BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034C07

Length=331
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006388444.1|  hypothetical protein POPTR_0184s002102g            120   1e-32   
gb|KDP28272.1|  hypothetical protein JCGZ_14043                         125   6e-31   Jatropha curcas
ref|XP_009610166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    125   8e-31   Nicotiana tomentosiformis
emb|CDP17060.1|  unnamed protein product                                125   1e-30   Coffea canephora [robusta coffee]
ref|XP_009610165.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   2e-30   Nicotiana tomentosiformis
ref|XP_006349177.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   2e-30   Solanum tuberosum [potatoes]
ref|XP_004229381.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    123   6e-30   Solanum lycopersicum
ref|XP_011042271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    122   1e-29   Populus euphratica
ref|XP_002301515.2|  DEAD/DEAH box helicase family protein              122   2e-29   
ref|XP_009403707.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54423.1|  DEAD-box ATP-dependent RNA helicase 24-like protein     119   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010267974.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_007163191.1|  hypothetical protein PHAVU_001G214100g             119   2e-28   Phaseolus vulgaris [French bean]
emb|CAN74586.1|  hypothetical protein VITISV_041989                     119   2e-28   Vitis vinifera
ref|XP_002277419.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-28   Vitis vinifera
ref|XP_009758479.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   4e-28   Nicotiana sylvestris
ref|XP_004494431.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   4e-28   Cicer arietinum [garbanzo]
ref|XP_004494432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   4e-28   Cicer arietinum [garbanzo]
ref|XP_009758471.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   6e-28   Nicotiana sylvestris
ref|XP_010921475.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-27   Elaeis guineensis
ref|XP_010938236.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-27   Elaeis guineensis
ref|XP_008808687.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-27   Phoenix dactylifera
ref|XP_004152219.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   1e-26   Cucumis sativus [cucumbers]
ref|XP_008454276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   1e-26   Cucumis melo [Oriental melon]
ref|XP_007051130.1|  P-loop containing nucleoside triphosphate hy...    112   2e-26   
ref|XP_007051129.1|  P-loop containing nucleoside triphosphate hy...    113   2e-26   
ref|XP_004156816.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    113   2e-26   
ref|XP_002515267.1|  hypothetical protein RCOM_1346600                  113   2e-26   Ricinus communis
ref|XP_007051128.1|  P-loop containing nucleoside triphosphate hy...    113   3e-26   
ref|XP_010544963.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    112   3e-26   Tarenaya hassleriana [spider flower]
gb|KDO86973.1|  hypothetical protein CISIN_1g003881mg                   110   1e-25   Citrus sinensis [apfelsine]
ref|XP_009416320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444513.1|  hypothetical protein CICLE_v10018925mg             110   1e-25   
gb|KDO86968.1|  hypothetical protein CISIN_1g003881mg                   110   1e-25   Citrus sinensis [apfelsine]
ref|XP_006444514.1|  hypothetical protein CICLE_v10018925mg             110   2e-25   Citrus clementina [clementine]
ref|XP_003625986.1|  DEAD-box ATP-dependent RNA helicase                109   4e-25   Medicago truncatula
ref|XP_011468779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   9e-25   Fragaria vesca subsp. vesca
ref|XP_004288535.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   1e-24   Fragaria vesca subsp. vesca
gb|KJB22485.1|  hypothetical protein B456_004G050000                    108   1e-24   Gossypium raimondii
gb|KJB22484.1|  hypothetical protein B456_004G050000                    107   2e-24   Gossypium raimondii
ref|XP_006840470.1|  hypothetical protein AMTR_s00045p00182070          106   5e-24   
gb|KHG13094.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    105   1e-23   Gossypium arboreum [tree cotton]
ref|XP_009349922.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_008343158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   2e-23   
ref|XP_006293732.1|  hypothetical protein CARUB_v10022694mg             103   4e-23   Capsella rubella
gb|EYU46816.1|  hypothetical protein MIMGU_mgv1a001735mg                103   4e-23   Erythranthe guttata [common monkey flower]
ref|XP_010507898.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006397925.1|  hypothetical protein EUTSA_v10001321mg             103   5e-23   Eutrema salsugineum [saltwater cress]
ref|NP_566099.1|  DEAD-box ATP-dependent RNA helicase 24                103   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007221465.1|  hypothetical protein PRUPE_ppa001666mg             103   6e-23   Prunus persica
ref|XP_009370603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   6e-23   Pyrus x bretschneideri [bai li]
ref|XP_002882116.1|  hypothetical protein ARALYDRAFT_483908             102   8e-23   
ref|XP_008381412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   9e-23   
ref|XP_008227876.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   1e-22   Prunus mume [ume]
ref|XP_010518433.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010518432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010506769.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010506768.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_008781128.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    100   6e-22   Phoenix dactylifera
ref|XP_010069832.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    1e-21   Eucalyptus grandis [rose gum]
ref|XP_003521597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  95.5    4e-20   Glycine max [soybeans]
ref|XP_010679398.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.5    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679397.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.9    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011079539.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.7    4e-18   Sesamum indicum [beniseed]
ref|XP_011079538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  89.7    4e-18   Sesamum indicum [beniseed]
gb|KHN19202.1|  DEAD-box ATP-dependent RNA helicase 24                85.9    9e-17   Glycine soja [wild soybean]
gb|KJB22491.1|  hypothetical protein B456_004G050200                  84.0    4e-16   Gossypium raimondii
gb|KJB22489.1|  hypothetical protein B456_004G050200                  84.0    4e-16   Gossypium raimondii
gb|KJB22487.1|  hypothetical protein B456_004G050200                  84.0    4e-16   Gossypium raimondii
gb|KJB22490.1|  hypothetical protein B456_004G050200                  83.6    5e-16   Gossypium raimondii
gb|KHG18820.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein  83.6    5e-16   Gossypium arboreum [tree cotton]
gb|KJB22488.1|  hypothetical protein B456_004G050200                  83.2    6e-16   Gossypium raimondii
ref|XP_003554554.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  83.2    7e-16   Glycine max [soybeans]
ref|XP_001779387.1|  predicted protein                                70.5    2e-11   
gb|EPS66709.1|  hypothetical protein M569_08067                       60.1    6e-08   Genlisea aurea
ref|XP_002467976.1|  hypothetical protein SORBIDRAFT_01g037410        54.7    4e-06   Sorghum bicolor [broomcorn]
ref|XP_008654947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  54.7    4e-06   Zea mays [maize]
ref|XP_008654950.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  54.3    4e-06   Zea mays [maize]
gb|AFW88580.1|  putative DEAD-box ATP-dependent RNA helicase fami...  54.3    5e-06   
ref|NP_001147596.1|  pre-mRNA-processing ATP-dependent RNA helica...  54.3    6e-06   Zea mays [maize]
gb|EEC75096.1|  hypothetical protein OsI_11255                        53.1    1e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001049904.1|  Os03g0308500                                     52.4    2e-05   
ref|XP_004984607.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.6    4e-05   Setaria italica



>ref|XP_006388444.1| hypothetical protein POPTR_0184s002102g, partial [Populus trichocarpa]
 gb|ERP47358.1| hypothetical protein POPTR_0184s002102g, partial [Populus trichocarpa]
Length=97

 Score =   120 bits (302),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 7/95 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++++    +  + G+  EIDPLDAFMEGIHEEM+A
Sbjct  54   DDNDAAKESAENNGSAAEIDPLDAFMEGIHEEMRA  88



>gb|KDP28272.1| hypothetical protein JCGZ_14043 [Jatropha curcas]
Length=774

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 82/95 (86%), Gaps = 2/95 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTDLDNIDY+E D 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYEENDN  58

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             +D + D +  +G ADDEIDPLDAFMEGIHEEM+A
Sbjct  59   AKDTSADNSKDNGAADDEIDPLDAFMEGIHEEMRA  93



>ref|XP_009610166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana tomentosiformis]
Length=636

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI+Y+E D 
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNIEYEEHDA  60

Query  227  nednnndindgsggadd--EIDPLDAFMEGIHEEMKA  331
              ++N ++  G GG  +  EIDPLDAFMEGIHEEMKA
Sbjct  61   VGEDNKNVGGGGGGGAEDDEIDPLDAFMEGIHEEMKA  97



>emb|CDP17060.1| unnamed protein product [Coffea canephora]
Length=778

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 82/96 (85%), Gaps = 3/96 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR-SVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPS+R S GGHDNYEDTDLDNI  +  D
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSARSSSGGHDNYEDTDLDNI--EYDD  58

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             + D+N + ND   G +DEIDPLDAFMEGIHEEM+A
Sbjct  59   RDVDHNINNNDNGTGGNDEIDPLDAFMEGIHEEMRA  94



>ref|XP_009610165.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana tomentosiformis]
Length=777

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI+Y+E D 
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNIEYEEHDA  60

Query  227  nednnndindgsggadd--EIDPLDAFMEGIHEEMKA  331
              ++N ++  G GG  +  EIDPLDAFMEGIHEEMKA
Sbjct  61   VGEDNKNVGGGGGGGAEDDEIDPLDAFMEGIHEEMKA  97



>ref|XP_006349177.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Solanum 
tuberosum]
Length=774

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI   +   
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNI-EYDDHE  59

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
                NND   G GG DDEIDPLDAFMEGIHEEMKA
Sbjct  60   AVGGNNDDGGGGGGEDDEIDPLDAFMEGIHEEMKA  94



>ref|XP_004229381.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
 ref|XP_010322339.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
Length=774

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ TYNFER +APQRLYVPPSSRS G HDNYEDTDLDNI   +   
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERNQAPQRLYVPPSSRSGGSHDNYEDTDLDNI-EYDEHD  59

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
                NN+   G GG DDEIDPLDAFMEGIH+EMKA
Sbjct  60   AVGGNNNDGGGGGGEDDEIDPLDAFMEGIHQEMKA  94



>ref|XP_011042271.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Populus euphratica]
Length=800

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 7/95 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             +++    +  + G+  EIDPLDAFMEGIHEEM+A
Sbjct  54   ADNDAAKESAENNGSAAEIDPLDAFMEGIHEEMRA  88



>ref|XP_002301515.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80788.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=807

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 7/95 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQATYNFER++APQRLYVPPSSR    HDNYEDTDLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQAPQRLYVPPSSRQ--NHDNYEDTDLDNI-----DY  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++++    +  + G+  EIDPLDAFMEGIHEEM+A
Sbjct  54   DDNDAAKESAENNGSAAEIDPLDAFMEGIHEEMRA  88



>ref|XP_009403707.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=768

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATYNFERA APQRLYVPPSSR VGGHDN+ED DLDNI+YD+ D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERASAPQRLYVPPSSR-VGGHDNHEDADLDNIEYDQSDA  59

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             + +  +  DG+G  D EIDPLDAFMEGI EE++A
Sbjct  60   PDQSPPNGGDGAGDGDGEIDPLDAFMEGIQEEIRA  94



>gb|AGV54423.1| DEAD-box ATP-dependent RNA helicase 24-like protein [Phaseolus 
vulgaris]
Length=760

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 9/95 (9%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TY+FER++APQRLYVPPSSR   GHDNYEDTDLDNI       
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNI-------  51

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            + D NND    +   DDEIDPLDAFMEGIHEEM+A
Sbjct  52   DYDENNDEGIKNSNDDDEIDPLDAFMEGIHEEMRA  86



>ref|XP_010267974.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Nelumbo nucifera]
Length=771

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS  GHDNYED DLDNI  +  + 
Sbjct  1    MSKRKFGFEGFGINRSATYNFERSQAPQRLYVPPSSRS-AGHDNYEDHDLDNI--EYDER  57

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++ N+   +   G  D EIDPLDAFMEGIHEEM+A
Sbjct  58   DDRNDAPNDQSGGADDGEIDPLDAFMEGIHEEMRA  92



>ref|XP_007163191.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
 gb|ESW35185.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
Length=760

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 76/95 (80%), Gaps = 9/95 (9%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TY+FER++APQRLYVPPSSR   GHDNYEDTDLDNI       
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQAPQRLYVPPSSRH--GHDNYEDTDLDNI-------  51

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            + D NND    +   DDEIDPLDAFMEGIHEEM+A
Sbjct  52   DYDENNDEGIKNSNDDDEIDPLDAFMEGIHEEMRA  86



>emb|CAN74586.1| hypothetical protein VITISV_041989 [Vitis vinifera]
Length=771

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS GGHDNYED DLDNI   + D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERSQAPQRLYVPPSSRS-GGHDNYEDHDLDNI---DYDD  56

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             +++      G    D EIDPLDAFMEGIHEEM+A
Sbjct  57   KDEHGEVAGGGGEVDDGEIDPLDAFMEGIHEEMRA  91



>ref|XP_002277419.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Vitis vinifera]
 emb|CBI36962.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATYNFER++APQRLYVPPSSRS GGHDNYED DLDNI   + D 
Sbjct  1    MSKRKFGFEGFGINRPATYNFERSQAPQRLYVPPSSRS-GGHDNYEDHDLDNI---DYDD  56

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             +++      G    D EIDPLDAFMEGIHEEM+A
Sbjct  57   KDEHGEVAGGGGEVDDGEIDPLDAFMEGIHEEMRA  91



>ref|XP_009758479.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana sylvestris]
Length=636

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyde--r  220
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPS  S G HDNYEDTDLDNI+Y+E   
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSLCSGGSHDNYEDTDLDNIEYEEHDA  60

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             G ++ N+    G G  DDEIDPLDAFMEGIHEEMKA
Sbjct  61   VGEDNKNDGAGGGGGAEDDEIDPLDAFMEGIHEEMKA  97



>ref|XP_004494431.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Cicer arietinum]
Length=776

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  223
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR   GHDNYEDTD+DNI+  D+  
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--GHDNYEDTDIDNIEYDDDTR  58

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +NNND + G    ++EIDPLDAFMEGIHEEMKA
Sbjct  59   DEANNNNDGDGGGADKEEEIDPLDAFMEGIHEEMKA  94



>ref|XP_004494432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Cicer arietinum]
Length=775

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  223
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR   GHDNYEDTD+DNI+  D+  
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--GHDNYEDTDIDNIEYDDDTR  58

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +NNND + G    ++EIDPLDAFMEGIHEEMKA
Sbjct  59   DEANNNNDGDGGGADKEEEIDPLDAFMEGIHEEMKA  94



>ref|XP_009758471.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009758473.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
Length=762

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyde--r  220
            MSKRKFGF+GFGIN+Q TYNFER +APQRLYVPPS  S G HDNYEDTDLDNI+Y+E   
Sbjct  1    MSKRKFGFEGFGINKQTTYNFERNQAPQRLYVPPSLCSGGSHDNYEDTDLDNIEYEEHDA  60

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             G ++ N+    G G  DDEIDPLDAFMEGIHEEMKA
Sbjct  61   VGEDNKNDGAGGGGGAEDDEIDPLDAFMEGIHEEMKA  97



>ref|XP_010921475.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921477.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921478.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=767

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 73/94 (78%), Gaps = 7/94 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSRS GG+DNYED DLDNI       
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRSGGGNDNYEDHDLDNI-------  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMK  328
            + D  +  +     AD EIDPLDAFMEGIHEE++
Sbjct  54   DYDQPDAPDRQPDAADGEIDPLDAFMEGIHEEIR  87



>ref|XP_010938236.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938237.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938238.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=769

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSR  GG DNYED DLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRGGGGQDNYEDHDLDNI-----DY  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++ +  D    +   D EIDPLDAFMEGIHEE++A
Sbjct  56   DQSDAPDRLPDAADGDGEIDPLDAFMEGIHEEIRA  90



>ref|XP_008808687.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808688.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808689.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
Length=771

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 76/95 (80%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINR ATY+FER++APQRLYVPPSSR  GGHDN+ED DLDNI     D 
Sbjct  1    MSKRKFGFEGFGINRPATYSFERSQAPQRLYVPPSSRGGGGHDNHEDHDLDNI-----DY  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++ +  D    +GG D EIDPLDAFMEGIHEE++A
Sbjct  56   DQPDAPDRPADAGGGDGEIDPLDAFMEGIHEEIRA  90



>ref|XP_004152219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis 
sativus]
 gb|KGN52865.1| hypothetical protein Csa_4G004270 [Cucumis sativus]
Length=777

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 3/95 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  220
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+   ++ 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
            +    N +     SG  ++EIDPLDAFMEGIHEEM
Sbjct  60   EEASGNADGGAGASGAEEEEIDPLDAFMEGIHEEM  94



>ref|XP_008454276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Cucumis melo]
Length=776

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 3/95 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  220
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+   ++ 
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
            +    N++     +G  ++EIDPLDAFMEGIHEEM
Sbjct  60   EEASGNDDGGAGAAGAEEEEIDPLDAFMEGIHEEM  94



>ref|XP_007051130.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOX95287.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=622

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
                D NN  N+G+G  DDEIDPLDAFM+GI E++
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDL  93



>ref|XP_007051129.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX95286.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=781

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
                D NN  N+G+G  DDEIDPLDAFM+GI E++
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDL  93



>ref|XP_004156816.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Cucumis sativus]
Length=774

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 76/98 (78%), Gaps = 6/98 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-----y  211
            MSKRKFGF+GFGINRQ TYNFER++APQRLYVPPSSR   GHDNYEDTD+DNI+      
Sbjct  1    MSKRKFGFEGFGINRQTTYNFERSQAPQRLYVPPSSRG-HGHDNYEDTDVDNIEYDDNDG  59

Query  212  derdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
            +E  GN+D        SG  ++EIDPLDAFMEGIHEEM
Sbjct  60   EEASGNDDGGAGAAGASGAEEEEIDPLDAFMEGIHEEM  97



>ref|XP_002515267.1| hypothetical protein RCOM_1346600 [Ricinus communis]
 gb|EEF47251.1| hypothetical protein RCOM_1346600 [Ricinus communis]
Length=791

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 71/95 (75%), Gaps = 7/95 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ TYNFE+++ PQRLYVPPS+R    HDNYEDTDLD I     D 
Sbjct  1    MSKRKFGFEGFGINRQKTYNFEQSQPPQRLYVPPSTRR--SHDNYEDTDLDEI-----DY  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             E+N N         +DEIDPLDAFMEGIHEEMKA
Sbjct  54   AEENENAKESNGAEENDEIDPLDAFMEGIHEEMKA  88



>ref|XP_007051128.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX95285.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=838

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 76/95 (80%), Gaps = 4/95 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MSKRKFGF+GFGINRQ TYNFERA+APQRLYVPPSSR   GHDNYEDTDLDNI    ++ 
Sbjct  1    MSKRKFGFEGFGINRQPTYNFERAQAPQRLYVPPSSRH--GHDNYEDTDLDNIDYADNDT  58

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
                D NN  N+G+G  DDEIDPLDAFM+GI E++
Sbjct  59   SREADKNNPNNNGNGAEDDEIDPLDAFMQGIQEDL  93



>ref|XP_010544963.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Tarenaya hassleriana]
Length=774

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 82/98 (84%), Gaps = 6/98 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFG+NRQ+TYNFER++APQRLYVPPSSR   GHD++ED D++NIDY + + 
Sbjct  1    MSKRKFGFEGFGLNRQSTYNFERSQAPQRLYVPPSSR---GHDDFEDADIENIDYADNEN  57

Query  227  nednnnd---indgsggaddEIDPLDAFMEGIHEEMKA  331
             E++ ++     + +GG DDEIDPLDAFMEGIHEEMKA
Sbjct  58   AEEDVSEGGGATEANGGEDDEIDPLDAFMEGIHEEMKA  95



>gb|KDO86973.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=618

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNI   + + 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNI---DYED  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            N+      + G+G   +EIDPLDAFMEGIHEEM+A
Sbjct  56   NDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRA  90



>ref|XP_009416320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=764

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 68/95 (72%), Gaps = 7/95 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFG+NR ATYNFER  APQRLYVPPSSR  GGHDN+ED DLDNI       
Sbjct  1    MSKRKFGFEGFGVNRPATYNFERTSAPQRLYVPPSSRG-GGHDNHEDADLDNI------D  53

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             +  +        G D EIDPLDAFMEGI EE++A
Sbjct  54   YDQPDFPERSSPAGDDGEIDPLDAFMEGIQEEIRA  88



>ref|XP_006444513.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|ESR57753.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86971.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86972.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=630

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNI   + + 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNI---DYED  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            N+      + G+G   +EIDPLDAFMEGIHEEM+A
Sbjct  56   NDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRA  90



>gb|KDO86968.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=787

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNI   + + 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNI---DYED  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            N+      + G+G   +EIDPLDAFMEGIHEEM+A
Sbjct  56   NDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRA  90



>ref|XP_006444514.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 ref|XP_006492349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Citrus 
sinensis]
 gb|ESR57754.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86969.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86970.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=789

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 74/95 (78%), Gaps = 5/95 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            M+KRKFGF+GF INRQ +Y+FE+++APQRLYVPPSSR    HDNYEDTDLDNI   + + 
Sbjct  1    MTKRKFGFEGFNINRQTSYSFEQSQAPQRLYVPPSSRY--SHDNYEDTDLDNI---DYED  55

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            N+      + G+G   +EIDPLDAFMEGIHEEM+A
Sbjct  56   NDAAKAANDTGNGAEKEEIDPLDAFMEGIHEEMRA  90



>ref|XP_003625986.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES82204.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=775

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 79/97 (81%), Gaps = 4/97 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId--yder  220
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPSSR    HDN+ED DLDNI+   D R
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSSRK--SHDNFEDNDLDNIEYDDDSR  58

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            +   +N+++   G GG +DEIDPLDAFMEGIHEEMK+
Sbjct  59   EEQSNNDDNAGGGGGGEEDEIDPLDAFMEGIHEEMKS  95



>ref|XP_011468779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Fragaria vesca subsp. vesca]
Length=745

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 7/96 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAP-QRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQ+TYNFE+++ P QRLYVPPSSR+  GHDNYEDTDLDNI     D
Sbjct  1    MSKRKFGFEGFGINRQSTYNFEQSQQPPQRLYVPPSSRA-HGHDNYEDTDLDNI-----D  54

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             ++ +      G GG ++E+DPLDAFMEGIHEE+++
Sbjct  55   YDDVDAAANKGGDGGEEEEVDPLDAFMEGIHEEVRS  90



>ref|XP_004288535.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Fragaria vesca subsp. vesca]
Length=779

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 7/96 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAP-QRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQ+TYNFE+++ P QRLYVPPSSR+  GHDNYEDTDLDNI     D
Sbjct  1    MSKRKFGFEGFGINRQSTYNFEQSQQPPQRLYVPPSSRA-HGHDNYEDTDLDNI-----D  54

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             ++ +      G GG ++E+DPLDAFMEGIHEE+++
Sbjct  55   YDDVDAAANKGGDGGEEEEVDPLDAFMEGIHEEVRS  90



>gb|KJB22485.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=776

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 6/99 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+IDY + + 
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  227  nednnndindgsgg----addEIDPLDAFMEGIHEEMKA  331
              ++ +  +  +       DDEIDPLDAFM+GI E++KA
Sbjct  59   TSNDADTNDPTTSNGNGGEDDEIDPLDAFMQGIEEDLKA  97



>gb|KJB22484.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=661

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 6/99 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+IDY + + 
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  227  nednnndindgsgg----addEIDPLDAFMEGIHEEMKA  331
              ++ +  +  +       DDEIDPLDAFM+GI E++KA
Sbjct  59   TSNDADTNDPTTSNGNGGEDDEIDPLDAFMQGIEEDLKA  97



>ref|XP_006840470.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
 gb|ERN02145.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
Length=768

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 4/93 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ TY+FER+ APQRLY PPSSR+ G HDNYED DLD+I   E D 
Sbjct  1    MSKRKFGFEGFGINRQQTYSFERSSAPQRLYTPPSSRN-GDHDNYEDHDLDDI---EYDN  56

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEM  325
            +    N+        D EIDPLDAFME IH+EM
Sbjct  57   SGSKENENEAKPDSGDGEIDPLDAFMEAIHQEM  89



>gb|KHG13094.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 5/96 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR    HDNYED DLD+IDY + + 
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRH--SHDNYEDNDLDDIDYADNND  58

Query  227  nednnndindgsg---gaddEIDPLDAFMEGIHEEM  325
              ++ +  +  S    G DDEIDPLDAFM+GI E++
Sbjct  59   TSNDADTSDPTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>ref|XP_009349922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=782

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  220
            MSKRKFGF+GFGIN+Q+T++FER++ APQRLYVPPSSR    HDN+EDTDLDNID  D  
Sbjct  1    MSKRKFGFEGFGINKQSTFDFERSQQAPQRLYVPPSSRGGNSHDNFEDTDLDNIDYDDND  60

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
              N+  N++ +   GG D+E+DPLDAFMEGIHEE+++
Sbjct  61   GSNDPGNDNSHGDGGGGDEEVDPLDAFMEGIHEEVRS  97



>ref|XP_008343158.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=778

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFER-AEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGIN+Q++++FER  +APQRLYVPPSSR    HDNYED DLDNIDYD+ D
Sbjct  1    MSKRKFGFEGFGINKQSSFDFERPQQAPQRLYVPPSSRGGNSHDNYEDADLDNIDYDDND  60

Query  224  gned--nnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            G++D  ++++ +   GG D+E+DPLDAFMEGIHEE+++
Sbjct  61   GSKDPGSDDNNHGNGGGGDEEVDPLDAFMEGIHEEVRS  98



>ref|XP_006293732.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
 gb|EOA26630.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
Length=761

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MS RKFG +GFGINRQ TY+FER++ PQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEGFGINRQTTYSFERSQVPQRLYVPPSSR---GGDNSEDADLDNIDYMENEE  57

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +         +GG DDEIDPLDAFMEGIH+EMKA
Sbjct  58   AEEDVEEGPSAAANGGEDDEIDPLDAFMEGIHQEMKA  94



>gb|EYU46816.1| hypothetical protein MIMGU_mgv1a001735mg [Erythranthe guttata]
Length=767

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 4/96 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yderd  223
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR   G D  ED DL+NID  DERD
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSR---GGDADEDADLENIDYADERD  57

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             + ++  + NDG+   +DEIDPLDAFMEG+ EEMKA
Sbjct  58   TSNEDAPNTNDGAAADEDEIDPLDAFMEGLQEEMKA  93



>ref|XP_010507898.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Camelina 
sativa]
Length=647

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 74/97 (76%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MS RKFG + FGINRQ TY+FER+EAPQRLYVPPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  227  nednnnd--indgsggaddEIDPLDAFMEGIHEEMKA  331
             E++  +      +GG DDEIDPLDAFMEGIH+EMKA
Sbjct  58   AEEDVEEGGSAAANGGDDDEIDPLDAFMEGIHQEMKA  94



>ref|XP_006397925.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
 gb|ESQ39378.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
Length=772

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 70/98 (71%), Gaps = 6/98 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI---dyde  217
            MS RK GF GFGINRQ TY+FER++APQRLYVPPSSR   G DN ED DLDNI   + +E
Sbjct  1    MSNRKSGFQGFGINRQTTYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYLENEE  57

Query  218  rdgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
             + + +        +   DDEIDPLDAFMEGIHEE+KA
Sbjct  58   AEEDVEIGGSAAAANDLEDDEIDPLDAFMEGIHEEVKA  95



>ref|NP_566099.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
 sp|O22907.2|RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis 
thaliana]
 gb|AAL15330.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AAB63833.2| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AAM70580.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AEC10828.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
Length=760

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MS RKFG +GFGINRQ +Y+FER++APQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGMEGFGINRQTSYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYMENEE  57

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +         SGG  DEIDPLDAFMEGIH+EMK+
Sbjct  58   AEEDIEEGGSAAASGGEVDEIDPLDAFMEGIHQEMKS  94



>ref|XP_007221465.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
 gb|EMJ22664.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
Length=783

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 5/99 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNI---dyd  214
            MSKRKFGF+GFGIN+Q+T+NFER++ APQRLYVPPSSR    HDNYEDTDLDNI   D D
Sbjct  1    MSKRKFGFEGFGINKQSTFNFERSQQAPQRLYVPPSSRG-QSHDNYEDTDLDNIDYDDND  59

Query  215  erdgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
                  +NNN    G GG +DEIDPLDAFME IHEE+++
Sbjct  60   GSKDPGNNNNHDEGGGGGENDEIDPLDAFMESIHEEVRS  98



>ref|XP_009370603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=778

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFER-AEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFG+N+Q++++FER  +APQRLYVPPSSR    HDNYED DLDNIDYD+ D
Sbjct  1    MSKRKFGFEGFGMNKQSSFDFERPQQAPQRLYVPPSSRGGNSHDNYEDADLDNIDYDDND  60

Query  224  gned--nnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            G++D  ++++ +   GG D+E+DPLDAFMEGIHEE+++
Sbjct  61   GSKDPGSDDNNHGNGGGGDEEVDPLDAFMEGIHEEVRS  98



>ref|XP_002882116.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58375.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 70/97 (72%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MS RKFG +GFGINRQ +Y+FER++APQRLYVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEGFGINRQTSYSFERSQAPQRLYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +         +GG DDEIDPLDAFMEGIH+EMK+
Sbjct  58   AEEDIEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKS  94



>ref|XP_008381412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=777

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 78/97 (80%), Gaps = 2/97 (2%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  220
            MSKRKFGF+GFGIN+Q+ ++FER++ APQRLYVPPSSR    HDN+EDTDLDNID  D  
Sbjct  1    MSKRKFGFEGFGINKQSXFDFERSQQAPQRLYVPPSSRGGNSHDNFEDTDLDNIDYDDND  60

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
              N+  N++ +   GG D+E+DPLDAFMEGIHEE+++
Sbjct  61   GSNDPGNDNSHGDGGGGDEEVDPLDAFMEGIHEEVRS  97



>ref|XP_008227876.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Prunus mume]
Length=787

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 7/101 (7%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNI-----d  208
            MSKRKFGF+GFGIN+Q+T+NFER++ APQRLYVPPSSR    HDNYEDTDLDNI     D
Sbjct  1    MSKRKFGFEGFGINKQSTFNFERSQQAPQRLYVPPSSRG-QSHDNYEDTDLDNIDYDDND  59

Query  209  yderdgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
                 GN +N+++   G G  +DEIDPLDAFME IHEE+++
Sbjct  60   GSRDPGNNNNHDEGGGGGGDENDEIDPLDAFMESIHEEVRS  100



>ref|XP_010518433.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Camelina sativa]
Length=657

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 73/97 (75%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MS RKFG + FGINRQ TY+FER+EAPQR YVPPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRFYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  227  nednnnd--indgsggaddEIDPLDAFMEGIHEEMKA  331
             E++  +      +GG DDEIDPLDAFMEGIH+EMKA
Sbjct  58   AEEDVEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKA  94



>ref|XP_010518432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Camelina sativa]
Length=764

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 68/97 (70%), Gaps = 5/97 (5%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNI--dyder  220
            MS RKFG + FGINRQ TY+FER+EAPQR YVPPSSR   G DN ED DLDNI    +E 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRFYVPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
               +         +GG DDEIDPLDAFMEGIH+EMKA
Sbjct  58   AEEDVEEGGSAAANGGEDDEIDPLDAFMEGIHQEMKA  94



>ref|XP_010506769.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Camelina sativa]
 ref|XP_010506771.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X3 [Camelina sativa]
Length=765

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 6/98 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MS RKFG + FGINRQ TY+FER+EAPQRLY PPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYAPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  227  nednnndindgsggadd---EIDPLDAFMEGIHEEMKA  331
             +++  +    +        EIDPLDAFMEGIH+EMKA
Sbjct  58   ADEDVEEGGGSAAANGGDDDEIDPLDAFMEGIHQEMKA  95



>ref|XP_010506768.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Camelina sativa]
Length=765

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 6/98 (6%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MS RKFG + FGINRQ TY+FER+EAPQRLY PPSSR   G DN ED DLDNIDY E + 
Sbjct  1    MSNRKFGIEKFGINRQTTYSFERSEAPQRLYAPPSSR---GGDNSEDADLDNIDYIENEE  57

Query  227  nednnndindgsggadd---EIDPLDAFMEGIHEEMKA  331
             +++  +    +        EIDPLDAFMEGIH+EMKA
Sbjct  58   ADEDVEEGGGSAAANGGDDDEIDPLDAFMEGIHQEMKA  95



>ref|XP_008781128.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Phoenix dactylifera]
Length=765

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 5/90 (6%)
 Frame = +2

Query  59   KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdgnedn  238
            KFGF+GFGINR ATY+FER++APQRLYVPPSSR  GG D+YED DLDNI     D ++ +
Sbjct  3    KFGFEGFGINRPATYSFERSQAPQRLYVPPSSRRGGGLDSYEDHDLDNI-----DYDQSD  57

Query  239  nndindgsggaddEIDPLDAFMEGIHEEMK  328
              D    +G  D EIDPLDAFMEGI EE++
Sbjct  58   ATDRRPDAGDGDGEIDPLDAFMEGIQEEIR  87



>ref|XP_010069832.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Eucalyptus 
grandis]
 gb|KCW58317.1| hypothetical protein EUGRSUZ_H01004 [Eucalyptus grandis]
Length=797

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 78/107 (73%), Gaps = 12/107 (11%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRS---VGGHDNYEDTDLDNId---  208
            MSKRKFGF+GFGINRQATYNFER++ PQRL+VP  S S     GHDNYEDTDLDNI+   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLFVPSPSSSSSRAHGHDNYEDTDLDNIEYDA  60

Query  209  ------yderdgnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
                   +E +G    + D + G GG ++EIDPLDAFMEGIHEEM+A
Sbjct  61   EAEDAAGEEENGGGAGDGDGDGGDGGGEEEIDPLDAFMEGIHEEMRA  107



>ref|XP_003521597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=782

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 10/103 (10%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TY+FER +APQRLY+PPS+R   GHD+YEDTD+DNIDYD+ + 
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERPQAPQRLYIPPSARH--GHDHYEDTDIDNIDYDDNNS  58

Query  227  nednnndindgsggadd--------EIDPLDAFMEGIHEEMKA  331
            N +NN D +D  G  ++        EIDPLDAFMEGIHEEM+A
Sbjct  59   NNNNNKDDDDDYGSNNNNGGGNDEDEIDPLDAFMEGIHEEMRA  101



>ref|XP_010679398.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQ TYNFE ++  PQRLY+PPSS S   HD+YEDTD+DN   D  +
Sbjct  1    MSKRKFGFEGFGINRQQTYNFEGSQPQPQRLYIPPSSSS-RPHDHYEDTDVDN--IDFDN  57

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEM  325
               DNNN+ N    G  +EIDPLDAFMEGIH+E+
Sbjct  58   NVNDNNNNNNISDVGNSEEIDPLDAFMEGIHKEV  91



>ref|XP_010679397.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=772

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 4/94 (4%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAE-APQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQ TYNFE ++  PQRLY+PPSS S   HD+YEDTD+DN   D  +
Sbjct  1    MSKRKFGFEGFGINRQQTYNFEGSQPQPQRLYIPPSSSS-RPHDHYEDTDVDN--IDFDN  57

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEM  325
               DNNN+ N    G  +EIDPLDAFMEGIH+E+
Sbjct  58   NVNDNNNNNNISDVGNSEEIDPLDAFMEGIHKEV  91



>ref|XP_011079539.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Sesamum indicum]
Length=654

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR  GG D+ +  +++  +  +   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSRGGGGDDDADLDNIEYAEDRDTLD  60

Query  227  ned-nnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++  NNN+ N+G+   +DEIDPLDAFMEG+ EEMK+
Sbjct  61   DDVPNNNNNNNGAAADEDEIDPLDAFMEGLQEEMKS  96



>ref|XP_011079538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Sesamum indicum]
Length=770

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQATYNFER++ PQRLYVPPSSR  GG D+ +  +++  +  +   
Sbjct  1    MSKRKFGFEGFGINRQATYNFERSQPPQRLYVPPSSRGGGGDDDADLDNIEYAEDRDTLD  60

Query  227  ned-nnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++  NNN+ N+G+   +DEIDPLDAFMEG+ EEMK+
Sbjct  61   DDVPNNNNNNNGAAADEDEIDPLDAFMEGLQEEMKS  96



>gb|KHN19202.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=784

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 80/106 (75%), Gaps = 14/106 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYV---PPSSRSVGGHDNYEDTDLDNIdyde  217
            MSKRKFGF+GFGINRQ+TY+FER +APQRLY+   PP+     GHD+YEDTD+DNIDYD+
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERPQAPQRLYIHIPPPAPH---GHDHYEDTDIDNIDYDD  57

Query  218  rdgnednnndindgsggadd--------EIDPLDAFMEGIHEEMKA  331
             + N +NN D +D  G  ++        EIDPLDAFMEGIHEEM+A
Sbjct  58   NNSNNNNNKDDDDDYGSNNNNGGGNDEDEIDPLDAFMEGIHEEMRA  103



>gb|KJB22491.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
 gb|KJB22492.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=775

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 29/108 (27%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  181
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  182  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             D D +                 ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>gb|KJB22489.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=774

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 29/108 (27%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  181
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  182  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             D D +                 ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>gb|KJB22487.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=793

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 29/108 (27%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  181
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  182  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             D D +                 ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>gb|KJB22490.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=636

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 29/108 (27%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  181
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  182  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             D D +                 ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>gb|KHG18820.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR-SVGGHDNYEDTDLDNIdyderd  223
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR S   +D+ +  D+D  D ++  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             + + N+  ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDANTNDPTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>gb|KJB22488.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=660

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 65/108 (60%), Gaps = 29/108 (27%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSR---------------SVGGHDNY  181
            MSKRKFGF+GFGINRQ+TYNFER++APQRLYVPPSSR                   +D  
Sbjct  1    MSKRKFGFEGFGINRQSTYNFERSQAPQRLYVPPSSRHSHDNYDDNDLDDIDYADNNDTS  60

Query  182  EDTDLDNIdyderdgnednnndindgsggaddEIDPLDAFMEGIHEEM  325
             D D +                 ++G+GG DDEIDPLDAFM+GI E++
Sbjct  61   NDADTNG--------------PTSNGNGGEDDEIDPLDAFMQGIEEDL  94



>ref|XP_003554554.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=768

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGF+GFGINRQ+TY+FER++ PQRLYVPPS+R   GHD+YEDTD+DNID+D+ + 
Sbjct  1    MSKRKFGFEGFGINRQSTYSFERSQPPQRLYVPPSARH--GHDHYEDTDIDNIDFDDNNN  58

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++ + N+   G+   D+    LDAFMEGIHEEM+A
Sbjct  59   DDGSKNNNGGGNDDDDEIDP-LDAFMEGIHEEMRA  92



>ref|XP_001779387.1| predicted protein [Physcomitrella patens]
 gb|EDQ55777.1| predicted protein [Physcomitrella patens]
Length=741

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 11/102 (11%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVP-PSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKR+FGF+GFGIN++  Y+FE   A  RLY+P P +R     +  ED DLDNI  ++  
Sbjct  1    MSKRRFGFEGFGINKKTNYDFEAQPAKPRLYLPSPRNRR---SEYVEDHDLDNIGSEDDG  57

Query  224  gnedn-------nndindgsggaddEIDPLDAFMEGIHEEMK  328
               +N       NN  +      DDE+DPLDAFMEGIHEE+K
Sbjct  58   RESENFRNRDENNNAGSGAVPDNDDEVDPLDAFMEGIHEEVK  99



>gb|EPS66709.1| hypothetical protein M569_08067 [Genlisea aurea]
Length=753

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 9/95 (9%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKRKFGFDG   +RQ+ YNFE +   QR Y PPSSR  GG D+ +  +++       + 
Sbjct  1    MSKRKFGFDG---DRQSNYNFEESSRSQRFYFPPSSRLGGGDDDADLDNIE------YEE  51

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++D + +      G ++EIDPLDA+M G+ EE+KA
Sbjct  52   DQDTSGEAARDCNGGEEEIDPLDAYMNGLEEEIKA  86



>ref|XP_002467976.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
 gb|EER94974.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
Length=766

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 12/95 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++   +   +G    D+EIDPLDAFM  I EE++A
Sbjct  49   SDAPASTAVEGKAEDDEEIDPLDAFMAEIQEEIRA  83



>ref|XP_008654947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Zea mays]
 tpg|DAA45029.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=766

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKR    +GF I R  +YNFER+++ QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQSVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++   +   +G    ++E+DPLDAFM  I EE++A
Sbjct  49   SDAQASTAVEGKAENEEEMDPLDAFMAEIQEEIRA  83



>ref|XP_008654950.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Zea mays]
Length=750

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 12/95 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKR    +GF I R  +YNFER+++ QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQSVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++   +   +G    ++E+DPLDAFM  I EE++A
Sbjct  49   SDAQASTAVEGKAENEEEMDPLDAFMAEIQEEIRA  83



>gb|AFW88580.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=768

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (55%), Gaps = 12/95 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++       DG    D+EIDPLDAFM  I EE++A
Sbjct  49   SDAPAGTAVDGKAEHDEEIDPLDAFMAEIQEEIRA  83



>ref|NP_001147596.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
 gb|ACG28038.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
Length=768

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (55%), Gaps = 12/95 (13%)
 Frame = +2

Query  47   MSKRKFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderdg  226
            MSKR    +GF I R  +YNFER++  QRLY P            +D DLD+I + +   
Sbjct  1    MSKRP-KLEGFSIPRPTSYNFERSQPVQRLYRP-----------TDDPDLDDIAFSDDAP  48

Query  227  nednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
            ++       DG    D+EIDPLDAFM  I EE++A
Sbjct  49   SDAPAGTAVDGKAEHDEEIDPLDAFMAEIQEEIRA  83



>gb|EEC75096.1| hypothetical protein OsI_11255 [Oryza sativa Indica Group]
Length=1023

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 54/96 (56%), Gaps = 15/96 (16%)
 Frame = +2

Query  47   MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  220
            MSKR K G  GF I R  +Y+FER++ PQRLYVP            +D DLD+I   D+ 
Sbjct  1    MSKRPKLG--GFSIPRPTSYSFERSQTPQRLYVP-----------ADDPDLDDIAFSDDA  47

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMK  328
                D       G+ G ++EIDPLDAFM  I EE++
Sbjct  48   AAPSDAPPAGGGGAAGDEEEIDPLDAFMAEIQEEIR  83



>ref|NP_001049904.1| Os03g0308500 [Oryza sativa Japonica Group]
 sp|Q10MH8.1|RH24_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Oryza sativa 
Japonica Group]
 gb|ABF95549.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11818.1| Os03g0308500 [Oryza sativa Japonica Group]
 dbj|BAG96306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=770

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 54/96 (56%), Gaps = 15/96 (16%)
 Frame = +2

Query  47   MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNId-yder  220
            MSKR K G  GF I R  +Y+FER++ PQRLYVP            +D DLD+I   D+ 
Sbjct  1    MSKRPKLG--GFSIPRPTSYSFERSQPPQRLYVP-----------ADDPDLDDIAFSDDA  47

Query  221  dgnednnndindgsggaddEIDPLDAFMEGIHEEMK  328
                D       G+ G ++EIDPLDAFM  I EE++
Sbjct  48   AAPSDAPPAGGGGAAGDEEEIDPLDAFMAEIQEEIR  83



>ref|XP_004984607.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Setaria 
italica]
Length=768

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 14/96 (15%)
 Frame = +2

Query  47   MSKR-KFGFDGFGINRQATYNFERAEAPQRLYVPPSSRSVGGHDNYEDTDLDNIdyderd  223
            MSKR K G  GF I R  TY+FER++   RLY P            +D DLD+I + +  
Sbjct  1    MSKRPKLG--GFSIPRPTTYSFERSQPVPRLYRP-----------TDDPDLDDIAFSDDA  47

Query  224  gnednnndindgsggaddEIDPLDAFMEGIHEEMKA  331
              +              +EIDPLDAFM  I EE++A
Sbjct  48   PTDAPAAAAVASKAQDAEEIDPLDAFMAEIQEEIRA  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564723838400