothetical protein B456_012G094900                    128   1e-31   
gb|KJB76563.1|  hypothetical protein B456_012G094900                    128   1e-31   
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         128   1e-31   
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       120   1e-31   
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         128   1e-31   
gb|KJB76566.1|  hypothetical protein B456_012G094900                    128   1e-31   
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         122   1e-31   
dbj|BAK02399.1|  predicted protein                                      128   1e-31   
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       125   1e-31   
ref|XP_002317229.2|  serine carboxypeptidase S10 family protein         122   1e-31   
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         128   1e-31   
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    127   1e-31   
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         128   1e-31   
gb|KEH21654.1|  serine carboxypeptidase-like protein                    123   1e-31   
gb|EMT05424.1|  Serine carboxypeptidase II-3                            120   1e-31   
ref|XP_010533892.1|  PREDICTED: serine carboxypeptidase-like 31 i...    119   1e-31   
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    122   1e-31   
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         128   1e-31   
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    122   1e-31   
gb|ACJ85847.1|  unknown                                                 122   1e-31   
ref|XP_007025718.1|  Serine carboxypeptidase-like 31                    120   1e-31   
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          127   1e-31   
ref|XP_008654562.1|  PREDICTED: uncharacterized protein LOC100273...    126   1e-31   
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         117   1e-31   
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         128   2e-31   
emb|CBI19568.3|  unnamed protein product                                124   2e-31   
gb|ACU18095.1|  unknown                                                 120   2e-31   
ref|XP_002445202.1|  hypothetical protein SORBIDRAFT_07g005800          120   2e-31   
ref|XP_006347176.1|  PREDICTED: serine carboxypeptidase-like 31-like    121   2e-31   
emb|CAN74854.1|  hypothetical protein VITISV_028701                     127   2e-31   
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    128   2e-31   
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    120   2e-31   
ref|XP_008797239.1|  PREDICTED: serine carboxypeptidase-like 34         120   2e-31   
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         123   2e-31   
gb|KFK40732.1|  hypothetical protein AALP_AA2G034000                    122   2e-31   
ref|XP_010316720.1|  PREDICTED: serine carboxypeptidase-like 31         120   2e-31   
ref|XP_002529402.1|  serine carboxypeptidase, putative                  127   2e-31   
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    119   2e-31   
dbj|BAJ85578.1|  predicted protein                                      127   2e-31   
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         127   2e-31   
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         120   2e-31   
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          127   2e-31   
ref|XP_007159282.1|  hypothetical protein PHAVU_002G224800g             120   2e-31   
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     127   2e-31   
ref|XP_003560572.1|  PREDICTED: serine carboxypeptidase-like 34         119   2e-31   
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             120   2e-31   
ref|NP_193246.2|  serine carboxypeptidase-like 30                       122   2e-31   
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         127   2e-31   
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       123   2e-31   
ref|XP_009398853.1|  PREDICTED: serine carboxypeptidase-like 35         122   2e-31   
ref|XP_008812782.1|  PREDICTED: serine carboxypeptidase-like 34         127   2e-31   
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         122   2e-31   
ref|XP_003601337.1|  Serine carboxypeptidase-like protein               118   2e-31   
emb|CDY03789.1|  BnaC01g29060D                                          120   2e-31   
ref|XP_002876371.1|  predicted protein                                  119   2e-31   
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         125   3e-31   
ref|XP_006417391.1|  hypothetical protein EUTSA_v10007471mg             120   3e-31   
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       117   3e-31   
gb|AES71588.2|  serine carboxypeptidase-like protein                    118   3e-31   
ref|XP_006297573.1|  hypothetical protein CARUB_v10013596mg             118   3e-31   
gb|KGN58552.1|  hypothetical protein Csa_3G681160                       122   3e-31   
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    127   3e-31   
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     127   3e-31   
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    118   3e-31   
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         127   3e-31   
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    120   3e-31   
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         127   3e-31   
emb|CDY68103.1|  BnaCnng57600D                                          122   3e-31   
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         119   3e-31   
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    127   3e-31   
emb|CDY39224.1|  BnaA03g50360D                                          124   3e-31   
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         123   3e-31   
ref|XP_010495900.1|  PREDICTED: putative serine carboxypeptidase-...    119   3e-31   
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          127   3e-31   



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   160 bits (405),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK++Y NPYSW
Sbjct  70   GRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGKSIYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+DSPAGVG+SYSNTSSD+ T+GD
Sbjct  130  NKAANILFLDSPAGVGFSYSNTSSDLFTNGD  160


 Score = 68.6 bits (166),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 8/74 (11%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  205
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  206  GYVTVNQESGRALF  247
            GY TVN+ESGRALF
Sbjct  61   GYATVNKESGRALF  74



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   160 bits (404),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY NPYSW
Sbjct  67   GRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD L +GD
Sbjct  127  NKVANILFLDSPVGVGFSYSNTSSDSLNNGD  157


 Score = 64.7 bits (156),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 46/71 (65%), Gaps = 5/71 (7%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  215  TVNQESGRALF  247
            TVN+ESGRALF
Sbjct  61   TVNKESGRALF  71



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   153 bits (387),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  101  GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  160

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSDI T+GD
Sbjct  161  NQVANILFLDSPVGVGFSYSNTSSDITTNGD  191


 Score = 65.1 bits (157),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALF  105



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   164 bits (415),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPY
Sbjct  66   KLGRALFYWFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  AN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  126  SWNQVANVLFLDAPVGVGYSYSNTSSDLLTNGD  158


 Score = 54.7 bits (130),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALF
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALF  72



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   155 bits (393),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSW
Sbjct  64   GRALFYWFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+D P GVG+SYSNTSSD+LT+GD
Sbjct  124  NQVANVLFLDMPVGVGFSYSNTSSDLLTNGD  154


 Score = 62.8 bits (151),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALF
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALF  68



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   150 bits (378),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDPSSKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY N YSW
Sbjct  80   GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKADGKTLYLNQYSW  139

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSN S D+L +GD
Sbjct  140  NQVANVLFLESPVGVGFSYSNNSLDVLNNGD  170


 Score = 64.3 bits (155),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALF
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALF  84



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  62   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLA  121

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            AN+LF+DSP GVGYSYSNTSSD L +GD
Sbjct  122  ANVLFLDSPVGVGYSYSNTSSDHLNNGD  149


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALF   
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  257  L*GCGGP  277
                  P
Sbjct  67   FEAVDDP  73



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   157 bits (398),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  +FYWFFEA EDPSSKPL+LWLNGGPGCSSIA+GLAEEVGPFH+EKDGKTLY N +SW
Sbjct  39   GRAYFYWFFEADEDPSSKPLLLWLNGGPGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSW  98

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LFVDSP GVG+SYSNTSSD+L +GD
Sbjct  99   NKVANVLFVDSPVGVGFSYSNTSSDLLNNGD  129


 Score = 55.8 bits (133),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA F
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYF  43



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   157 bits (398),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  59   KLGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+L++GD
Sbjct  119  SWNQAANILFLDAPVGVGYSYSNTSSDLLSNGD  151


 Score = 55.5 bits (132),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  67   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNPYSWNLA  126

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            ANLLF+DSP GVGYSYSNTSSD L +GD
Sbjct  127  ANLLFLDSPVGVGYSYSNTSSDHLNNGD  154


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFLLVL*GCGGP  277
            +ES RALF         P
Sbjct  61   EESERALFYWFFEAVDDP  78



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  62   LFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLA  121

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            AN+LF+DSP GVGYSYSNTSSD L +GD
Sbjct  122  ANVLFLDSPVGVGYSYSNTSSDHLNNGD  149


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALF   
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  257  L*GCGGP  277
                  P
Sbjct  67   FEAVDDP  73



>gb|KDP38716.1| hypothetical protein JCGZ_04069 [Jatropha curcas]
Length=266

 Score =   147 bits (371),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  FFYWF EAVEDP SKPLVLWLNG PGCSSI +G AEEVG F+++ DGKTLY NPYSW
Sbjct  76   GRAFFYWFMEAVEDPESKPLVLWLNGRPGCSSIGYGEAEEVGLFYIQADGKTLYLNPYSW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD+L +GD
Sbjct  136  NNVANILFIDSPVGVGFSYSNTSSDVLNNGD  166


 Score = 65.1 bits (157),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 9/64 (14%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            CL F++ L      G G     S  + QQ+LD VL LPG  F+VSFAHYSGYVTVN+ESG
Sbjct  21   CLFFLINLYV----GTGVAFSLSDPIAQQELDRVLGLPGQTFDVSFAHYSGYVTVNEESG  76

Query  236  RALF  247
            RA F
Sbjct  77   RAFF  80



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   153 bits (387),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP SKPLVLWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSW
Sbjct  64   GRALFYWFFEAVEDPVSKPLVLWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSN S D+L++GD
Sbjct  124  NQVANILFLDSPVGVGFSYSNNSQDVLSNGD  154


 Score = 58.5 bits (140),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALF
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALF  68



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +3

Query  243  FFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLA  422
             FYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNPYSWNLA
Sbjct  67   LFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNPYSWNLA  126

Query  423  ANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            ANLLF+DSP GVGYSYSNTSSD L +GD
Sbjct  127  ANLLFLDSPVGVGYSYSNTSSDHLNNGD  154


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  224  QESGRALFLLVL*GCGGP  277
            +ES RALF         P
Sbjct  61   EESERALFYWFFEAVDEP  78



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   147 bits (371),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKPLVLWLNGGPGCSSIA+G+AEE+GPFH+  D  +LY NPYSW
Sbjct  68   GRSLFYWFTEAAEDPDSKPLVLWLNGGPGCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NL ANLLF+DSP GVG+SYSNTSSD+L +GD
Sbjct  127  NLVANLLFIDSPVGVGFSYSNTSSDLLNNGD  157


 Score = 63.5 bits (153),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LF
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLF  72



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   154 bits (389),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+W
Sbjct  65   GRALFYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LFVD+PAGVG+SYSNTSSD+L HGD
Sbjct  125  NQVANILFVDAPAGVGFSYSNTSSDLLNHGD  155


 Score = 56.6 bits (135),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  245  FLLVL  259
            F   +
Sbjct  69   FYWFM  73



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   147 bits (371),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKPLVLWLNGGPGCSSIA+G+AEE+GPFH+  D  +LY NPYSW
Sbjct  68   GRSLFYWFTEAAEDPDSKPLVLWLNGGPGCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NL ANLLF+DSP GVG+SYSNTSSD+L +GD
Sbjct  127  NLVANLLFIDSPVGVGFSYSNTSSDLLNNGD  157


 Score = 63.5 bits (153),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LF
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLF  72



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   156 bits (395),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  62   KLGRALFYWFFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  121

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+ T+GD
Sbjct  122  SWNQAANILFLDAPVGVGYSYSNTSSDLQTNGD  154


 Score = 53.9 bits (128),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
              L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALF
Sbjct  11   NALIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALF  68



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   150 bits (379),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIAFG AEE+GPFH+  DGK++Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAFGEAEEIGPFHINADGKSVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GD
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGD  154


 Score = 59.7 bits (143),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   149 bits (376),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK++Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKSVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GD
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGD  154


 Score = 59.7 bits (143),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   149 bits (375),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK +Y NPYSW
Sbjct  138  GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSW  197

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GD
Sbjct  198  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGD  228


 Score = 60.1 bits (144),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  106  QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  142



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   154 bits (389),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GD
Sbjct  122  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGD  155


 Score = 53.5 bits (127),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  33   QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALF  69



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   154 bits (390),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  62   KLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  121

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+ T+GD
Sbjct  122  SWNQAANILFLDAPVGVGYSYSNTSSDLQTNGD  154


 Score = 53.5 bits (127),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  32   QKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALF  68



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   154 bits (388),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  61   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GD
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKTNGD  154


 Score = 53.9 bits (128),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVTTNEKLGRALF  68



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   148 bits (373),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA ED +SKPLVLWLNGGPGCSSIA+G AEE+GPFH+  DGK +Y NPYSW
Sbjct  64   GRALFYWFFEATEDSASKPLVLWLNGGPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SYSNTSSD++ +GD
Sbjct  124  NEVANVLFLDSPAGVGFSYSNTSSDLMNNGD  154


 Score = 59.7 bits (143),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALF
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALF  68



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   153 bits (386),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N Y
Sbjct  59   KLGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  AN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  119  SWNQVANILFLDAPVGVGYSYSNTSSDLLTNGD  151


 Score = 54.3 bits (129),  Expect(2) = 8e-45, Method: Composition-based stats.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   154 bits (389),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  80   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQ  139

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GD
Sbjct  140  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGD  173


 Score = 52.0 bits (123),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  F+VSFAHYSG+VT N++ GRALF
Sbjct  51   QKEQDKVSKLPGQNFDVSFAHYSGFVTTNEKLGRALF  87



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   153 bits (386),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N 
Sbjct  58   EKLGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQ  117

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN  AN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  118  YSWNQVANILFLDAPVGVGYSYSNTSSDLLTNGD  151


 Score = 52.8 bits (125),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   153 bits (386),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N 
Sbjct  58   EKLGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQ  117

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN  AN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  118  YSWNQVANILFLDAPVGVGYSYSNTSSDLLTNGD  151


 Score = 52.8 bits (125),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  229
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  230  SGRALF  247
             GRALF
Sbjct  60   LGRALF  65



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   152 bits (385),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  61   KLGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  120

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+ ++GD
Sbjct  121  SWNQAANILFLDAPVGVGYSYSNTSSDLRSNGD  153


 Score = 52.8 bits (125),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  31   QKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALF  67



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   151 bits (382),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  60   KLGRALFYWFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTS+D+ ++GD
Sbjct  120  SWNQAANILFLDAPVGVGYSYSNTSTDLRSNGD  152


 Score = 53.1 bits (126),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  30   QKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALF  66



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   151 bits (382),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GD
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGD  154


 Score = 52.4 bits (124),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   152 bits (384),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYWFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N Y
Sbjct  60   KLGRALFYWFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+ ++GD
Sbjct  120  SWNQAANILFLDAPVGVGYSYSNTSSDLRSNGD  152


 Score = 50.8 bits (120),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNV F HYSG+VT N++ GRALF
Sbjct  30   QKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALF  66



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   151 bits (381),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GD
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGD  154


 Score = 52.0 bits (123),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D V  LPG  FNVSFAHYSG+V  N++ GRALF
Sbjct  32   QKEQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALF  68



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   151 bits (382),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW FEA ED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLFEATEDAESKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GD
Sbjct  122  YSWNQAANILFLDAPVGVGYSYSNTSSDLRSNGD  155


 Score = 50.4 bits (119),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q+  D V  LPG  FNV FAHYSG+VT N++ GRALF
Sbjct  33   QKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALF  69



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTLY NPYSW
Sbjct  74   GRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTLYLNPYSW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLFVDSP GVG+SYSNTSSD+L +GD
Sbjct  134  NQVANLLFVDSPVGVGFSYSNTSSDLLNNGD  164


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            +  V QQ LD VL+LPG  FN+SFAHYSGYVTVNQESGR LF   +     P
Sbjct  37   TDPVAQQGLDRVLELPGQTFNISFAHYSGYVTVNQESGRNLFYWFMEAVEDP  88



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK LY NPYSW
Sbjct  66   GRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+DSP GVGYSYSNT SD L +GD
Sbjct  126  NQAANMLFLDSPVGVGYSYSNTPSDHLNNGD  156


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 11/93 (12%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  211
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  212  VTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            VTVN+E+GR LF         P   AS  L  W
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDP---ASKPLVLW  88



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSDI T+GD
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGD  156


 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTSSD+L +GD
Sbjct  132  NQVANILFLDSPVGVGYSYSNTSSDLLNNGD  162


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTSSD+L +GD
Sbjct  132  NQVANILFLDSPVGVGYSYSNTSSDLLNNGD  162


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSW
Sbjct  64   GRALFYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD++++GD
Sbjct  124  NQVANILFLDSPVGVGFSYSNTSSDLMSNGD  154


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRALF   +     P
Sbjct  32   QQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRALFYWFVEAAEDP  78



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+L LNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVGYSYSNTSSD+L +GD
Sbjct  132  NQVANILFLDSPAGVGYSYSNTSSDLLNNGD  162


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   143 bits (361),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSW
Sbjct  64   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+D+P GVG+SYSN  S++L +GD
Sbjct  124  NRVANILFLDTPVGVGFSYSNNGSELLNNGD  154


 Score = 52.4 bits (124),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LF
Sbjct  32   QQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLF  68



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   142 bits (358),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG TLY NPYS
Sbjct  79   GRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDGNTLYLNPYS  138

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  AN+LFVDSP GVG+SYSNTSS++L +GD
Sbjct  139  WNQVANILFVDSPVGVGFSYSNTSSELLNNGD  170


 Score = 53.5 bits (127),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +2

Query  47   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  205
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  206  GYVTVNQESGRALF  247
            GY+TVN+++GR LF
Sbjct  70   GYITVNEDTGRNLF  83



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   150 bits (378),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPLVLWLNGGPGCSSIA+GL EEVGPFHV  DGK ++ NPYSW
Sbjct  65   GAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLFVDSP GVGYSYSNTS DIL +GD
Sbjct  125  NKVANLLFVDSPVGVGYSYSNTSDDILRNGD  155


 Score = 45.8 bits (107),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALF
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALF  69



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+W
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSN S D+LT+GD
Sbjct  126  NQVANILFLDSPVGVGFSYSNNSQDVLTNGD  156


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCS  298
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALF         P   AS  
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDP---ASKP  84

Query  299  LAQW  310
            L  W
Sbjct  85   LVLW  88



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSW
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+DSP GVG+SYSN S D+L++GD
Sbjct  126  NQAANILFLDSPVGVGFSYSNNSQDVLSNGD  156


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALF   
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  L*GCGGPFF*ASCSLAQW  310
                  P   AS  L  W
Sbjct  74   FEAVEDP---ASKPLVLW  88



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSDI T+GD
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGD  156


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            +  V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF   +     P
Sbjct  29   TDPVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDP  80



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSDI T+GD
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGD  156


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  63   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD+ T+GD
Sbjct  123  NQVANILFLDSPVGVGFSYSNTSSDVSTNGD  153


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFLLVL*GCGGP  277
             SGRALF   +     P
Sbjct  61   NSGRALFYWFIEAAEDP  77



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSW
Sbjct  66   GRALFYWFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSDI T+GD
Sbjct  126  NQVANILFLDSPVGVGFSYSNTSSDITTNGD  156


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 43/69 (62%), Gaps = 6/69 (9%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALF 
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  251  LVL*GCGGP  277
              +     P
Sbjct  72   WFVEAVEDP  80



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP SKPL+L LNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWFVEAVEDPQSKPLLLRLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVGYSYSNTSSD+L +GD
Sbjct  132  NQVANILFLDSPAGVGYSYSNTSSDLLNNGD  162


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALF   +     P
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDP  86



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   148 bits (373),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +   G   FYWFFEA +DP SKPLVLWLNGGPGCSSIAFGL EEVGPFHV  DGK ++ N
Sbjct  61   SEQRGAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAFGLGEEVGPFHVNADGKGVHVN  120

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF+DSP GVGYSYSNTS D L +GD
Sbjct  121  PYSWNKVANLLFLDSPVGVGYSYSNTSDDALKNGD  155


 Score = 46.6 bits (109),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALF
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALF  69



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSW
Sbjct  67   GRALFYWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF DSP GVG+SYSNTSSD+L++GD
Sbjct  127  NQVANVLFFDSPVGVGFSYSNTSSDLLSNGD  157


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +2

Query  71   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  248  LLVL*GCGGP  277
               +     P
Sbjct  72   YWFVEAAEDP  81



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   147 bits (372),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +   G   FYWFFEA +DP SKPLVLWLNGGPGCSSIAFGL EEVGPFHV  DGK ++ N
Sbjct  61   SEQRGAALFYWFFEAEKDPGSKPLVLWLNGGPGCSSIAFGLGEEVGPFHVNADGKGVHVN  120

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF+DSP GVGYSYSNTS D L +GD
Sbjct  121  PYSWNKVANLLFLDSPVGVGYSYSNTSDDALKNGD  155


 Score = 46.6 bits (109),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALF
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALF  69



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSW
Sbjct  66   GRALFYWFFEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+DSP GVG+SYSN S D+L++GD
Sbjct  126  NQAANILFLDSPVGVGFSYSNNSQDVLSNGD  156


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALF   
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  257  L*GCGGPFF*ASCSLAQW  310
                  P   AS  L  W
Sbjct  74   FEAVEDP---ASKPLVLW  88



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSW
Sbjct  67   GRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF DSP GVG+SYSNTSSD+L++GD
Sbjct  127  NQVANVLFFDSPVGVGFSYSNTSSDLLSNGD  157


 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGG-----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M+   W   L VL++  ++  G       +  + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
             VN++SGRALF   +     P
Sbjct  61   PVNEDSGRALFYWFVEAAEDP  81



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   154 bits (388),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SW
Sbjct  71   GRALFYWFIEAVEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSW  130

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN++F+D+P GVG+SYSNT+SD+LT+GD
Sbjct  131  NKVANVIFLDAPVGVGFSYSNTTSDLLTNGD  161


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  86   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*G  265
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALF   +  
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  266  CGGP  277
               P
Sbjct  82   VEDP  85



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              +G   FYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N 
Sbjct  70   EKMGRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQ  129

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +SWN AAN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  130  HSWNQAANILFLDAPVGVGYSYSNTSSDLLTNGD  163


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            ++  D V +LPG  FNV+FAHYSG+VT N++ GRALF  +      P   AS  L  W
Sbjct  41   EKDQDKVWNLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDP---ASKPLVLW  95



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +  G   FYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP
Sbjct  62   KEAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNP  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             SWN  ANLLFVDSP GVG+SYSNTS DI+++GD
Sbjct  122  DSWNQVANLLFVDSPVGVGFSYSNTSEDIISNGD  155


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 49/88 (56%), Gaps = 15/88 (17%)
 Frame = +2

Query  71   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  227  ESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            E+GRALF         P   +S  L  W
Sbjct  63   EAGRALFYWFFEAVDDP---SSKPLVVW  87



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EAVEDP+SKPLVLWLNGGPGCSSI FG AEE+GPFH+  DGKTLY NPYSW
Sbjct  72   GRALFYWFIEAVEDPASKPLVLWLNGGPGCSSIGFGEAEEIGPFHIHADGKTLYLNPYSW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD++ +GD
Sbjct  132  NQVANILFIDSPVGVGFSYSNTSSDLVNNGD  162


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALF   +     P   AS  L  W
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDP---ASKPLVLW  94



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             +G   FYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +
Sbjct  95   KMGRALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQH  154

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD LT+GD
Sbjct  155  SWNQAANILFLDAPVGVGYSYSNTSSDFLTNGD  187


 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  +      P   AS  L  W
Sbjct  65   QKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDP---ASKPLVLW  119



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQ  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVG+SYSNTSSD+LT+GD
Sbjct  122  YSWNQAANILFLDAPVGVGFSYSNTSSDLLTNGD  155


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSL  301
             S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  ++     P   AS  L
Sbjct  28   ESVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDP---ASKPL  84

Query  302  AQW  310
              W
Sbjct  85   VLW  87



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N Y
Sbjct  63   KLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVG+SYSNTSSD+LT+GD
Sbjct  123  SWNQAANILFLDAPVGVGFSYSNTSSDLLTNGD  155


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 6/90 (7%)
 Frame = +2

Query  50   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  220
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  221  NQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            N++ GRALF  ++     P   AS  L  W
Sbjct  61   NEKLGRALFYWLIEAAEDP---ASKPLVLW  87



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 6/97 (6%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAVEDP SKPL+LWLNGGPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSW
Sbjct  72   GRALFYWLVEAVEDPQSKPLLLWLNGGPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSW  131

Query  414  N------LAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N        AN+LF+DSP GVGYSYSNTSSD+L +GD
Sbjct  132  NQYFNQFAVANILFLDSPVGVGYSYSNTSSDLLNNGD  168


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGP  277
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALF  ++     P
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDP  86



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             +G   FYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +
Sbjct  58   KMGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQH  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AAN+LF+D+P GVGYSYSNTSSD+LT+GD
Sbjct  118  SWNQAANILFLDAPVGVGYSYSNTSSDLLTNGD  150


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF  283
            Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALF  +      P +
Sbjct  28   QKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPAY  76



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   137 bits (346),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSDHPESKPLVLWLNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  145


 Score = 53.1 bits (126),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
              LG   FYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQ  121

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AAN+LF+D+P GVG+SYSNTSSD++T+GD
Sbjct  122  YSWNQAANILFLDAPVGVGFSYSNTSSDLVTNGD  155


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +++ D V  LPG  FNV+FA YSG+VT N++ GRALF  ++     P   AS  L  W
Sbjct  33   EKEQDKVSKLPGQNFNVNFAQYSGFVTTNEKLGRALFYWLIEAAEDP---ASKPLVLW  87



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G  FFYWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSW
Sbjct  68   GRAFFYWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSW  127

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP G G++YSN S D+LT+GD
Sbjct  128  NQVANILFLDSPVGAGFAYSNNSQDVLTNGD  158


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 7/81 (9%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  248  LLVL*GCGGPFF*ASCSLAQW  310
                     P   AS  L  W
Sbjct  73   YWFFEATEEP---ASKPLVLW  90



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   139 bits (350),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY NPYS
Sbjct  66   GRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLYLNPYS  125

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  AN+L++DSP GVG+SYS  SSDILT+GD
Sbjct  126  WNQVANILYIDSPVGVGFSYSKNSSDILTNGD  157


 Score = 51.2 bits (121),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN+SF HYSGY+TVN+++GR LF
Sbjct  33   QQEQDRIDRPLPGQNFNISFEHYSGYITVNEDAGRNLF  70



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   137 bits (345),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSQHPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  145


 Score = 53.1 bits (126),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY NPYSW
Sbjct  67   GRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD+L++GD
Sbjct  127  NQVANILFLDSPVGVGFSYSNTSSDLLSNGD  157


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
            TVN++SGRALF  ++     P
Sbjct  61   TVNEDSGRALFYWLVEAAEDP  81



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY NPYSW
Sbjct  67   GRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLYLNPYSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVG+SYSNTSSD+L++GD
Sbjct  127  NQVANILFLDSPVGVGFSYSNTSSDLLSNGD  157


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +2

Query  50   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  215  TVNQESGRALFLLVL*GCGGP  277
            TVN++SGRALF  ++     P
Sbjct  61   TVNEDSGRALFYWLVEAAEDP  81



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   129 bits (325),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY
Sbjct  57   GRALFYWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SYSNT+SD+ T GD
Sbjct  117  AWNNLANILFLDSPAGVGFSYSNTTSDLYTAGD  149


 Score = 60.1 bits (144),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALF 
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  LVL  259
             ++
Sbjct  63   WLV  65



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   136 bits (343),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYW  E+ + P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  53   SAGRALFYWLTESSDHPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  112

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  AWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  145


 Score = 53.1 bits (126),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALF
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALF  59



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNTSSD+L +GD
Sbjct  130  NQVANILFLESPVGVGFSYSNTSSDLLNNGD  160


 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  27   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  86

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD
Sbjct  87   NQVANILFLDSPVGVGYSYSNTSADILSNGD  117



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  60   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD
Sbjct  120  NQVANILFLDSPVGVGYSYSNTSADILSNGD  150


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALF         P   AS  L  W
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDP---ASKPLLLW  82



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   134 bits (336),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  63   GRALFYWLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  123  SWNKLANLLFLESPAGVGFSYSNTSSDLYTVGD  155


 Score = 54.7 bits (130),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALF
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALF  67



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  DP+SKPL+LWLNGGPGCSSIAFG+ EEVGPFHV  DGK ++ NPYSW
Sbjct  60   GAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTS+DIL++GD
Sbjct  120  NQVANILFLDSPVGVGYSYSNTSADILSNGD  150


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALF         P   AS  L  W
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDP---ASKPLLLW  82



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +   G   FYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ N
Sbjct  71   SEERGAALFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLN  130

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  AN+LF+DSP GVGYSYSN S DIL +GD
Sbjct  131  PYSWNQVANILFLDSPVGVGYSYSNVSDDILNNGD  165


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 36/68 (53%), Gaps = 3/68 (4%)
 Frame = +2

Query  107  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*  286
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALF         P   
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDP---  89

Query  287  ASCSLAQW  310
            AS  L  W
Sbjct  90   ASKPLVLW  97



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ NPYSW
Sbjct  65   GAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSP GVGYSYSNTS DIL++GD
Sbjct  125  NRVANILFLDSPVGVGYSYSNTSGDILSNGD  155


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (4%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
             +LF+L ++ +      SS   +Q+ D V  +PG GFN SFAHY+GYVTV++E G ALF 
Sbjct  11   AVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTVSEERGAALFY  70

Query  251  LVL*GCGGPFF*ASCSLAQW  310
                    P   AS  L  W
Sbjct  71   WFFEAAHEP---ASKPLVLW  87



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  64   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+D P GVG+SYSN+S DI ++GD
Sbjct  124  NQAANILFLDFPVGVGFSYSNSSFDISSNGD  154


 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  227  ESGRALFLLVL*GCGGP  277
             +GRALF   +     P
Sbjct  62   YTGRALFYWFIEAAEDP  78



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   139 bits (349),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            + +G   FYWF EA   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DG TL+ N
Sbjct  64   KDVGRTLFYWFIEADHIDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGNTLHLN  123

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  AN+L +DSP GVG+SYSN SSDIL +GD
Sbjct  124  PYSWNQVANILLIDSPVGVGFSYSNASSDILNNGD  158


 Score = 48.9 bits (115),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LF
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLF  71



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   139 bits (349),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            + +G   FYWF EA   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DG TL+ N
Sbjct  64   KDVGRTLFYWFIEADHIDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGNTLHLN  123

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  AN+L +DSP GVG+SYSN SSDIL +GD
Sbjct  124  PYSWNQVANILLIDSPVGVGFSYSNASSDILNNGD  158


 Score = 48.9 bits (115),  Expect(2) = 5e-39, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  137  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LF
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLF  71



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  104  GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  163

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AAN+LF+D P GVG+SYSN+S DI ++GD
Sbjct  164  NQAANILFLDFPVGVGFSYSNSSFDISSNGD  194


 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  227  ESGRALFLLVL*GCGGP  277
             +GRALF   +     P
Sbjct  102  YTGRALFYWFIEAAEDP  118



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNTSSD+L +GD
Sbjct  130  NQVANILFLESPVGVGFSYSNTSSDLLNNGD  160


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   132 bits (333),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  60   GRSLFYWLVEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SYSN S+D+ T GD
Sbjct  120  AWNNLANVLFLDSPAGVGFSYSNKSTDLYTFGD  152


 Score = 54.7 bits (130),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  23   ASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  68



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   131 bits (329),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGD  150


 Score = 55.8 bits (133),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSW
Sbjct  70   GRALFYWFFEAAEDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF++SP GVG+SYSNTS D+L +GD
Sbjct  130  NKVANLLFLESPIGVGFSYSNTSFDLLNNGD  160


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 41/63 (65%), Gaps = 5/63 (8%)
 Frame = +2

Query  89   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GC  268
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALF       
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  269  GGP  277
              P
Sbjct  82   EDP  84



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +   G   FYWFFEA +DP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ N
Sbjct  71   SEERGASLFYWFFEAADDPASKPLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLN  130

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  AN+LF+DSP GVGYSYSN S DIL +GD
Sbjct  131  PYSWNQVANILFLDSPVGVGYSYSNASDDILNNGD  165



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   135 bits (340),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   E+P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  54   SAGRALFYWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  113

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  114  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  148


 Score = 51.2 bits (121),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALF  60



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   137 bits (345),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY
Sbjct  68   GRALFYWLIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI   GD
Sbjct  128  TWNKVANLLFLDSPAGVGFSYSNTSSDIYAVGD  160


 Score = 48.9 bits (115),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
             L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALF 
Sbjct  15   ALSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFY  73

Query  251  LVL  259
             ++
Sbjct  74   WLI  76



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   130 bits (327),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGD  150


 Score = 55.8 bits (133),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   133 bits (334),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +3

Query  231  LGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            +G + FYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++NPY
Sbjct  64   VGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPY  123

Query  408  SWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGD  506
            SWN  AN+L++DSP GVG+SYS  N+S DIL +GD
Sbjct  124  SWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGD  158


 Score = 52.8 bits (125),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALF  247
            N++ GR LF
Sbjct  61   NEDVGRNLF  69



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   134 bits (336),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  147


 Score = 52.0 bits (123),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   130 bits (326),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGD  150


 Score = 55.8 bits (133),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   132 bits (333),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +3

Query  231  LGEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            +G + FYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++NPY
Sbjct  64   VGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPY  123

Query  408  SWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGD  506
            SWN  AN+L++DSP GVG+SYS  N+S DIL +GD
Sbjct  124  SWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGD  158


 Score = 52.8 bits (125),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 3/69 (4%)
 Frame = +2

Query  50   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  220
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  221  NQESGRALF  247
            N++ GR LF
Sbjct  61   NEDVGRNLF  69



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   138 bits (347),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  54   RKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  114  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGD  149


 Score = 47.8 bits (112),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 8/59 (14%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++GRALF
Sbjct  11   CILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKAGRALF  61



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   130 bits (326),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGD  150


 Score = 55.5 bits (132),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   130 bits (326),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYWF E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWFIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN LF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANTLFLESPAGVGFSYTNTTSDLYTSGD  150


 Score = 55.5 bits (132),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALF  
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  254  VL  259
             +
Sbjct  65   FI  66



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   134 bits (338),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   + P SKPLVLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQHPESKPLVLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  PYAWNQLANLLFLESPAGVGFSYSNTTSDLYTAGD  147


 Score = 50.8 bits (120),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSW
Sbjct  70   GRALFYWFFEAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N   N+LF++SP GVG+SYSNTSSD+L +GD
Sbjct  130  NQVVNILFLESPVGVGFSYSNTSSDLLNNGD  160


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = +2

Query  80   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALF    
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  260  *GCGGP  277
                 P
Sbjct  79   EAAKDP  84



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   133 bits (335),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  53   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHN  112

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  113  PYSWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  147


 Score = 51.6 bits (122),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALF  59



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   124 bits (312),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY
Sbjct  57   GRALFYWLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN +  ++F+DSPAGVG+SYSNT+SD+ T GD
Sbjct  117  AWNNSVVIVFLDSPAGVGFSYSNTTSDLYTAGD  149


 Score = 60.1 bits (144),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALF 
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  251  LVL  259
             ++
Sbjct  63   WLV  65



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   135 bits (339),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL+ NPY
Sbjct  66   GRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GD
Sbjct  126  AWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGD  158


 Score = 50.1 bits (118),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALFLLVL  259
            V+   GRALF  ++
Sbjct  61   VDPVEGRALFYWLI  74



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   135 bits (341),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSD  T GD
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSSDTYTVGD  160


 Score = 48.9 bits (115),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FLLVL  259
            F  ++
Sbjct  72   FYWLI  76



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NPYSW
Sbjct  62   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNPYSW  121

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+D+P GVG+SYSN  SD+L +GD
Sbjct  122  NRVANILFLDTPVGVGFSYSNNKSDMLINGD  152


 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  224  QESGRALFLLVL*GCGGP  277
            +++GR LF   +     P
Sbjct  59   EKAGRTLFYWFIEALEDP  76



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NPYSW
Sbjct  76   GRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNPYSW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+D+P GVG+SYSN  SD+L +GD
Sbjct  136  NRVANILFLDTPVGVGFSYSNNKSDMLINGD  166


 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  224  QESGRALFLLVL*GCGGP  277
            +++GR LF   +     P
Sbjct  73   EKAGRTLFYWFIEALEDP  90



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   129 bits (325),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  59   GRSLFYWLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SYSN S+D+ T GD
Sbjct  119  AWNNLANVLFLDSPAGVGFSYSNKSTDLYTFGD  151


 Score = 54.7 bits (130),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  22   ASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  67



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   134 bits (336),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL+ NPY
Sbjct  66   GRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD
Sbjct  126  AWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGD  158


 Score = 50.4 bits (119),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +2

Query  50   MSALSWGCLLF-VLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  217
            M   S  C LF VL  AT   S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  218  VNQESGRALF  247
            V+   GRALF
Sbjct  61   VDPVEGRALF  70



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   129 bits (325),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  243  FFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN
Sbjct  63   LFYWLVEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWN  122

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
              AN+LF+DSPAGVG+SYSN ++D+ T GD
Sbjct  123  KLANILFLDSPAGVGFSYSNKTADLYTFGD  152


 Score = 54.3 bits (129),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +2

Query  80   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLV  256
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALF  +
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  257  L  259
            +
Sbjct  68   V  68



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   134 bits (338),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  52   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  111

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  112  PYSWNKVANLLFLESPAGVGFSYSNTTSDLYTAGD  146


 Score = 49.3 bits (116),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  58



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   134 bits (338),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E+   ++P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  52   SAGRALFYWLTESPPSQNPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHN  111

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PYSWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  112  PYSWNKVANLLFLESPAGVGFSYSNTTSDLYTAGD  146


 Score = 48.9 bits (115),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALF  58



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   132 bits (333),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G + FYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L++NPY 
Sbjct  66   GRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLHFNPYY  125

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  AN L+++SP GVG+SYS  SSDIL +GD
Sbjct  126  WNQVANFLYIESPVGVGFSYSKNSSDILNNGD  157


 Score = 51.2 bits (121),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 4/74 (5%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  217
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  218  VNQESGRALFLLVL  259
            VN+++GR LF   +
Sbjct  61   VNEDAGRNLFYWFI  74



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   131 bits (330),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTL++
Sbjct  57   QQAGRALFYWLTEAPASRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFF  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  AN+LF++SPAGVG+SYSNTSSD+ T GD
Sbjct  117  NPYAWNNLANILFLESPAGVGFSYSNTSSDLYTAGD  152


 Score = 52.4 bits (124),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALF
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALF  64



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   127 bits (319),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A  DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  57   GRALFYWLVESPATRDPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  117  AWNKLANLLFLESPAGVGFSYTNTTSDLYTTGD  149


 Score = 56.2 bits (134),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALF  ++
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLV  65



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NPYSW
Sbjct  74   GRALFYWLIEATENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHINADGKSLYLNPYSW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSDI   GD
Sbjct  134  NKLANILFLDSPAGVGFSYTNTSSDISQSGD  164


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL V L +T+    + S+  D   +Q  D +  LPG   NV+FA YSGY+TV+  +GRAL
Sbjct  18   LLLVALQSTATSTWEESNERDWRNEQAKDRITQLPGQPSNVNFAQYSGYITVDNNAGRAL  77

Query  245  FLLVL*GCGGP  277
            F  ++     P
Sbjct  78   FYWLIEATENP  88



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   129 bits (323),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY
Sbjct  60   GRSLFYWLVEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SYSN ++D+ T GD
Sbjct  120  AWNNLANVLFLDSPAGVGFSYSNKTTDLYTFGD  152


 Score = 54.3 bits (129),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LF  ++
Sbjct  23   ASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWLV  68



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   134 bits (336),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGD  151


 Score = 49.3 bits (116),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  233  GRALFLLVL  259
            GRALF  ++
Sbjct  59   GRALFYWLV  67



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   129 bits (323),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+  +  P ++PLVLWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY
Sbjct  58   GRALFYWLTESPVNRVPKARPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  118  AWNKLANLLFLESPAGVGFSYTNTTSDLYTTGD  150


 Score = 54.3 bits (129),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALF
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALF  62



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   133 bits (334),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY 
Sbjct  54   KQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  114  NPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  149


 Score = 50.1 bits (118),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALF
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALF  61



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   135 bits (341),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+W
Sbjct  72   GRALFYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NL ANLLF+DSPAGVG+SY+NTSSD LT GD
Sbjct  132  NLEANLLFLDSPAGVGFSYTNTSSDELTVGD  162


 Score = 47.4 bits (111),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  F  247
            F
Sbjct  76   F  76



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   131 bits (329),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  55   GRALFYWLTESPPSLNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  114

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  115  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGD  147


 Score = 51.6 bits (122),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  59



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   131 bits (329),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  58   GRALFYWLTESPPSLNPESKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  118  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGD  150


 Score = 51.6 bits (122),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  25   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  62



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   131 bits (329),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P SKPLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  57   GRALFYWLTESPPSLNPDSKPLVLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  117  SWNQLANLLFLESPAGVGFSYSNTTSDLYTAGD  149


 Score = 51.6 bits (122),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALF
Sbjct  24   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALF  61



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   134 bits (336),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSD  T GD
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSSDTYTVGD  160


 Score = 48.5 bits (114),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (62%), Gaps = 3/65 (5%)
 Frame = +2

Query  74   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  245  FLLVL  259
            F  ++
Sbjct  72   FYWLI  76



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   133 bits (335),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY 
Sbjct  56   KQAGRALFYWLTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYL  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTTSDLYTAGD  151


 Score = 48.9 bits (115),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALF
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALF  63



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   129 bits (325),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E      P ++PLVLWLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y
Sbjct  58   GRALFYWLIELPVSRSPETRPLVLWLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF++SPAGVG+SYSNT+SD+ T GD
Sbjct  118  AWNNLANMLFLESPAGVGFSYSNTTSDLYTAGD  150


 Score = 52.8 bits (125),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALF  ++
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLI  66



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   129 bits (323),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E      P ++PLVLWLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y
Sbjct  121  GRALFYWLIELPVSRSPETRPLVLWLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRY  180

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF++SPAGVG+SYSNT+SD+ T GD
Sbjct  181  AWNNLANMLFLESPAGVGFSYSNTTSDLYTAGD  213


 Score = 53.1 bits (126),  Expect(2) = 3e-37, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALF
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALF  125



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   134 bits (338),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+W
Sbjct  72   GRALFYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAW  131

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NL ANLLF+DSPAGVG+SY+NTSSD LT GD
Sbjct  132  NLDANLLFLDSPAGVGFSYTNTSSDELTVGD  162


 Score = 47.0 bits (110),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  245  F  247
            F
Sbjct  76   F  76



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   134 bits (338),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY 
Sbjct  54   RKAGRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYL  113

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  114  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGD  149


 Score = 46.6 bits (109),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +S+  Q  D +  LPG   NV FA YSGYVTVN+++GRALF
Sbjct  22   ASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKAGRALF  61



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   135 bits (339),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  +A     P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY
Sbjct  60   GRALFYWLIKAPFKSQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GD
Sbjct  120  AWNQEANLLFLDSPAGVGFSYSNTSSDIYTVGD  152


 Score = 46.2 bits (108),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALF  ++
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLI  68



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   123 bits (308),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y
Sbjct  62   GRALFYWLVESPLTRVPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLY  121

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+NT+SD+   GD
Sbjct  122  AWNKLANLLFLESPAGVGFSYTNTTSDLYITGD  154


 Score = 58.2 bits (139),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALF  ++
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLV  70



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   130 bits (328),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N Y+W
Sbjct  63   GRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNKYAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SY+NTSSD+ T GD
Sbjct  123  NKEANILFLESPAGVGFSYTNTSSDLTTSGD  153


 Score = 50.4 bits (119),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +2

Query  68   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN+E GRALF
Sbjct  9    GLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVNEEHGRALF  67



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   134 bits (338),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+GLAEE+GPF +  DGKTLY 
Sbjct  127  RQAGRALFYWLVESPASRRPESRPLVLWLNGGPGCSSVAYGLAEEIGPFRIRPDGKTLYS  186

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+W+  ANLLF++SPAG+G+SY+NT+SD+ T GD
Sbjct  187  NPYAWSKLANLLFLESPAGIGFSYTNTTSDLYTTGD  222


 Score = 46.6 bits (109),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +++ D + +LPG   N  FA YSGYVTVN+++GRALF
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALF  134



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   132 bits (332),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N Y
Sbjct  63   GRALFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVGYSYSNTSSD+ T GD
Sbjct  123  SWNKLANLLFLESPAGVGYSYSNTSSDLYTVGD  155


 Score = 48.5 bits (114),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRALF
Sbjct  10   CSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRALF  67



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   133 bits (335),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY NPY
Sbjct  58   GRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDGKTLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SY+NTSSD+   GD
Sbjct  118  SWNNLANLLFLESPAGVGFSYTNTSSDLYNAGD  150


 Score = 47.0 bits (110),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +Q  D +  LPG   NV F  YSGYVTVN+++GRALF  ++
Sbjct  26   EQLRDKITYLPGQPANVQFNQYSGYVTVNEQAGRALFYWLI  66



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   130 bits (327),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ++ G   FYW  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NP
Sbjct  61   QNAGRALFYWLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNP  120

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            Y+WN  AN+LF+DSPAGVG+SYSN+SSD+   GD
Sbjct  121  YAWNKLANILFLDSPAGVGFSYSNSSSDLKHPGD  154


 Score = 50.1 bits (118),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALF  247
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALF
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALF  68



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   132 bits (333),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  58   GRALFYWLIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SPAGVG+SY+NTSSD+   GD
Sbjct  118  SWNNLANLLFLESPAGVGFSYTNTSSDLYNAGD  150


 Score = 47.8 bits (112),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALF  
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LI  66



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   131 bits (330),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  79   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  138

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GD
Sbjct  139  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGD  171


 Score = 48.9 bits (115),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +2

Query  71   CLL-FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +GRALF
Sbjct  27   CVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRAGRALF  83

Query  248  LLVL  259
              ++
Sbjct  84   YWLI  87



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   131 bits (330),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 74/93 (80%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY
Sbjct  68   GRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSD+   GD
Sbjct  128  AWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGD  160


 Score = 48.9 bits (115),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +2

Query  71   CLL-FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  +GRALF
Sbjct  16   CVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPRAGRALF  72

Query  248  LLVL  259
              ++
Sbjct  73   YWLI  76



>gb|KJB76572.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=441

 Score =   134 bits (337),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY
Sbjct  68   GRALFYWLTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GD
Sbjct  128  AWNQEANLLFLDSPAGVGFSYSNTSSDIYTAGD  160


 Score = 45.8 bits (107),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 4/53 (8%)
 Frame = +2

Query  89   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            L+  S +GG       +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALF
Sbjct  24   LVVWSAEGGHRK----EQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALF  72



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   134 bits (337),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY
Sbjct  68   GRALFYWLTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI T GD
Sbjct  128  AWNQEANLLFLDSPAGVGFSYSNTSSDIYTAGD  160


 Score = 45.8 bits (107),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALF
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALF  72



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   123 bits (308),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGD  151


 Score = 56.6 bits (135),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   122 bits (307),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGD  151


 Score = 56.6 bits (135),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   122 bits (307),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGD  151


 Score = 56.2 bits (134),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   122 bits (307),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y
Sbjct  59   GRALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  119  AWNNLANILFLDSPAGVGFSYCNKTTDLYTFGD  151


 Score = 56.6 bits (135),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +2

Query  68   GCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
            G  +F ++L  SI   G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGRA
Sbjct  2    GYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGRA  61

Query  242  LFLLVL  259
            LF  ++
Sbjct  62   LFYWLI  67



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   135 bits (339),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSW
Sbjct  56   GRALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSW  115

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SY+NTSS++   GD
Sbjct  116  NKEANILFLESPAGVGFSYTNTSSELKHSGD  146


 Score = 43.9 bits (102),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALF  247
            RALF
Sbjct  57   RALF  60



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   134 bits (338),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSW
Sbjct  56   GRALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSW  115

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SY+NTSS++   GD
Sbjct  116  NKEANILFLESPAGVGFSYTNTSSELKHSGD  146


 Score = 44.3 bits (103),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  236  RALF  247
            RALF
Sbjct  57   RALF  60



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   130 bits (327),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA  D  P S+PL+LWLNGGPGCSSIA+G AEE+GPF +  +GKTLY N Y
Sbjct  55   GRALFYWLTEASVDSVPDSRPLLLWLNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLNSY  114

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN   NLLF++SPAGVGYSYSNTSSD+ T GD
Sbjct  115  SWNKLVNLLFLESPAGVGYSYSNTSSDLYTAGD  147


 Score = 48.5 bits (114),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            S SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALF
Sbjct  18   SWSVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALF  59



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   125 bits (315),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G  EEVGPF V  DGKTLY   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGD  152


 Score = 52.8 bits (125),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   125 bits (315),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G  EEVGPF V  DGKTLY   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGD  152


 Score = 53.1 bits (126),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   127 bits (319),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLARDPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGD  152


 Score = 51.2 bits (121),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALF  ++
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLV  68



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   125 bits (314),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEEVGPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGD  152


 Score = 52.8 bits (125),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   129 bits (323),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV D + KPLVLWLNGGPGCSS+A+G +EE+GPF +++ G +LY N +SW
Sbjct  57   GRALFYWLTEAVTDAAKKPLVLWLNGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSW  116

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF++SPAGVG+SY+N SSD+ + GD
Sbjct  117  NREANLLFLESPAGVGFSYANVSSDLQSVGD  147


 Score = 49.3 bits (116),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALF
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALF  61



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   125 bits (313),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEEVGPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPTTRDPKSRPLVLWLNGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SY+N++SD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYTNSTSDLYTTGD  152


 Score = 52.8 bits (125),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLV  68



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +S G   FYW  E+  +P +KPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NP
Sbjct  54   KSAGRTLFYWLTESPSNPETKPLVLWLNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNP  113

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN  ANLLF++SPAGVG+SYSN SSD+ T GD
Sbjct  114  YSWNNEANLLFLESPAGVGFSYSNRSSDLYTVGD  147



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   125 bits (314),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  58   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  117

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+++PAGVG+SYSNTSSD+ T GD
Sbjct  118  AWNKLANLLFLEAPAGVGFSYSNTSSDLYTTGD  150


 Score = 52.4 bits (124),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLL  253
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  254  VL  259
            ++
Sbjct  65   LV  66



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G+ FFYWF E+ EDPSSKPL LWLNGGP CSSIAFG AEE+GPF    DGK++Y NPY
Sbjct  82   SAGKAFFYWFVESAEDPSSKPLALWLNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPY  141

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN++FV+SPAG G+SYSNTSSD+   GD
Sbjct  142  AWNQVANIIFVESPAGTGFSYSNTSSDLYNTGD  174


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSL  301
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A F   +     P   +S  L
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDP---SSKPL  103

Query  302  AQW  310
            A W
Sbjct  104  ALW  106



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   131 bits (329),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +TL  NP+
Sbjct  67   SHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQTLKLNPH  126

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             WN AANLLF++SP GVG+SY+NTSSDI   GD
Sbjct  127  RWNKAANLLFLESPVGVGFSYTNTSSDIHQLGD  159


 Score = 46.2 bits (108),  Expect(2) = 5e-36, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  214
            +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+GYV
Sbjct  4    NAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYAGYV  62

Query  215  TVNQESGRALF  247
            TVN+  GRALF
Sbjct  63   TVNESHGRALF  73



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 19/110 (17%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGG-------------------PGCSSIAFGLAEEV  356
            G   FYWFFEA EDP+SKP+VLWLNGG                   PGCSSIA+G AEE+
Sbjct  70   GRALFYWFFEAAEDPASKPIVLWLNGGLPALLVFHLLCLVTMKSLGPGCSSIAYGEAEEI  129

Query  357  GPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            GPFH++ D KTLY NPYSWN  AN+LF+DSP GVG+SYSN SSD+L++GD
Sbjct  130  GPFHIKPDAKTLYLNPYSWNQVANILFIDSPVGVGFSYSNASSDLLSNGD  179


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL*GCGGPFF*ASCSLAQW  310
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALF         P   AS  +  W
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDP---ASKPIVLW  92



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   129 bits (324),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y+W
Sbjct  68   GRALFYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIYAW  127

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  128  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  158


 Score = 48.1 bits (113),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  12   CMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  71

Query  245  F  247
            F
Sbjct  72   F  72



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   128 bits (322),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  64   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  124  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  154


 Score = 48.5 bits (114),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALF
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALF  68



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 80/119 (67%), Gaps = 28/119 (24%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPYSW
Sbjct  63   GRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPYSW  122

Query  414  N----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N                              AN+LF+DSP GVG+SYSNTSSD+ T+GD
Sbjct  123  NQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNGD  181


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +2

Query  50   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  226
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  227  ESGRALFLLVL*GCGGP  277
             SGRALF   +     P
Sbjct  61   NSGRALFYWFIEAAEDP  77



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   126 bits (317),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTSSDLYTTGD  152


 Score = 50.1 bits (118),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  ++
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLV  68



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   126 bits (317),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  60   GRALFYWLVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLY  119

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  120  AWNKLANLLFLESPAGVGFSYSNTSSDLYTTGD  152


 Score = 50.1 bits (118),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALF  ++
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLV  68



>gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   132 bits (331),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA +   P  KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY
Sbjct  66   GRALFYWLTEAPKTVQPKLKPLVLWLNGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF+DSPAGVG+SYSNTSSDI   GD
Sbjct  126  AWNKEANLLFLDSPAGVGFSYSNTSSDISNVGD  158


 Score = 44.7 bits (104),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALF
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALF  70



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   132 bits (331),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA       PLVLWLNGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+W
Sbjct  75   GRALFYWLVEAPPSAQPAPLVLWLNGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAW  134

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD+ T GD
Sbjct  135  NTVANVLFLDSPAGVGFSYTNTSSDLHTSGD  165


 Score = 44.3 bits (103),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALF  ++
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLV  83



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   129 bits (324),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  64   GRNLFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  124  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  154


 Score = 45.8 bits (107),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 5/59 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  +L   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LF
Sbjct  15   CMVIAILDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLF  68



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   129 bits (324),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SW
Sbjct  67   GRALFYWLTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+++PAGVG+SYSN SSD+L  GD
Sbjct  127  NTVANLLFLETPAGVGFSYSNRSSDLLDTGD  157


 Score = 46.2 bits (108),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALF
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALF  71



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   123 bits (308),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY
Sbjct  59   GRALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPY  118

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF++SPAGVG+SY N ++D+   GD
Sbjct  119  AWNNLANILFLESPAGVGFSYCNKTTDMQNFGD  151


 Score = 52.0 bits (123),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGRALF
Sbjct  9    VLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGRALF  63



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   128 bits (322),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  N Y
Sbjct  64   TAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRLNIY  123

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  124  AWNKVANVLFLDSPAGVGFSYTNTSSDELTVGD  156


 Score = 46.6 bits (109),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +2

Query  71   CLLFVLL--LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C++  LL  +++S DG K      Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  15   CMVIALLDQVSSSDDGDKV-----QKMKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  69

Query  245  F  247
            F
Sbjct  70   F  70



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   129 bits (323),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  67   GRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSW  126

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+++PAGVG+SYSN SSD+L  GD
Sbjct  127  NTLANLLFLETPAGVGFSYSNKSSDLLDTGD  157


 Score = 45.8 bits (107),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 4/61 (7%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSV---DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL +LL+A    G  G + V   ++++ D +  LPG    VSF  YSGYVTVN  +GRAL
Sbjct  12   LLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNHVAGRAL  70

Query  245  F  247
            F
Sbjct  71   F  71



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   129 bits (323),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SW
Sbjct  69   GRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSW  128

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+++PAGVG+SYSN SSD+L  GD
Sbjct  129  NTLANLLFLETPAGVGFSYSNKSSDLLDTGD  159


 Score = 45.8 bits (107),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV---DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  241
             LL +LL+A    G  G + V   ++++ D +  LPG    VSF  YSGYVTVN  +GRA
Sbjct  13   VLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNHVAGRA  71

Query  242  LF  247
            LF
Sbjct  72   LF  73



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   123 bits (309),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N Y
Sbjct  67   SHGRALFYWFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTY  126

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SP GVG+SY+NTSSD+L   D
Sbjct  127  SWNKEANLLFLESPVGVGFSYTNTSSDLLELND  159


 Score = 51.2 bits (121),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  GRALF
Sbjct  19   CIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHGRALF  73



>ref|XP_009420309.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   128 bits (321),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +  G   FYW  EA  D + KPLVLWLNGGPGCSS+A+G +EE+GPF + +   +LY N 
Sbjct  63   KEQGRALFYWLTEAATDAAKKPLVLWLNGGPGCSSVAYGASEEIGPFRISRTCSSLYLNQ  122

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +SWN  ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  123  FSWNREANLLFLESPAGVGFSYTNTSSDLKTSGD  156


 Score = 46.6 bits (109),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             DQQ  D +  LPG    V+FA +SGYVTVN+E GRALF
Sbjct  33   ADQQAHDRITALPGQP-PVTFAQFSGYVTVNKEQGRALF  70



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   124 bits (312),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  243  FFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  E+  +  P+ +PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN
Sbjct  64   LFYWLIESPMNRGPNLRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  123

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
              AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  124  NLANILFLDSPAGVGFSYCNKTTDLYTFGD  153


 Score = 49.7 bits (117),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALF  ++
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLI  69



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   130 bits (328),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGD  176


 Score = 43.5 bits (101),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   124 bits (312),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  243  FFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  416
             FYW  E+  +  P+ +PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN
Sbjct  64   LFYWLIESPMNRGPNLRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWN  123

Query  417  LAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
              AN+LF+DSPAGVG+SY N ++D+ T GD
Sbjct  124  NLANILFLDSPAGVGFSYCNKTTDLYTFGD  153


 Score = 49.7 bits (117),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALF  ++
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLI  69



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   124 bits (312),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  63   GRALFYWLVESPLTRSPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  122

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  123  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGD  155


 Score = 49.3 bits (116),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLV  71



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 15/149 (10%)
 Frame = +3

Query  87   FSWPPVLMVGKGLLLWISKNWTQSWICQ-------GLASMSALHTILGM*L*TRSLGEHF  245
            F++P +L++  G      ++  +  I Q       G A  S   T+       R  G   
Sbjct  7    FAFPCILLLFLGGCFASVQDQVRDRITQLPGQPTVGFAQYSGYVTV------NRKAGRAL  60

Query  246  FYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  419
            FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN 
Sbjct  61   FYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNN  120

Query  420  AANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  121  LANLLFLESPAGVGFSYTNTSSDLYTAGD  149



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   124 bits (311),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+     P S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  61   GRALFYWLVESPLTRSPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  120

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  121  AWNKLANLLFLESPAGVGFSYSNTTSDLYTTGD  153


 Score = 49.7 bits (117),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  131  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALF  ++
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLV  69



>gb|KJB07564.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   130 bits (327),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGD  176


 Score = 43.5 bits (101),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   128 bits (322),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  70   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  130  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  160


 Score = 45.4 bits (106),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 6/60 (10%)
 Frame = +2

Query  71   CLLFVLL-LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            C++  LL + TS D  K     +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  20   CMVIALLDVVTSSDDAK-----EQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74



>gb|KJB07559.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=488

 Score =   130 bits (327),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGD  176


 Score = 43.5 bits (101),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   130 bits (327),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  86   GRALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  145

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD
Sbjct  146  NMEANILFLESPAGVGFSYTNTSSDLKDSGD  176


 Score = 43.5 bits (101),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query  56   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  235
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  236  RALF  247
            RALF
Sbjct  87   RALF  90



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 94/149 (63%), Gaps = 15/149 (10%)
 Frame = +3

Query  87   FSWPPVLMVGKGLLLWISKNWTQSWICQ-------GLASMSALHTILGM*L*TRSLGEHF  245
            F++P +L++  G      ++  +  I Q       G A  S   T+       R  G   
Sbjct  7    FAFPCILLLFLGGCFASVQDQVRDRITQLPGQPTVGFAQYSGYVTV------NRKAGRAL  60

Query  246  FYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  419
            FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN 
Sbjct  61   FYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNN  120

Query  420  AANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  121  LANLLFLESPAGVGFSYTNTSSDLYTAGD  149



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   133 bits (334),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+W
Sbjct  81   GRALFYWFIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAW  140

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+DSPAGVG+SYSNTSSD+ T GD
Sbjct  141  NSEANLLFLDSPAGVGFSYSNTSSDLYTAGD  171


 Score = 40.8 bits (94),  Expect(2) = 7e-35, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 5/58 (9%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            L   L+L   + GG  +S       D +  LPG    V F+ YSGYVTVN  +GRALF
Sbjct  33   LTLALVLNYGVVGGLAASRAS----DRIYRLPGQP-PVGFSQYSGYVTVNARAGRALF  85



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   127 bits (320),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANL+F++SP GVG+SY+NTSSD+   GD
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGD  167


 Score = 45.8 bits (107),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (57%), Gaps = 6/65 (9%)
 Frame = +2

Query  68   GCLL--FVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  232
            GC L    LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  233  GRALF  247
            GRALF
Sbjct  77   GRALF  81



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYSNTSSDLYTAGD  152


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>gb|KEH32355.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=484

 Score =   124 bits (310),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA   PS+KPL+LWLNGGPGCSSI +G   E+GP  V ++G+ L +NPYSW
Sbjct  65   GRALFYWFFEAQSQPSNKPLLLWLNGGPGCSSIGYGAVVEIGPLLVNQNGEGLKFNPYSW  124

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLFV+SP GVG+SY+NTSSD+    D
Sbjct  125  NQEANLLFVESPVGVGFSYTNTSSDLTILED  155


 Score = 49.3 bits (116),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  128  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +V+  + D ++DLPG   N S +H+SGY+ VN+E GRALF
Sbjct  30   NVESYETDRIIDLPGQPSNPSISHFSGYINVNEEHGRALF  69



>gb|AEX12772.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12773.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12774.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12777.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12778.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12780.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12781.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12784.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NPYSW
Sbjct  50   GRALFYWLVEAAENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHINADGKSLYLNPYSW  109

Query  414  NLAANLLFVDSPAGVGYSY  470
            N  AN+LF+DSPAGVG+SY
Sbjct  110  NKLANILFLDSPAGVGFSY  128



>gb|AEX12786.1| hypothetical protein 2_8315_02, partial [Pinus radiata]
Length=128

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NPYSW
Sbjct  50   GRALFYWLVEAAENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHIHADGKSLYLNPYSW  109

Query  414  NLAANLLFVDSPAGVGYSY  470
            N  AN+LF+DSPAGVG+SY
Sbjct  110  NKLANILFLDSPAGVGFSY  128



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   128 bits (321),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+W
Sbjct  49   GRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAW  108

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  109  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  139


 Score = 45.1 bits (105),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 5/58 (9%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALF
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALF  53



>gb|AEX12770.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12771.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12775.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12776.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12779.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12782.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12783.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
 gb|AEX12785.1| hypothetical protein 2_8315_02, partial [Pinus taeda]
Length=128

 Score =   129 bits (324),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA E+PSSKPLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+LY NPYSW
Sbjct  50   GRALFYWLVEAAENPSSKPLVLWLNGGPGCSSVAYGEAEELGPFHIHADGKSLYLNPYSW  109

Query  414  NLAANLLFVDSPAGVGYSY  470
            N  AN+LF+DSPAGVG+SY
Sbjct  110  NKLANILFLDSPAGVGFSY  128



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   127 bits (318),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 2/90 (2%)
 Frame = +3

Query  234  GEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY
Sbjct  68   GRALFYWLIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPY  127

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILT  497
            +WN  ANLLF+DSPAGVG+SYSNTS D++T
Sbjct  128  AWNKVANLLFLDSPAGVGFSYSNTSFDMVT  157


 Score = 46.2 bits (108),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALF  ++
Sbjct  36   HQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFYWLI  76



>gb|ACA61622.1| hypothetical protein AP7_B10.2 [Arabidopsis lyrata subsp. petraea]
Length=200

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G + FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL  N Y+W
Sbjct  49   GRNLFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRLNLYAW  108

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  109  NKVANVLFLDSPAGVGFSYTNTSSDKLTVGD  139



>ref|XP_004304228.1| PREDICTED: serine carboxypeptidase-like 25 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   128 bits (321),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +3

Query  228  SLGEHFFYWFFEA-VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
             +G   FYW  EA V+DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LYWN 
Sbjct  66   RVGRALFYWLTEAAVKDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTATGLYWNK  125

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +SWN  ANLLF+++PAGVG+SYSN S+D+   GD
Sbjct  126  FSWNTEANLLFLETPAGVGFSYSNRSADLFDTGD  159


 Score = 45.1 bits (105),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            ++ VLLL   I    GS + ++++ D ++ LPG    V+F  +SGYVTVN   GRALF
Sbjct  17   MVSVLLLGLFISASNGSVN-EEEEADRIVSLPGQP-KVTFQQFSGYVTVNHRVGRALF  72



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   125 bits (313),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+W
Sbjct  76   GRALFYWLVEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAW  135

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SYSNTSSD+ T GD
Sbjct  136  NTVANVLFLESPAGVGFSYSNTSSDLYTAGD  166


 Score = 47.8 bits (112),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  83   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALF  ++
Sbjct  27   LLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWLV  84



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (78%), Gaps = 2/95 (2%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            S G   FYW  E      P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V  +GKTLY N
Sbjct  63   SAGRALFYWLIEVPRHLRPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPNGKTLYLN  122

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD
Sbjct  123  PYAWNREANLLFLDSPAGVGFSYSNTSSDVYTPGD  157


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALF  ++
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLI  73



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   124 bits (311),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = +3

Query  234  GEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            G   FYW  E+    DP  +PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y
Sbjct  57   GRALFYWLVESPSTRDPKFRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLY  116

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  ANLLF++SPAGVG+SYSNT+SD+ T GD
Sbjct  117  AWNQLANLLFLESPAGVGFSYSNTTSDLYTTGD  149


 Score = 48.1 bits (113),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  119  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALF  ++
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLV  65



>gb|KDO75846.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
 gb|KDO75847.1| hypothetical protein CISIN_1g0117382mg, partial [Citrus sinensis]
Length=318

 Score =   125 bits (313),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NPY+W
Sbjct  74   GRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNPYAW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT++D    GD
Sbjct  134  NKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164


 Score = 47.4 bits (111),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 10/68 (15%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  224  QESGRALF  247
            + +GRALF
Sbjct  71   EHNGRALF  78



>ref|XP_002520355.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF42021.1| serine carboxypeptidase, putative [Ricinus communis]
Length=572

 Score =   128 bits (321),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA   P  KPLVLWLNGGPGCSSI +G AEE+GPF   K    L  NPYSW
Sbjct  62   GRALFYWFFEATTKPQEKPLVLWLNGGPGCSSIGYGEAEELGPFFPRKRQPELKLNPYSW  121

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N AANLLF++SP GVG+SY+NTSSDI   GD
Sbjct  122  NKAANLLFIESPVGVGFSYTNTSSDINELGD  152


 Score = 44.3 bits (103),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 4/61 (7%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            LL   +L  S+ G    S  +   +Q+ D V+ LPG    VSF  Y+GYVTVN   GRAL
Sbjct  7    LLVAPVLLMSLGGAAAVSGCELSHEQEADRVIKLPGQP-EVSFKQYAGYVTVNVTHGRAL  65

Query  245  F  247
            F
Sbjct  66   F  66



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYWF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++
Sbjct  59   KKAGRALFYWFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFF  118

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPYSWN  ANLLFV+SPAGVG+SYSNTSSD+ T GD
Sbjct  119  NPYSWNKLANLLFVESPAGVGFSYSNTSSDLYTAGD  154


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFL  250
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALF 
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  251  LVL  259
              +
Sbjct  68   WFI  70



>ref|XP_010546240.1| PREDICTED: serine carboxypeptidase-like 34 isoform X1 [Tarenaya 
hassleriana]
Length=492

 Score =   127 bits (320),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYWFFEA   PS KPL+LWLNGGPGCSSI +G +EE+GPF  +KD   L +N Y
Sbjct  76   TRGRALFYWFFEATRHPSRKPLLLWLNGGPGCSSIGYGASEELGPFFPQKDQPNLKFNRY  135

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AANLLF++SP GVG+SY+NTSSDI   GD
Sbjct  136  SWNKAANLLFLESPVGVGFSYTNTSSDIGELGD  168


 Score = 44.3 bits (103),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 6/52 (12%)
 Frame = +2

Query  107  DGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D  +GSS ++     +Q+ D V  LPG    V F HYSGYVTVN+  GRALF
Sbjct  32   DEEEGSSCLNSGVLSRQRADIVRGLPGQP-PVKFRHYSGYVTVNETRGRALF  82



>ref|XP_010546241.1| PREDICTED: serine carboxypeptidase-like 34 isoform X2 [Tarenaya 
hassleriana]
Length=491

 Score =   127 bits (320),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYWFFEA   PS KPL+LWLNGGPGCSSI +G +EE+GPF  +KD   L +N Y
Sbjct  76   TRGRALFYWFFEATRHPSRKPLLLWLNGGPGCSSIGYGASEELGPFFPQKDQPNLKFNRY  135

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN AANLLF++SP GVG+SY+NTSSDI   GD
Sbjct  136  SWNKAANLLFLESPVGVGFSYTNTSSDIGELGD  168


 Score = 44.3 bits (103),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 6/52 (12%)
 Frame = +2

Query  107  DGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D  +GSS ++     +Q+ D V  LPG    V F HYSGYVTVN+  GRALF
Sbjct  32   DEEEGSSCLNSGVLSRQRADIVRGLPGQP-PVKFRHYSGYVTVNETRGRALF  82



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY 
Sbjct  56   KQSGRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYS  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGD  151



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   126 bits (317),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            + G   FYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y
Sbjct  66   TAGRALFYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIY  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF+DSPAGVG+SY+NTSSD +T GD
Sbjct  126  AWNKVANVLFLDSPAGVGFSYTNTSSDEVTVGD  158


 Score = 45.4 bits (106),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  12   CMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGRAL  71

Query  245  F  247
            F
Sbjct  72   F  72



>ref|XP_006467848.1| PREDICTED: serine carboxypeptidase-like 31-like [Citrus sinensis]
Length=478

 Score =   124 bits (311),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NPY+W
Sbjct  74   GRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNPYAW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT++D    GD
Sbjct  134  NKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164


 Score = 47.4 bits (111),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 10/68 (15%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  224  QESGRALF  247
            + +GRALF
Sbjct  71   EHNGRALF  78



>ref|XP_006449285.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
 gb|ESR62525.1| hypothetical protein CICLE_v10015093mg [Citrus clementina]
Length=478

 Score =   124 bits (311),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA+  P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ L +NPY+W
Sbjct  74   GRALFYWFYEAMTRPQEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTDGRGLQFNPYAW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT++D    GD
Sbjct  134  NKEANMLFLESPIGVGFSYSNTTNDYEMLGD  164


 Score = 47.4 bits (111),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 10/68 (15%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSS---------VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  223
            CL F LL A  +   K  ++         +  +  D V +LPG   NV F HY+GYVTVN
Sbjct  12   CLTFCLLNALDVVSAKPLATRWPRDDGLNLSSENEDLVTNLPGQP-NVDFRHYAGYVTVN  70

Query  224  QESGRALF  247
            + +GRALF
Sbjct  71   EHNGRALF  78



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   126 bits (317),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y+W
Sbjct  66   GRALFYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIYAW  125

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF+DSPAGVG+SY+NTSSD LT GD
Sbjct  126  NKVANVLFLDSPAGVGFSYTNTSSDELTVGD  156


 Score = 44.7 bits (104),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +2

Query  71   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  244
            C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  10   CMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGRAL  69

Query  245  F  247
            F
Sbjct  70   F  70



>ref|XP_002452974.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
 gb|EES05950.1| hypothetical protein SORBIDRAFT_04g035810 [Sorghum bicolor]
Length=488

 Score =   130 bits (326),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            R  G   FYW  EAV D ++KPLVLWLNGGPGCSS+A+G +EE+GPF ++ +G  L+ N 
Sbjct  85   RDGGRALFYWLTEAVGDAAAKPLVLWLNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNK  144

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  145  YSWNREANLLFLESPAGVGFSYTNTTSDLKTTGD  178


 Score = 41.2 bits (95),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V+ LPG    V+FA YSGYVTVN++ GRALF
Sbjct  61   DRVVALPGQP-AVAFAQYSGYVTVNRDGGRALF  92



>gb|KHG14577.1| Serine carboxypeptidase 24 -like protein [Gossypium arboreum]
Length=465

 Score =   130 bits (327),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  63   GRGLFYWFTEATRVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SY+NTSSD+   GD
Sbjct  123  NMEANILFLESPAGVGFSYTNTSSDLKDSGD  153


 Score = 41.2 bits (95),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            QQ+LD +  LPG    V F+ +SGYVTVN++ GR LF
Sbjct  32   QQELDRISSLPGQP-PVGFSQFSGYVTVNEKHGRGLF  67



>ref|XP_010501423.1| PREDICTED: serine carboxypeptidase-like 31 [Camelina sativa]
Length=635

 Score =   125 bits (313),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA++ P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ +G  L +NPY
Sbjct  73   SNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNGNGLNFNPY  132

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF++SP GVG+SYSNTSSD    GD
Sbjct  133  AWNKEANMLFLESPVGVGFSYSNTSSDYQKLGD  165


 Score = 46.6 bits (109),  Expect(2) = 4e-34, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 11/73 (15%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  208
            S L++ CL  +L+LA  +        D  K S   ++Q  D V DLPG   +VSF HY+G
Sbjct  10   SILTFLCLTALLMLAPVVLCTRQHRFDSPKRSLLANEQ--DLVTDLPGQP-DVSFRHYAG  66

Query  209  YVTVNQESGRALF  247
            YV V++ +GRA+F
Sbjct  67   YVPVDESNGRAMF  79



>ref|XP_009413121.1| PREDICTED: serine carboxypeptidase-like 34 [Musa acuminata subsp. 
malaccensis]
Length=478

 Score =   122 bits (305),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA  D   KPL+LWLNGGPGCSSI +G AEE+GPF ++K    L +N +
Sbjct  66   SHGRALFYWFFEATHDVEKKPLLLWLNGGPGCSSIGYGAAEELGPFLMQKGVPQLRFNQH  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SP GVG+SY+NTSSD+ + GD
Sbjct  126  SWNKEANLLFLESPVGVGFSYTNTSSDLQSLGD  158


 Score = 49.3 bits (116),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 6/73 (8%)
 Frame = +2

Query  44   LEMSALSWGCLLFVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSG  208
            + + ++S    L VLL + S+  G  S  +D     QQ+ D V+ LPG    VSF  Y+G
Sbjct  1    MRLFSISSASFLLVLLFSCSLVRGGRSRELDREALRQQEADRVVGLPGQP-PVSFRQYAG  59

Query  209  YVTVNQESGRALF  247
            YVTVN+  GRALF
Sbjct  60   YVTVNESHGRALF  72



>ref|XP_006578498.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max]
Length=545

 Score =   124 bits (311),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FY+F E+  +PS+KPLVLWLNGGPGCSS+ +G  EE+GPF +  DGKTLY N Y+W
Sbjct  155  GRALFYYFVESSYNPSTKPLVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAW  214

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SYSNT SD    GD
Sbjct  215  NVVANVLFLESPAGVGFSYSNTISDYEHSGD  245


 Score = 47.0 bits (110),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D ++ LPG  + V+F  YSGYVTV+ E+GRALF
Sbjct  123  QKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALF  159



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+
Sbjct  56   QQAGRALFYWLVEAPTSRSPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYF  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGD  151


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLV  67



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   125 bits (313),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA    ++ PL+LWLNGGPGCSSIA+G AEE+GPF +  +G+TL+ NPYSW
Sbjct  60   GRALFYWLVEAEAAAATAPLILWLNGGPGCSSIAYGSAEEIGPFRIHPNGRTLFSNPYSW  119

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+DSPAGVGYSY+NT+SD+ T GD
Sbjct  120  NKLANLLFLDSPAGVGYSYTNTTSDLYTTGD  150


 Score = 46.2 bits (108),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            + ++ D + +LPG   NV F+ YSGYVTV+Q++GRALF  ++
Sbjct  27   EDEEGDKISELPGQPGNVGFSQYSGYVTVDQDAGRALFYWLV  68



>ref|XP_006345489.1| PREDICTED: serine carboxypeptidase-like 40-like [Solanum tuberosum]
Length=460

 Score =   132 bits (331),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +S G   FY+F EA E+  S PL+LWLNGGPGCSS+A+G  EE+GPF + KDGKTLY N 
Sbjct  42   KSAGRALFYYFVEAHENFKSLPLLLWLNGGPGCSSLAYGAMEEIGPFRIHKDGKTLYRNN  101

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            YSWN AANLLF++SPAGVG+SYSN SS++ ++GD
Sbjct  102  YSWNQAANLLFLESPAGVGFSYSNISSEVKSNGD  135


 Score = 39.3 bits (90),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D +  LPG  F V F  Y GYVTVN+ +GRALF
Sbjct  18   DQIKKLPGQPF-VKFKQYGGYVTVNKSAGRALF  49



>ref|XP_007146042.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
 gb|ESW18036.1| hypothetical protein PHAVU_006G007800g [Phaseolus vulgaris]
Length=489

 Score =   124 bits (310),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FY+F E+  +PS+KPLVLWLNGGPGCSS+ +G  EE+GPF +  DGKTLY N Y+W
Sbjct  100  GRALFYYFVESPYNPSTKPLVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAW  159

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SYSNTSSD    GD
Sbjct  160  NEVANVLFLESPAGVGFSYSNTSSDYDHAGD  190


 Score = 47.0 bits (110),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  140  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q+ D ++ LPG  + V+F  YSGYVTV+ E+GRALF
Sbjct  69   QQADKIVALPGQSYGVNFDQYSGYVTVDPEAGRALF  104



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ 
Sbjct  57   QQAGRALFYWLVEAPANRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYSNTSSDLYTAGD  152


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALF  ++
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLV  68



>ref|XP_008800209.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=498

 Score =   128 bits (322),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +3

Query  234  GEHFFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            G   FY+F EA   DPSS+PLVLWLNGGPGCSS+ +G  EE+GPF V  DGKTL+ NPY+
Sbjct  108  GRALFYYFAEAASADPSSRPLVLWLNGGPGCSSLGYGAMEELGPFRVMSDGKTLFRNPYA  167

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  AN+LF++SPAGVG+SYSNT+SD    GD
Sbjct  168  WNRVANVLFLESPAGVGFSYSNTTSDYGNSGD  199


 Score = 42.4 bits (98),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 36/76 (47%), Gaps = 12/76 (16%)
 Frame = +2

Query  29   LTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKL---DAVLDLPGLGFNVSFAH  199
            L + P   +A  +   LF  L          S +  QQ L   D ++ LPG    V F  
Sbjct  46   LKRTPAAANASPYATTLFSDL---------SSKTYPQQGLKESDKIIKLPGQPEGVDFDQ  96

Query  200  YSGYVTVNQESGRALF  247
            Y GYVTV+ E+GRALF
Sbjct  97   YGGYVTVDMEAGRALF  112



>gb|KHN35601.1| Serine carboxypeptidase II-3 [Glycine soja]
Length=495

 Score =   124 bits (310),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FY+F E+  +PS+KPLVLWLNGGPGCSS+ +G  EE+GPF +  DGKTLY N Y+W
Sbjct  101  GRALFYYFVESSYNPSTKPLVLWLNGGPGCSSLGYGAFEELGPFRINSDGKTLYRNKYAW  160

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N+ AN+LF++SPAGVG+SYSNT SD    GD
Sbjct  161  NVVANVLFLESPAGVGFSYSNTISDYEHSGD  191


 Score = 47.0 bits (110),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            Q++ D ++ LPG  + V+F  YSGYVTV+ E+GRALF
Sbjct  69   QKEADKIVALPGQPYGVNFDQYSGYVTVDPEAGRALF  105



>emb|CBI18754.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   125 bits (314),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA   P+ KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG  L +NPYSW
Sbjct  93   GRALFYWFYEATTQPNEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSW  152

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT+SD    GD
Sbjct  153  NREANMLFLESPVGVGFSYSNTTSDYEKLGD  183


 Score = 45.1 bits (105),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V DLPG    V F HY+GYVTVN+E+GRALF
Sbjct  66   DLVTDLPGQP-AVDFRHYAGYVTVNEENGRALF  97



>ref|XP_006845380.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda]
 gb|ERN07055.1| hypothetical protein AMTR_s00019p00043630 [Amborella trichopoda]
Length=458

 Score =   125 bits (314),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            ++ G   FYW  EA  + + KPLVLWLNGGPGCSSIAFG +EE+GPF V K G +LY N 
Sbjct  57   QTHGRALFYWLTEATSNANEKPLVLWLNGGPGCSSIAFGASEEIGPFRVNKTGHSLYLNK  116

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +SWN  ANLLF++SPAGVG+SY+NT+SD+   GD
Sbjct  117  FSWNKDANLLFLESPAGVGFSYTNTTSDLKDSGD  150


 Score = 45.4 bits (106),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +2

Query  134  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D+++ D +++LPG    VSF  +SGYVTVNQ  GRALF
Sbjct  28   DEREKDRIINLPGQP-KVSFEQFSGYVTVNQTHGRALF  64



>ref|XP_008801741.1| PREDICTED: serine carboxypeptidase-like 33 isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   122 bits (305),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +R  G   FYWFFEA  +PS +PL+LWLNGGPGCSSI +G A E+GP  V++ G+ L +N
Sbjct  60   SRENGRALFYWFFEAQTEPSKRPLLLWLNGGPGCSSIGYGAAVEMGPLRVKRYGRGLEFN  119

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             Y+WN  ANLLF++SP GVG+SY+NTSSD+    D
Sbjct  120  KYAWNKEANLLFLESPVGVGFSYTNTSSDLTKLDD  154


 Score = 48.9 bits (115),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +LF L    SI   +     + Q+ D V +LPG   + S +H+SGY+TV++E+GRALF
Sbjct  11   ILFFLSFIKSIKPLQEEVHQNDQESDRVFNLPGQPRSPSLSHFSGYITVSRENGRALF  68



>ref|XP_007035881.1| Serine carboxypeptidase-like 33 [Theobroma cacao]
 gb|EOY06807.1| Serine carboxypeptidase-like 33 [Theobroma cacao]
Length=468

 Score =   124 bits (312),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWFFEA   PS KPL+LWLNGGPGCSSIA+G A E+GP  V K+G  L++N Y+W
Sbjct  69   GRALFYWFFEAQSQPSEKPLLLWLNGGPGCSSIAYGAASELGPLRVGKNGGDLHFNKYAW  128

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LFV+SP GVG+SY+NTSSD+    D
Sbjct  129  NKVANILFVESPVGVGFSYTNTSSDLTKLND  159


 Score = 46.2 bits (108),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
             F+  L T I G    + +  Q+ D V++LPG   + S + +SGY+TVNQE GRALF
Sbjct  19   FFLGFLITHIKGS--GAYLTAQESDRVINLPGQPPSPSISQFSGYITVNQEHGRALF  73



>ref|XP_008801742.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Phoenix 
dactylifera]
Length=434

 Score =   122 bits (305),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  222  TRSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +R  G   FYWFFEA  +PS +PL+LWLNGGPGCSSI +G A E+GP  V++ G+ L +N
Sbjct  60   SRENGRALFYWFFEAQTEPSKRPLLLWLNGGPGCSSIGYGAAVEMGPLRVKRYGRGLEFN  119

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
             Y+WN  ANLLF++SP GVG+SY+NTSSD+    D
Sbjct  120  KYAWNKEANLLFLESPVGVGFSYTNTSSDLTKLDD  154


 Score = 48.9 bits (115),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +LF L    SI   +     + Q+ D V +LPG   + S +H+SGY+TV++E+GRALF
Sbjct  11   ILFFLSFIKSIKPLQEEVHQNDQESDRVFNLPGQPRSPSLSHFSGYITVSRENGRALF  68



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 8/114 (7%)
 Frame = +3

Query  171  GLASMSALHTILGM*L*TRSLGEHFFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGL  344
            G A  S   T+       +  G   FYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G 
Sbjct  42   GFAQFSGYVTV------NKKAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGA  95

Query  345  AEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD
Sbjct  96   AEEIGPFRIRPDGKTLYLNPYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGD  149



>emb|CAN82217.1| hypothetical protein VITISV_020424 [Vitis vinifera]
Length=492

 Score =   125 bits (314),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA   P+ KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG  L +NPYSW
Sbjct  74   GRALFYWFYEATTQPNEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT+SD    GD
Sbjct  134  NREANMLFLESPVGVGFSYSNTTSDYEKLGD  164


 Score = 45.1 bits (105),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V DLPG    V F HY+GYVTVN+E+GRALF
Sbjct  47   DLVTDLPGQP-AVDFRHYAGYVTVNEENGRALF  78



>ref|XP_010645362.1| PREDICTED: serine carboxypeptidase-like 31 [Vitis vinifera]
Length=481

 Score =   125 bits (314),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA   P+ KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG  L +NPYSW
Sbjct  74   GRALFYWFYEATTQPNEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGHGLKFNPYSW  133

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT+SD    GD
Sbjct  134  NREANMLFLESPVGVGFSYSNTTSDYEKLGD  164


 Score = 45.1 bits (105),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V DLPG    V F HY+GYVTVN+E+GRALF
Sbjct  47   DLVTDLPGQP-AVDFRHYAGYVTVNEENGRALF  78



>ref|XP_009596929.1| PREDICTED: serine carboxypeptidase-like 25 [Nicotiana tomentosiformis]
Length=468

 Score =   125 bits (314),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW  EA  +P SKPLVLWLNGGPGCSS+A+G +EE+GPF + K    LY N +S
Sbjct  63   VGRALFYWLTEAENEPLSKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTSSGLYVNKFS  122

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  ANLLF+++PAGVG+SYSN SSD+L  GD
Sbjct  123  WNKLANLLFLETPAGVGFSYSNRSSDLLDTGD  154


 Score = 45.1 bits (105),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +2

Query  86   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            L+L  ++     ++  ++++ D ++ LPG    VSF  YSGYVTVNQ  GRALF
Sbjct  16   LILVAAVCTVNATNYKEEEEADRIISLPGQP-KVSFQQYSGYVTVNQIVGRALF  68



>ref|XP_009771074.1| PREDICTED: serine carboxypeptidase-like 25 [Nicotiana sylvestris]
Length=463

 Score =   124 bits (311),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  231  LGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  410
            +G   FYW  EA  +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +S
Sbjct  58   VGRALFYWLTEADNEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTSSGLYLNKFS  117

Query  411  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            WN  ANLLF+++PAGVG+SYSN SSD+L  GD
Sbjct  118  WNKLANLLFLETPAGVGFSYSNRSSDLLDTGD  149


 Score = 46.2 bits (108),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +2

Query  77   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + +L+L  ++     ++  +++++D ++ LPG    VSF  YSGYVTVNQ  GRALF
Sbjct  8    VVLLILVAAVCTVNATNYKEEEEVDRIISLPGQP-KVSFQQYSGYVTVNQIVGRALF  63



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGD  152


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>ref|XP_006408447.1| hypothetical protein EUTSA_v10020652mg [Eutrema salsugineum]
 gb|ESQ49900.1| hypothetical protein EUTSA_v10020652mg [Eutrema salsugineum]
Length=472

 Score =   124 bits (310),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  225  RSLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  404
            +S+G   FYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N 
Sbjct  58   KSVGRSLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRISKGGSGLYLNK  117

Query  405  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            ++WN  ANLLF+++PAGVG+SY+N SSD+   GD
Sbjct  118  FAWNSLANLLFLEAPAGVGFSYTNRSSDLFNTGD  151


 Score = 46.6 bits (109),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C++F + +AT +   +G S +     + + D +  LPG   NV+F  +SGYVTV++  GR
Sbjct  4    CVIFTIFMATLVMTSQGRSQIGGGEKEAEADRITSLPGQP-NVTFEQFSGYVTVDKSVGR  62

Query  239  ALF  247
            +LF
Sbjct  63   SLF  65



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  EA     P ++PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+
Sbjct  56   QQAGRALFYWLVEAPTSRSPEARPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYF  115

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SYSNTSSD+ T GD
Sbjct  116  NPYAWNKLANLLFLESPAGVGFSYSNTSSDLYTAGD  151


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  125  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALF  ++
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLV  67



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   126 bits (316),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+W
Sbjct  42   GRALFYWLTEAPSPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAW  101

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+DSPAGVG+SY+N SSD LT GD
Sbjct  102  NKVANLLFLDSPAGVGFSYTNASSDELTVGD  132


 Score = 43.9 bits (102),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  116  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALF
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALF  46



>ref|XP_004954211.1| PREDICTED: serine carboxypeptidase 24-like [Setaria italica]
Length=478

 Score =   127 bits (320),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA  D +SKPLVLWLNGGPGCSS+A+G +EE+GPF ++ +G  L+ N YSW
Sbjct  78   GRALFYWLTEADGDAASKPLVLWLNGGPGCSSVAYGASEEIGPFRIKPNGTGLFLNKYSW  137

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  138  NREANLLFLESPAGVGFSYTNTTSDLKTTGD  168


 Score = 42.4 bits (98),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 1/33 (3%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V  LPG    V+FA YSGYVTVN+E GRALF
Sbjct  51   DRVEALPGQP-PVAFAQYSGYVTVNEERGRALF  82



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPASRKPESRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPYSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  115  NPYSWNKLANLLFLESPAGVGFSYTNTTSDLYTAGD  150


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALF  ++
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLI  66



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY 
Sbjct  57   KQAGRALFYWLVESPAQRGPESRPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYL  116

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+WN  ANLLF++SPAGVG+SY+NTSSD+ T GD
Sbjct  117  NPYAWNNLANLLFLESPAGVGFSYTNTSSDLYTAGD  152


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALF  ++
Sbjct  23   ASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLV  68



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   125 bits (314),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA  +  +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSW
Sbjct  61   GRALFYWLTEATSNAHTKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSW  120

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SY+NTSS++   GD
Sbjct  121  NRVANILFLESPAGVGFSYTNTSSNLKDSGD  151


 Score = 44.3 bits (103),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = +2

Query  74   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +L +  L++S+     ++    Q+LD +  LPG    V+F+ +SGYVTVN++ GRALF
Sbjct  9    VLLLCFLSSSVLTALLAALPADQELDRISALPGQP-PVNFSQFSGYVTVNEQQGRALF  65



>ref|XP_006845845.1| hypothetical protein AMTR_s00154p00033550 [Amborella trichopoda]
 gb|ERN07520.1| hypothetical protein AMTR_s00154p00033550 [Amborella trichopoda]
Length=475

 Score =   127 bits (320),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
             +G   FYW  EA  +P S+PLVLWLNGGPGCSSIA+G +EE+GPF ++K    LY N +
Sbjct  66   QVGRALFYWLTEAELEPESRPLVLWLNGGPGCSSIAYGASEEIGPFRIKKSASGLYLNKF  125

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            SWN  ANLLF++SP GVGYSY+NTSSD+   GD
Sbjct  126  SWNKVANLLFLESPVGVGYSYTNTSSDLTNFGD  158


 Score = 42.4 bits (98),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +++ D +L LPG    VSF  +SGYVTVN++ GRALF
Sbjct  37   EEEQDRILRLPGQP-EVSFKQFSGYVTVNEQVGRALF  72



>ref|XP_010458486.1| PREDICTED: serine carboxypeptidase-like 31 [Camelina sativa]
Length=488

 Score =   124 bits (312),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  228  SLGEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  407
            S G   FYWFFEA++ P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ +G  L +NPY
Sbjct  73   SNGRAMFYWFFEAMDLPKEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNGNGLNFNPY  132

Query  408  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            +WN  AN+LF++SP GVG+SYSNTSSD    GD
Sbjct  133  AWNKEANMLFLESPVGVGFSYSNTSSDYQKLGD  165


 Score = 45.4 bits (106),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 11/73 (15%)
 Frame = +2

Query  53   SALSWGCLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  208
            S L++ CL  +L+LA  +        D  K S   ++Q  D V DLPG   +VSF HY+G
Sbjct  10   SILTFLCLTALLMLAPVVFCTRKHRFDSPKRSLLANEQ--DLVTDLPGQP-DVSFRHYAG  66

Query  209  YVTVNQESGRALF  247
            YV V++ +GRA+F
Sbjct  67   YVPVDESNGRAMF  79



>ref|XP_010278297.1| PREDICTED: serine carboxypeptidase-like 31 [Nelumbo nucifera]
Length=482

 Score =   122 bits (305),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF+EA   P  KPLVLWLNGGPGCSS+ +G  +E+GPF V+ DG+ +  NPYSW
Sbjct  70   GRALFYWFYEASVRPDEKPLVLWLNGGPGCSSVGYGATQEIGPFIVDTDGRGIKLNPYSW  129

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SP GVG+SYSNT++D    GD
Sbjct  130  NKEANMLFLESPVGVGFSYSNTTTDYKILGD  160


 Score = 47.8 bits (112),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  149  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            D V DLPG   +V F HY+GYVTVN+++GRALF
Sbjct  42   DLVTDLPGQPADVGFRHYAGYVTVNEKNGRALF  74



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   130 bits (326),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYWF E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+W
Sbjct  64   GRSLFYWFTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAW  123

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  AN+LF++SPAGVG+SY+NTSSD+ T GD
Sbjct  124  NREANVLFLESPAGVGFSYTNTSSDLKTSGD  154


 Score = 39.7 bits (91),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  137  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  247
            +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LF
Sbjct  33   EQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLF  68



>ref|XP_008783277.1| PREDICTED: serine carboxypeptidase II-3-like [Phoenix dactylifera]
Length=499

 Score =   125 bits (313),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +3

Query  225  RSLGEHFFYWFFEA-VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  401
            +  G   FY+  EA   DPSS+PLVLWLNGGPGCSS   G  EE+GPF V  DGKTL+ N
Sbjct  106  KEAGRALFYYLTEAATADPSSRPLVLWLNGGPGCSSFGIGAMEELGPFRVMSDGKTLFRN  165

Query  402  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            PY+WN  AN+LF++SPAGVG+SYSNT+SD    GD
Sbjct  166  PYAWNRVANVLFLESPAGVGFSYSNTTSDYGNSGD  200


 Score = 44.7 bits (104),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 12/78 (15%)
 Frame = +2

Query  23   LCLTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKL---DAVLDLPGLGFNVSF  193
            L L + P   +A S+   LF  +          S +  QQ L   D ++ LPG    V F
Sbjct  45   LMLKRAPAAANASSYATALFSDM---------SSKTYPQQGLKESDKIIKLPGQPEGVDF  95

Query  194  AHYSGYVTVNQESGRALF  247
              Y GYVTV++E+GRALF
Sbjct  96   DQYGGYVTVDKEAGRALF  113



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            +  G   FYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY 
Sbjct  55   QQAGRALFYWLIESPASRKPESRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYL  114

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPYSWN  ANLLF++SPAGVG+SY+NT+SD+ T GD
Sbjct  115  NPYSWNKLANLLFLESPAGVGFSYTNTTSDLYTAGD  150


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  122  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFLLVL  259
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALF  ++
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLI  66



>emb|CDY43258.1| BnaC05g48510D [Brassica napus]
Length=473

 Score =   122 bits (305),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  234  GEHFFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  413
            G   FYW  EA   P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N ++W
Sbjct  63   GRSLFYWLTEASHLPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRIRKGGSGLYLNKFAW  122

Query  414  NLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            N  ANLLF+++PAGVG+SY+N SSD+   GD
Sbjct  123  NSIANLLFLEAPAGVGFSYTNRSSDLFNTGD  153


 Score = 47.8 bits (112),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = +2

Query  71   CLLFVLLLATSIDGGKGSSSV----DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  238
            C+LF  L+A  I   +G S       Q + D +  LPG   NV+F  +SGYVTV + SGR
Sbjct  6    CVLFTTLMAILIMTSQGRSQAREGEKQAEADRITSLPGQP-NVTFEQFSGYVTVAKHSGR  64

Query  239  ALF  247
            +LF
Sbjct  65   SLF  67



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 2/96 (2%)
 Frame = +3

Query  225  RSLGEHFFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  398
            R  G   FYW  E  A   P S+PLVLWLNGGPGCSS+A+GLAEE+GPF +  DGKTLY 
Sbjct  66   RQAGRALFYWLVESPASRRPESRPLVLWLNGGPGCSSVAYGLAEEIGPFRIRPDGKTLYS  125

Query  399  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  506
            NPY+W+  ANLLF++SPAG+G+SY+NT+SD+ T GD
Sbjct  126  NPYAWSKLANLLFLESPAGIGFSYTNTTSDLYTTGD  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510