BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033N18

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275389.1|  ubiquitin-conjugating enzyme E2 27-like            157   1e-44   Solanum tuberosum [potatoes]
ref|NP_001233964.1|  ubiquitin conjugating enzyme                       157   1e-44   Solanum lycopersicum
gb|ABB87105.1|  ubiquitin conjugating enzyme-like                       156   3e-44   Solanum tuberosum [potatoes]
emb|CDO98671.1|  unnamed protein product                                154   2e-43   Coffea canephora [robusta coffee]
ref|XP_011073121.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    153   4e-43   Sesamum indicum [beniseed]
ref|XP_009615553.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      152   8e-43   Nicotiana tomentosiformis
gb|EYU32921.1|  hypothetical protein MIMGU_mgv1a014267mg                152   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_002284366.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      150   6e-42   Vitis vinifera
ref|XP_008464378.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      149   1e-41   Cucumis melo [Oriental melon]
ref|XP_002322290.2|  ubiquitin-conjugating enzyme family protein        149   2e-41   
ref|XP_011002115.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    149   3e-41   Populus euphratica
ref|XP_011083414.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    149   3e-41   Sesamum indicum [beniseed]
ref|XP_002511117.1|  ubiquitin-conjugating enzyme E2-25kD, putative     149   3e-41   Ricinus communis
gb|ABK92892.1|  unknown                                                 149   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010037360.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      148   4e-41   Eucalyptus grandis [rose gum]
gb|KDP22561.1|  hypothetical protein JCGZ_26392                         147   7e-41   Jatropha curcas
ref|XP_004138029.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    147   9e-41   Cucumis sativus [cucumbers]
ref|XP_002318760.1|  ubiquitin-conjugating enzyme family protein        147   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_011042936.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      147   1e-40   Populus euphratica
ref|XP_009594947.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    142   7e-40   Nicotiana tomentosiformis
ref|XP_006436915.1|  hypothetical protein CICLE_v10032815mg             144   2e-39   Citrus clementina [clementine]
ref|XP_010555576.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      143   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_010678313.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      143   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209522.1|  hypothetical protein PRUPE_ppa010579mg             144   4e-39   
ref|XP_010442437.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      143   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007038089.1|  Ubiquitin-conjugating enzyme 27                    142   7e-39   Theobroma cacao [chocolate]
ref|XP_008239533.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      142   7e-39   Prunus mume [ume]
ref|XP_006402053.1|  hypothetical protein EUTSA_v10014747mg             142   9e-39   Eutrema salsugineum [saltwater cress]
ref|XP_006282380.1|  hypothetical protein CARUB_v10028678mg             142   1e-38   Capsella rubella
ref|NP_199900.1|  ubiquitin-conjugating enzyme E2 27                    141   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190508.1|  ubiquitin-conjugating enzyme E2 27                 141   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50908.1|  hypothetical protein B456_008G209500                    140   4e-38   Gossypium raimondii
ref|XP_002865827.1|  ubiquitin-conjugating enzyme 26                    140   6e-38   Arabidopsis lyrata subsp. lyrata
emb|CDY45812.1|  BnaC03g16350D                                          140   6e-38   Brassica napus [oilseed rape]
ref|XP_009132686.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      140   7e-38   Brassica rapa
gb|KHN23957.1|  Ubiquitin-conjugating enzyme E2 27                      139   2e-37   Glycine soja [wild soybean]
gb|KHN31276.1|  Ubiquitin-conjugating enzyme E2 27                      138   3e-37   Glycine soja [wild soybean]
ref|XP_010093942.1|  Ubiquitin-conjugating enzyme E2 27                 138   4e-37   Morus notabilis
ref|XP_004501731.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    137   4e-37   Cicer arietinum [garbanzo]
ref|XP_004297507.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      137   1e-36   Fragaria vesca subsp. vesca
ref|XP_011073120.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    137   2e-36   Sesamum indicum [beniseed]
ref|XP_008392720.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      135   3e-36   
ref|XP_007137877.1|  hypothetical protein PHAVU_009G163400g             135   3e-36   Phaseolus vulgaris [French bean]
ref|XP_010250584.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      136   4e-36   Nelumbo nucifera [Indian lotus]
gb|KFK26715.1|  hypothetical protein AALP_AA8G283800                    135   6e-36   Arabis alpina [alpine rockcress]
ref|XP_008364577.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    134   1e-35   Malus domestica [apple tree]
gb|AFK44991.1|  unknown                                                 134   1e-35   Lotus japonicus
gb|KJB50909.1|  hypothetical protein B456_008G209500                    133   2e-35   Gossypium raimondii
ref|XP_009337530.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      132   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_003602765.1|  Ubiquitin carrier protein                          133   5e-35   
ref|XP_003602764.1|  Ubiquitin carrier protein                          131   1e-34   
ref|XP_006645263.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    127   6e-33   Oryza brachyantha
ref|XP_010908214.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    126   1e-32   Elaeis guineensis
gb|AGY80454.1|  ubiquitin-conjugating enzyme                            126   2e-32   Dendrocalamus latiflorus [sweet bamboo]
ref|NP_001045259.1|  Os01g0925800                                       125   2e-32   
ref|XP_009385499.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    125   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003564977.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      124   5e-32   Brachypodium distachyon [annual false brome]
emb|CDM85817.1|  unnamed protein product                                124   8e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006844560.1|  hypothetical protein AMTR_s00016p00186510          124   1e-31   Amborella trichopoda
gb|EMT06415.1|  Ubiquitin carrier protein E2 27                         124   1e-31   
ref|XP_008801125.1|  PREDICTED: ubiquitin-conjugating enzyme E2 27      124   1e-31   Phoenix dactylifera
ref|XP_004971132.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    123   3e-31   Setaria italica
gb|KHG10228.1|  Ubiquitin-conjugating enzyme E2 27 -like protein        123   3e-31   Gossypium arboreum [tree cotton]
ref|XP_002459014.1|  hypothetical protein SORBIDRAFT_03g044480          122   4e-31   Sorghum bicolor [broomcorn]
gb|AFW84086.1|  hypothetical protein ZEAMMB73_619651                    121   4e-31   
ref|NP_001150323.1|  ubiquitin-conjugating enzyme E2-22 kDa             122   6e-31   Zea mays [maize]
gb|EWM21093.1|  ubiquitin-conjugating enzyme e2 27                      117   7e-30   Nannochloropsis gaditana
emb|CCA27209.1|  ubiquitinconjugating enzyme E2 putative                118   2e-29   Albugo laibachii Nc14
emb|CBJ30375.1|  ubiquitin-conjugating enzyme 1                         120   4e-29   Ectocarpus siliculosus
gb|ABK21242.1|  unknown                                                 117   4e-29   Picea sitchensis
emb|CCI11036.1|  unnamed protein product                                116   7e-29   Albugo candida
ref|XP_008360795.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    112   1e-28   
ref|XP_010908213.1|  PREDICTED: ubiquitin-conjugating enzyme E2 2...    115   2e-28   Elaeis guineensis
ref|XP_002971734.1|  ubiquitin-conjugating enzyme 27, E2                114   4e-28   
ref|XP_002991561.1|  ubiquitin-conjugating enzyme 27, E2                114   4e-28   Selaginella moellendorffii
gb|KJB40047.1|  hypothetical protein B456_007G044100                    110   9e-27   Gossypium raimondii
ref|XP_005853570.1|  hypothetical protein NGA_0500800                   106   2e-26   Nannochloropsis gaditana CCMP526
ref|XP_001755212.1|  predicted protein                                  109   5e-26   
gb|EMS62075.1|  Ubiquitin-conjugating enzyme E2 27                      107   2e-25   Triticum urartu
emb|CEF98001.1|  Ubiquitin-conjugating enzyme, active site              105   1e-24   Ostreococcus tauri
ref|XP_001417769.1|  predicted protein                                  105   1e-24   Ostreococcus lucimarinus CCE9901
ref|XP_009032291.1|  hypothetical protein AURANDRAFT_69594              105   2e-24   Aureococcus anophagefferens
ref|XP_008862080.1|  hypothetical protein H310_00902                    105   2e-24   Aphanomyces invadans
ref|XP_001689734.1|  ubiquitin conjugating enzyme                       104   2e-24   Chlamydomonas reinhardtii
ref|XP_008862082.1|  hypothetical protein H310_00904                    104   2e-24   Aphanomyces invadans
ref|XP_009842907.1|  hypothetical protein H257_16240                    103   6e-24   Aphanomyces astaci
ref|XP_007514447.1|  predicted protein                                  103   8e-24   Bathycoccus prasinos
ref|XP_005651685.1|  hypothetical protein COCSUDRAFT_52084              102   1e-23   Coccomyxa subellipsoidea C-169
ref|XP_009519397.1|  hypothetical protein PHYSODRAFT_261502             102   1e-23   Phytophthora sojae
ref|XP_009533884.1|  hypothetical protein PHYSODRAFT_518528             102   2e-23   Phytophthora sojae
ref|XP_009533974.1|  hypothetical protein PHYSODRAFT_518543             102   2e-23   Phytophthora sojae
ref|XP_008900048.1|  hypothetical protein, variant                      101   4e-23   Phytophthora parasitica INRA-310
ref|XP_008900047.1|  hypothetical protein PPTG_07524                    101   6e-23   Phytophthora parasitica INRA-310
gb|ETI54309.1|  hypothetical protein F443_02851                         101   7e-23   Phytophthora parasitica P1569
gb|EAR87660.4|  ubiquitin-conjugating enzyme                            100   1e-22   Tetrahymena thermophila SB210
gb|ETO83061.1|  hypothetical protein, variant                           100   1e-22   Phytophthora parasitica P1976
ref|XP_002906044.1|  ubiquitin-conjugating enzyme E2, putative          100   1e-22   Phytophthora infestans T30-4
gb|KIJ45921.1|  hypothetical protein M422DRAFT_29567                    100   1e-22   Sphaerobolus stellatus SS14
gb|ETO83060.1|  hypothetical protein F444_02862                         100   2e-22   Phytophthora parasitica P1976
gb|EWC47763.1|  hypothetical protein DRE_02963                          100   2e-22   Drechslerella stenobrocha 248
gb|ETP52116.1|  hypothetical protein, variant                         99.4    3e-22   Phytophthora parasitica P10297
gb|ETP52115.1|  hypothetical protein F442_02826                       99.0    5e-22   Phytophthora parasitica P10297
gb|KDO32440.1|  hypothetical protein SPRG_02917                       98.2    6e-22   Saprolegnia parasitica CBS 223.65
emb|CCE31918.1|  probable ubiquitin--protein ligase                   99.0    8e-22   Claviceps purpurea 20.1
ref|XP_002502493.1|  predicted protein                                97.8    9e-22   Micromonas commoda
ref|XP_003056945.1|  predicted protein                                97.8    9e-22   Micromonas pusilla CCMP1545
ref|XP_007413145.1|  hypothetical protein MELLADRAFT_37906            98.2    1e-21   Melampsora larici-populina 98AG31
gb|KIY62972.1|  hypothetical protein CYLTODRAFT_494274                97.8    1e-21   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_459396.1|  DEHA2E01562p                                        97.1    3e-21   Debaryomyces hansenii CBS767
gb|EDK39920.2|  hypothetical protein PGUG_04018                       97.1    3e-21   Meyerozyma guilliermondii ATCC 6260
ref|XP_008604446.1|  ubiquitin-conjugating enzyme (huntingtin int...  96.3    3e-21   Saprolegnia diclina VS20
ref|XP_002952512.1|  hypothetical protein VOLCADRAFT_62621            96.7    4e-21   Volvox carteri f. nagariensis
dbj|GAA92909.1|  ubiquitin conjugating enzyme                         97.1    4e-21   Aspergillus kawachii IFO 4308
ref|XP_011116574.1|  hypothetical protein H072_11229                  96.7    5e-21   
ref|XP_003710343.1|  hypothetical protein MGG_05478                   96.7    6e-21   Magnaporthe oryzae 70-15
dbj|GAK62134.1|  ubiquitin-conjugating enzyme e2-24 kda               96.3    6e-21   Moesziomyces antarcticus
dbj|GAC73762.1|  ubiquitin-protein ligase                             96.3    6e-21   Moesziomyces antarcticus T-34
gb|EST06461.1|  ubiquitin-protein ligase                              96.3    7e-21   Kalmanozyma brasiliensis GHG001
ref|XP_007768847.1|  hypothetical protein CONPUDRAFT_165646           95.9    8e-21   Coniophora puteana RWD-64-598 SS2
ref|XP_011386364.1|  putative E2 ubiquitin-conjugating protein UBC1   95.9    8e-21   Ustilago maydis 521
ref|XP_004032164.1|  ubiquitin-conjugating enzyme family protein,...  95.1    9e-21   Ichthyophthirius multifiliis
gb|EJW79559.1|  ubiquitin carrier protein                             95.1    1e-20   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_003146009.1|  hypothetical protein LOAG_10437                  95.1    1e-20   
ref|XP_001900771.1|  Ubiquitin-conjugating enzyme E2-25 kDa           95.5    1e-20   Brugia malayi [agent of lymphatic filariasis]
emb|CBQ67936.1|  probable UBC1-E2 ubiquitin-conjugating enzyme        95.5    1e-20   Sporisorium reilianum SRZ2
gb|KFG87301.1|  ubiquitin-conjugating enzyme E2-24 kDa                95.5    1e-20   Metarhizium anisopliae
ref|XP_007808316.1|  ubiquitin conjugating enzyme (UbcA), putative    95.5    1e-20   Metarhizium acridum CQMa 102
ref|XP_007821019.1|  Ubiquitin-conjugating enzyme, E2                 95.5    1e-20   Metarhizium robertsii ARSEF 23
ref|XP_002615191.1|  hypothetical protein CLUG_05206                  95.1    1e-20   Clavispora lusitaniae ATCC 42720
gb|EHA22307.1|  hypothetical protein ASPNIDRAFT_57253                 95.5    2e-20   Aspergillus niger ATCC 1015
ref|XP_001398255.1|  ubiquitin conjugating enzyme (UbcA)              95.5    2e-20   Aspergillus niger CBS 513.88
emb|CEJ94406.1|  Putative Ubiquitin-conjugating enzyme                95.1    2e-20   Torrubiella hemipterigena
gb|ACO12956.1|  Ubiquitin-conjugating enzyme E2 K                     94.4    2e-20   Lepeophtheirus salmonis
ref|XP_001823145.1|  ubiquitin conjugating enzyme (UbcA)              95.5    2e-20   Aspergillus oryzae RIB40
emb|CCF54274.1|  probable UBC1-E2 ubiquitin-conjugating enzyme        94.7    2e-20   Ustilago hordei
gb|KFH62915.1|  ubiquitin-conjugating enzyme (huntingtin interact...  94.7    3e-20   Mortierella verticillata NRRL 6337
emb|CDP99145.1|  Protein BM-UBC-20, isoform b                         95.1    3e-20   
gb|EPS34742.1|  hypothetical protein PDE_09706                        94.4    3e-20   Penicillium oxalicum 114-2
ref|XP_004204757.1|  Piso0_000027                                     94.4    3e-20   
gb|KIM36530.1|  hypothetical protein M413DRAFT_288264                 94.0    4e-20   Hebeloma cylindrosporum h7
ref|XP_001483289.1|  hypothetical protein PGUG_04018                  94.0    5e-20   Meyerozyma guilliermondii ATCC 6260
gb|KIR48771.1|  ubiquitin-conjugating enzyme (huntingtin interact...  94.0    5e-20   Cryptococcus gattii CA1280
gb|KIR56151.1|  ubiquitin-conjugating enzyme (huntingtin interact...  93.6    5e-20   Cryptococcus gattii Ru294
gb|EGU87777.1|  hypothetical protein FOXB_01702                       94.0    5e-20   Fusarium oxysporum Fo5176
ref|XP_008717136.1|  hypothetical protein HMPREF1541_04569            94.0    5e-20   Cyphellophora europaea CBS 101466
ref|XP_002548462.1|  ubiquitin-conjugating enzyme E2-24 kDa           93.6    5e-20   Candida tropicalis MYA-3404
ref|XP_006684159.1|  hypothetical protein CANTEDRAFT_112466           93.6    5e-20   Yamadazyma tenuis ATCC 10573
emb|CDM35914.1|  Ubiquitin-conjugating enzyme E2 1                    94.0    5e-20   Penicillium roqueforti FM164
ref|XP_005784046.1|  hypothetical protein EMIHUDRAFT_429671           93.2    5e-20   Emiliania huxleyi CCMP1516
emb|CCG82392.1|  Ubiquitin-conjugating enzyme E2 1                    93.6    5e-20   Taphrina deformans PYCC 5710
gb|EMT66236.1|  Ubiquitin-conjugating enzyme E2 1                     93.6    6e-20   Fusarium oxysporum f. sp. cubense race 4
gb|EXK87438.1|  ubiquitin-conjugating enzyme (huntingtin interact...  93.6    6e-20   Fusarium oxysporum f. sp. raphani 54005
gb|KIN98175.1|  hypothetical protein M404DRAFT_1005540                92.0    7e-20   Pisolithus tinctorius Marx 270
gb|KIM52727.1|  hypothetical protein SCLCIDRAFT_487418                93.2    7e-20   Scleroderma citrinum Foug A
ref|XP_002565396.1|  Pc22g14750                                       93.6    7e-20   Penicillium rubens Wisconsin 54-1255
gb|EJT45143.1|  ubiquitin-conjugating enzyme e2-24 kda                93.2    7e-20   Trichosporon asahii var. asahii CBS 2479
gb|EJY66901.1|  Ubiquitin-conjugating enzyme, putative                92.8    7e-20   Oxytricha trifallax
gb|KIJ98078.1|  hypothetical protein K443DRAFT_221603                 93.2    7e-20   Laccaria amethystina LaAM-08-1
gb|EJU02948.1|  hypothetical protein DACRYDRAFT_94114                 93.2    7e-20   Dacryopinax primogenitus
ref|XP_001887589.1|  predicted protein                                93.2    8e-20   Laccaria bicolor S238N-H82
dbj|GAC93359.1|  hypothetical protein PHSY_000924                     93.6    8e-20   Pseudozyma hubeiensis SY62
gb|KJA16294.1|  hypothetical protein HYPSUDRAFT_147916                93.2    9e-20   Hypholoma sublateritium FD-334 SS-4
ref|XP_002125172.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  92.4    9e-20   
emb|CDI51448.1|  probable UBC1-E2 ubiquitin-conjugating enzyme        93.2    9e-20   Melanopsichium pennsylvanicum 4
ref|XP_007851632.1|  ubiquitin-conjugating enzyme e2-24 kda           92.8    1e-19   
emb|CCE39620.1|  hypothetical protein CPAR2_600330                    92.8    1e-19   Candida parapsilosis
gb|KHG15935.1|  Ubiquitin-conjugating enzyme E2 27 -like protein      91.7    1e-19   Gossypium arboreum [tree cotton]
gb|KHN97238.1|  Ubiquitin-conjugating enzyme/RWD-like protein         92.8    1e-19   Metarhizium album ARSEF 1941
gb|KDQ26171.1|  hypothetical protein PLEOSDRAFT_52152                 92.4    1e-19   Pleurotus ostreatus PC15
ref|XP_002767170.1|  ubiquitin-conjugating enzyme E2-25 kDa, puta...  90.5    1e-19   Perkinsus marinus ATCC 50983
ref|XP_007377517.1|  hypothetical protein SPAPADRAFT_63387            92.4    1e-19   Spathaspora passalidarum NRRL Y-27907
gb|ESX01368.1|  Ubiquitin-conjugating enzyme that mediates select...  92.4    1e-19   Ogataea parapolymorpha DL-1
gb|EIF46667.1|  ubiquitin-conjugating enzyme that mediates select...  92.8    1e-19   Brettanomyces bruxellensis AWRI1499
gb|KDB11497.1|  putative ubiquitin conjugating enzyme (UbcA)          92.4    2e-19   Ustilaginoidea virens
gb|EMG50146.1|  Ubiquitin carrier protein                             92.4    2e-19   Candida maltosa Xu316
gb|KDR77462.1|  hypothetical protein GALMADRAFT_95199                 92.4    2e-19   Galerina marginata CBS 339.88
ref|XP_003661904.1|  hypothetical protein MYCTH_2301813               92.4    2e-19   Thermothelomyces thermophila ATCC 42464
ref|XP_003871480.1|  Ubc1 protein                                     92.4    2e-19   Candida orthopsilosis Co 90-125
ref|XP_569863.1|  ubiquitin-conjugating enzyme e2-24 kda              92.4    2e-19   Cryptococcus neoformans var. neoformans JEC21
ref|XP_001383781.2|  hypothetical protein PICST_71285                 92.0    2e-19   Scheffersomyces stipitis CBS 6054
ref|XP_009546801.1|  hypothetical protein HETIRDRAFT_434426           92.0    2e-19   Heterobasidion irregulare TC 32-1
ref|XP_007867121.1|  hypothetical protein GLOTRDRAFT_139354           92.0    2e-19   Gloeophyllum trabeum ATCC 11539
gb|AFR93785.1|  ubiquitin-conjugating enzyme (huntingtin interact...  92.0    2e-19   Cryptococcus neoformans var. grubii H99
ref|XP_004204199.1|  Piso0_000027                                     92.0    2e-19   
gb|KDQ51574.1|  hypothetical protein JAAARDRAFT_41035                 92.0    2e-19   Jaapia argillacea MUCL 33604
gb|KDB33821.1|  hypothetical protein H112_04211                       89.0    2e-19   Trichophyton rubrum D6
ref|XP_005827196.1|  hypothetical protein GUITHDRAFT_154189           91.7    2e-19   Guillardia theta CCMP2712
emb|CEL56875.1|  ubiquitin-conjugating enzyme (huntingtin interac...  92.0    2e-19   Rhizoctonia solani AG-1 IB
ref|XP_001274030.1|  ubiquitin conjugating enzyme (UbcA), putative    92.8    2e-19   Aspergillus clavatus NRRL 1
ref|XP_003332230.1|  ubiquitin-conjugating enzyme                     92.8    2e-19   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_004344504.1|  ubiquitin-conjugating enzyme                     92.0    2e-19   Capsaspora owczarzaki ATCC 30864
ref|XP_007379770.1|  hypothetical protein PUNSTDRAFT_81407            92.0    2e-19   Punctularia strigosozonata HHB-11173 SS5
gb|EEQ46595.1|  hypothetical protein CAWG_04951                       92.0    2e-19   Candida albicans WO-1
ref|XP_002421181.1|  ubiquitin carrier protein, putative; ubiquit...  92.0    2e-19   Candida dubliniensis CD36
ref|XP_712073.1|  likely ubiquitin-conjugating enzyme Ubc1p           92.0    2e-19   
ref|XP_712098.1|  likely ubiquitin-conjugating enzyme Ubc1p           92.0    2e-19   Candida albicans SC5314
ref|XP_002840834.1|  hypothetical protein                             92.4    2e-19   Tuber melanosporum Mel28
ref|XP_006681813.1|  hypothetical protein BATDEDRAFT_91378            91.7    2e-19   Batrachochytrium dendrobatidis JAM81
gb|EXK43901.1|  ubiquitin-conjugating enzyme (huntingtin interact...  92.0    3e-19   Fusarium oxysporum f. sp. melonis 26406
ref|XP_753930.1|  ubiquitin conjugating enzyme (UbcA)                 92.4    3e-19   Aspergillus fumigatus Af293
gb|EKV12164.1|  Cyclin Ccl1, putative                                 95.1    3e-19   Penicillium digitatum Pd1
gb|KGO78022.1|  Ubiquitin-conjugating enzyme, E2                      95.1    3e-19   Penicillium italicum
gb|AGN29610.1|  ubiquitin-conjugating enzyme E2- 22kDa-like protein   91.3    3e-19   Acartia pacifica
ref|XP_001259977.1|  ubiquitin conjugating enzyme (UbcA), putative    92.0    3e-19   Aspergillus fischeri NRRL 181
ref|XP_003033703.1|  hypothetical protein SCHCODRAFT_256390           91.3    3e-19   Schizophyllum commune H4-8
gb|KIK93632.1|  hypothetical protein PAXRUDRAFT_502682                91.3    3e-19   Paxillus rubicundulus Ve08.2h10
gb|ERG81184.1|  putative ubiquitin-conjugating enzyme e2 21           90.9    3e-19   
ref|XP_659816.1|  hypothetical protein AN2212.2                       91.7    4e-19   Aspergillus nidulans FGSC A4
ref|XP_007881930.1|  hypothetical protein PFL1_06200                  91.3    4e-19   Anthracocystis flocculosa PF-1
gb|KGO45663.1|  Ubiquitin-conjugating enzyme, C-terminal fungi        94.7    4e-19   Penicillium expansum
gb|EKG10354.1|  Ubiquitin-conjugating enzyme E2                       91.7    4e-19   Macrophomina phaseolina MS6
gb|KIJ14982.1|  hypothetical protein PAXINDRAFT_115361                91.3    4e-19   Paxillus involutus ATCC 200175
ref|XP_009222625.1|  hypothetical protein GGTG_06542                  91.3    5e-19   Gaeumannomyces tritici R3-111a-1
gb|KIJ61091.1|  hypothetical protein HYDPIDRAFT_159944                90.9    5e-19   Hydnomerulius pinastri MD-312
emb|CDJ85762.1|  Ubiquitin-conjugating enzyme and Ubiquitin-assoc...  90.5    5e-19   Haemonchus contortus [red stomach worm]
emb|CDJ83787.1|  Ubiquitin-conjugating enzyme and Ubiquitin-assoc...  90.5    5e-19   Haemonchus contortus [red stomach worm]
ref|XP_002785618.1|  ubiquitin-conjugating enzyme E2-25 kDa, puta...  90.5    5e-19   Perkinsus marinus ATCC 50983
emb|CCX32307.1|  Similar to Ubiquitin-conjugating enzyme E2 1; ac...  90.9    5e-19   Pyronema omphalodes CBS 100304
ref|XP_004990689.1|  ubiquitin-conjugating enzyme E2-25kD             90.1    5e-19   Salpingoeca rosetta
ref|XP_007797254.1|  putative ubiquitin-conjugating enzyme protein    91.3    5e-19   
gb|KIL61916.1|  hypothetical protein M378DRAFT_814229                 90.9    6e-19   Amanita muscaria Koide BX008
gb|KIO15436.1|  hypothetical protein M407DRAFT_98351                  90.5    6e-19   Tulasnella calospora MUT 4182
gb|KII90998.1|  hypothetical protein PLICRDRAFT_697404                90.9    6e-19   Plicaturopsis crispa FD-325 SS-3
ref|XP_007837763.1|  hypothetical protein PFICI_10991                 90.9    7e-19   Pestalotiopsis fici W106-1
ref|XP_001242202.1|  hypothetical protein CIMG_06098                  90.9    7e-19   Coccidioides immitis RS
ref|XP_007319170.1|  hypothetical protein SERLADRAFT_469290           90.5    7e-19   Serpula lacrymans var. lacrymans S7.9
gb|KIH61984.1|  ubiquitin--protein ligase                             90.1    7e-19   Ancylostoma duodenale
gb|EYC42200.1|  hypothetical protein Y032_0540g3169                   90.1    7e-19   Ancylostoma ceylanicum
ref|XP_007002050.1|  hypothetical protein TREMEDRAFT_70845            90.5    7e-19   Tremella mesenterica DSM 1558
ref|XP_001217927.1|  hypothetical protein ATEG_09305                  90.9    8e-19   Aspergillus terreus NIH2624
ref|XP_002844999.1|  ubiquitin-protein ligase UBC1                    90.9    8e-19   Microsporum canis CBS 113480
ref|XP_011122559.1|  hypothetical protein AOL_s00079g382              90.5    8e-19   Arthrobotrys oligospora ATCC 24927
ref|XP_003844689.1|  similar to ubiquitin conjugating enzyme          90.5    9e-19   Leptosphaeria maculans JN3
ref|XP_001799373.1|  hypothetical protein SNOG_09070                  90.5    9e-19   Parastagonospora nodorum SN15
gb|KDN46991.1|  putative UBC1-E2 ubiquitin-conjugating enzyme         90.5    9e-19   Tilletiaria anomala UBC 951
ref|XP_001225086.1|  hypothetical protein CHGG_07430                  90.5    1e-18   Chaetomium globosum CBS 148.51
ref|XP_009166937.1|  hypothetical protein T265_04038                  89.7    1e-18   Opisthorchis viverrini [Southeast Asian liver fluke]
dbj|GAA48666.1|  ubiquitin-conjugating enzyme (huntingtin interac...  89.7    1e-18   Clonorchis sinensis [oriental liver fluke]
gb|KIY52476.1|  hypothetical protein FISHEDRAFT_63819                 90.1    1e-18   Fistulina hepatica ATCC 64428
gb|KIN97703.1|  hypothetical protein M404DRAFT_1005878                90.1    1e-18   Pisolithus tinctorius Marx 270
ref|XP_007369389.1|  hypothetical protein DICSQDRAFT_149491           90.1    1e-18   Dichomitus squalens LYAD-421 SS1
gb|EZF28705.1|  hypothetical protein H101_07617                       89.4    1e-18   Trichophyton interdigitale H6
ref|XP_007735747.1|  ubiquitin-conjugating enzyme (huntingtin int...  90.1    1e-18   Capronia epimyces CBS 606.96
gb|KIK24253.1|  hypothetical protein PISMIDRAFT_98853                 89.7    1e-18   Pisolithus microcarpus 441
ref|XP_001631613.1|  predicted protein                                89.4    1e-18   Nematostella vectensis
gb|KIK69992.1|  hypothetical protein GYMLUDRAFT_34400                 89.7    1e-18   Gymnopus luxurians FD-317 M1
gb|EMS22894.1|  ubiquitin-conjugating enzyme (huntingtin interact...  89.7    1e-18   Rhodotorula toruloides NP11
ref|XP_003100903.1|  CRE-UBC-20 protein                               89.0    2e-18   Caenorhabditis remanei
gb|ETN72541.1|  ubiquitin--protein ligase                             90.1    2e-18   Necator americanus
ref|XP_003193038.1|  ubiquitin-conjugating enzyme e2-24 kDa           89.4    2e-18   Cryptococcus gattii WM276
gb|EHJ79025.1|  ubiquitin conjugating enzyme 4                        89.0    2e-18   
ref|XP_003649457.1|  hypothetical protein THITE_2074062               89.4    2e-18   Thielavia terrestris NRRL 8126
ref|XP_001524154.1|  hypothetical protein LELG_04967                  89.4    2e-18   Lodderomyces elongisporus NRRL YB-4239
ref|XP_003173464.1|  ubiquitin-conjugating enzyme E2 1                89.4    2e-18   Nannizzia gypsea CBS 118893
ref|XP_003396259.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  88.6    2e-18   Bombus terrestris [large earth bumblebee]
emb|CCT72233.1|  probable ubiquitin--protein ligase                   89.4    2e-18   Fusarium fujikuroi IMI 58289
gb|EUC63156.1|  UBC1-E2 ubiquitin-conjugating enzyme, putative        89.0    2e-18   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_005851370.1|  hypothetical protein CHLNCDRAFT_19318            88.6    3e-18   Chlorella variabilis
ref|XP_006697166.1|  putative ubiquitin carrier protein               89.4    3e-18   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KIX96664.1|  hypothetical protein Z520_07383                       89.4    3e-18   Fonsecaea multimorphosa CBS 102226
gb|EPS95550.1|  hypothetical protein FOMPIDRAFT_1025740               89.0    3e-18   Fomitopsis pinicola FP-58527 SS1
gb|AAY52456.1|  ubiquitin conjugating enzyme E2                       88.6    3e-18   Caenorhabditis remanei
ref|XP_003348081.1|  hypothetical protein SMAC_03927                  89.0    3e-18   Sordaria macrospora k-hell
ref|XP_002184246.1|  ubiquitin-conjugating enzyme 1                   88.6    3e-18   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003017133.1|  ubiquitin conjugating enzyme (UbcJ), putative    89.0    3e-18   Trichophyton benhamiae CBS 112371
emb|CCA76039.1|  probable UBC1-E2 ubiquitin-conjugating enzyme        89.0    3e-18   Serendipita indica DSM 11827
gb|KIW76216.1|  hypothetical protein Z517_10962                       89.0    3e-18   Fonsecaea pedrosoi CBS 271.37
emb|CDP25450.1|  Putative ubiquitin-conjugating enzyme                89.0    3e-18   Podospora anserina S mat+
ref|XP_002544744.1|  conserved hypothetical protein                   89.0    3e-18   Uncinocarpus reesii 1704
gb|EFX00199.1|  ubiquitin conjugating enzyme                          89.0    3e-18   Grosmannia clavigera kw1407
emb|CAX69541.1|  huntingtin interacting protein 2                     88.2    4e-18   Schistosoma japonicum
emb|CDW82190.1|  ubiquitin-conjugating enzyme e2 27-like              88.6    4e-18   Stylonychia lemnae
gb|AAW25929.1|  SJCHGC02302 protein                                   88.2    4e-18   Schistosoma japonicum
ref|XP_007749501.1|  ubiquitin-conjugating enzyme (huntingtin int...  88.6    4e-18   Cladophialophora psammophila CBS 110553
gb|ELU15540.1|  hypothetical protein CAPTEDRAFT_150271                87.8    5e-18   Capitella teleta
gb|KIW51848.1|  hypothetical protein PV05_10533                       88.6    5e-18   Exophiala xenobiotica
ref|XP_006457662.1|  hypothetical protein AGABI2DRAFT_189108          88.2    5e-18   Agaricus bisporus var. bisporus H97
emb|CDR38023.1|  CYFA0S01e20296g1_1                                   87.8    5e-18   Cyberlindnera fabianii
ref|XP_007582818.1|  putative ubiquitin conjugating enzyme protein    88.6    5e-18   
ref|XP_007296650.1|  ubiquitin-conjugating enzyme E2-24 kDa           88.2    6e-18   
ref|XP_001911225.1|  hypothetical protein                             89.0    7e-18   
gb|EPQ65006.1|  Ubiquitin-conjugating enzyme                          88.2    7e-18   
gb|KIV76960.1|  hypothetical protein PV11_08804                       88.2    7e-18   
ref|XP_007271211.1|  hypothetical protein FOMMEDRAFT_23645            87.8    7e-18   
gb|KIX09450.1|  hypothetical protein Z518_00530                       88.2    7e-18   
emb|CCU75395.1|  ubiquitin conjugating enzyme                         88.2    7e-18   
ref|XP_009159606.1|  ubiquitin-conjugating enzyme                     88.2    7e-18   
emb|CDO72271.1|  hypothetical protein BN946_scf184970.g123            87.8    8e-18   
ref|XP_009847311.1|  hypothetical protein NEUTE1DRAFT_57702           87.8    8e-18   
ref|XP_010758545.1|  hypothetical protein PADG_02637                  88.2    8e-18   
ref|XP_002640838.1|  C. briggsae CBR-UBC-20 protein                   87.4    8e-18   
ref|XP_961591.1|  ubiquitin conjugating enzyme                        87.8    9e-18   
ref|XP_006672340.1|  ubiquitin-conjugating enzyme E2-24 kDa           87.8    9e-18   
emb|CCL99533.1|  predicted protein                                    87.4    9e-18   
ref|NP_001155723.1|  ubiquitin-conjugating enzyme E2-25kD-like        87.0    9e-18   
ref|XP_007722867.1|  ubiquitin-conjugating enzyme (huntingtin int...  87.8    9e-18   
ref|XP_008044887.1|  hypothetical protein TRAVEDRAFT_175464           87.4    9e-18   
gb|KIW27581.1|  hypothetical protein PV07_07310                       87.4    1e-17   
ref|XP_002168321.2|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  87.0    1e-17   
ref|XP_001007905.3|  Ubiquitin-conjugating enzyme family protein      86.7    1e-17   
ref|XP_008023223.1|  hypothetical protein SETTUDRAFT_167915           87.4    1e-17   
ref|XP_006001553.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  86.3    1e-17   
gb|KIW38609.1|  hypothetical protein PV06_09562                       87.4    1e-17   
ref|XP_011138522.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  86.7    1e-17   
ref|XP_007755036.1|  ubiquitin-conjugating enzyme (huntingtin int...  87.4    1e-17   
gb|KIM83578.1|  hypothetical protein PILCRDRAFT_819209                87.0    1e-17   
gb|EHK49597.1|  hypothetical protein TRIATDRAFT_297540                87.0    1e-17   
gb|KIW70744.1|  hypothetical protein PV04_02985                       87.4    1e-17   
ref|XP_008728110.1|  hypothetical protein G647_05561                  87.4    1e-17   
ref|XP_011429616.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  86.7    1e-17   
gb|KIK41357.1|  hypothetical protein CY34DRAFT_214237                 86.7    1e-17   
ref|NP_596239.1|  ubiquitin conjugating enzyme Ubc1 (predicted)       86.7    2e-17   
gb|EMD39899.1|  hypothetical protein CERSUDRAFT_112150                86.7    2e-17   
gb|KIP07933.1|  hypothetical protein PHLGIDRAFT_105092                86.7    2e-17   
ref|XP_007916506.1|  putative ubiquitin-conjugating enzyme protein    87.0    2e-17   
ref|XP_003382495.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  86.3    2e-17   
ref|XP_006001551.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  86.3    2e-17   
ref|XP_011350734.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  86.3    2e-17   
ref|XP_011053792.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  86.3    2e-17   
ref|XP_008600415.1|  ubiquitin-conjugating enzyme                     86.7    2e-17   
ref|XP_011267900.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  86.3    2e-17   
gb|EGI65764.1|  Ubiquitin-conjugating enzyme E2-22 kDa                86.3    2e-17   
ref|XP_001542731.1|  hypothetical protein HCAG_02902                  86.7    2e-17   
ref|XP_009652648.1|  ubiquitin-conjugating enzyme                     86.7    2e-17   
gb|EFN60302.1|  Ubiquitin-conjugating enzyme E2-22 kDa                86.3    2e-17   
gb|KEF60458.1|  ubiquitin-conjugating enzyme (huntingtin interact...  86.7    2e-17   
ref|XP_002793372.1|  ubiquitin-conjugating enzyme                     86.7    2e-17   
gb|EWG47354.1|  ubiquitin-conjugating enzyme (huntingtin interact...  86.7    2e-17   
ref|NP_497174.1|  Protein UBC-20                                      85.9    2e-17   
ref|XP_002432367.1|  ubiquitin-conjugating enzyme E2-22 kDa, puta...  85.9    2e-17   
ref|XP_009021235.1|  hypothetical protein HELRODRAFT_185754           85.9    2e-17   
gb|KGB38531.1|  Ubiquitin-conjugating enzyme E2 K                     85.9    2e-17   
ref|NP_509502.3|  Protein UBC-21                                      86.3    3e-17   
ref|XP_003000321.1|  ubiquitin-conjugating enzyme                     86.3    3e-17   
ref|XP_002295622.1|  ubiquitin-conjugating enzyme                     85.9    3e-17   
ref|XP_504909.1|  YALI0F02563p                                        85.9    3e-17   
tpg|DAA34259.1|  TPA: ubiquitin-protein ligase                        85.1    3e-17   
ref|XP_002435158.1|  ubiquitin protein ligase, putative               85.5    3e-17   
ref|XP_005109764.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  85.5    3e-17   
ref|XP_003047629.1|  hypothetical protein NECHADRAFT_85976            86.3    3e-17   
gb|KIV91352.1|  hypothetical protein PV10_05898                       86.3    3e-17   
gb|EYE94212.1|  hypothetical protein EURHEDRAFT_413434                86.3    3e-17   
gb|KFA69129.1|  hypothetical protein S40285_00053                     86.3    3e-17   
gb|KIW16721.1|  hypothetical protein PV08_03910                       86.3    3e-17   
gb|KEY72913.1|  hypothetical protein S7711_06743                      86.3    3e-17   
gb|KIL90453.1|  hypothetical protein FAVG1_06185                      86.3    3e-17   
ref|XP_003702104.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  85.5    4e-17   
ref|XP_002172199.2|  ubiquitin conjugating enzyme Ubc1                85.5    4e-17   
gb|KHN88323.1|  putative ubiquitin-conjugating enzyme E2 21           85.9    4e-17   
gb|ENH79593.1|  ubiquitin conjugating enzyme                          85.9    4e-17   
gb|ADF45341.1|  ubiquitin conjugating enzyme-2                        84.7    4e-17   
emb|CCD76999.1|  putative ubiquitin-conjugating enzyme E2-25kD        85.5    5e-17   
ref|XP_004223168.1|  ubiquitin-conjugating enzyme family protein      85.5    5e-17   
dbj|GAD91889.1|  ubiquitin-conjugating enzyme, putative               85.9    5e-17   
gb|KDR10179.1|  Ubiquitin-conjugating enzyme E2-22 kDa                85.1    5e-17   
ref|NP_001108475.1|  ubiquitin conjugating enzyme 4                   85.1    5e-17   
emb|CDS09695.1|  hypothetical protein LRAMOSA02372                    84.0    5e-17   
ref|XP_002493859.1|  Ubiquitin-conjugating enzyme that mediates s...  85.5    6e-17   
gb|ETN57965.1|  ubiquitin-conjugating enzyme E2-25kD                  84.7    6e-17   
ref|XP_002084307.1|  GD14207                                          84.7    6e-17   
ref|XP_002055651.1|  GJ19478                                          84.7    6e-17   
gb|EWC74387.1|  hypothetical protein C923_04935                       84.0    6e-17   
ref|XP_011314079.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    6e-17   
ref|XP_011202431.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    6e-17   
ref|XP_003305057.1|  hypothetical protein PTT_17800                   85.5    6e-17   
ref|XP_011192700.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    6e-17   
ref|XP_008549756.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    7e-17   
ref|XP_005183881.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    7e-17   
ref|XP_004526147.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  84.7    8e-17   
gb|KGK36352.1|  hypothetical protein JL09_g4499                       85.1    8e-17   
gb|KGK35716.1|  hypothetical protein JL09_g5133                       85.1    8e-17   
ref|XP_007354446.1|  hypothetical protein AURDEDRAFT_116792           84.7    8e-17   
emb|CDH55607.1|  ubiquitin-conjugating enzyme e2 d4-like              83.6    8e-17   
ref|XP_001930963.1|  ubiquitin-conjugating enzyme E2-24 kDa           85.1    8e-17   
ref|XP_007690771.1|  hypothetical protein COCMIDRAFT_7765             85.1    8e-17   
ref|XP_007711778.1|  hypothetical protein COCCADRAFT_25853            85.1    9e-17   
gb|KDE06850.1|  ubiquitin-conjugating enzyme (huntingtin interact...  84.7    9e-17   
ref|XP_002625248.1|  ubiquitin conjugating enzyme                     85.1    9e-17   
ref|XP_008087193.1|  UBC-like protein                                 84.7    1e-16   
ref|XP_971328.2|  PREDICTED: ubiquitin-conjugating enzyme E2-22 kDa   84.3    1e-16   
ref|XP_001350274.1|  ubiquitin conjugating enzyme, putative           84.3    1e-16   
ref|XP_007787950.1|  hypothetical protein EPUS_04949                  84.7    1e-16   
ref|XP_007305100.1|  hypothetical protein STEHIDRAFT_98645            84.7    1e-16   
ref|XP_002145471.1|  ubiquitin conjugating enzyme (UbcA), putative    84.7    1e-16   
ref|XP_002145474.1|  ubiquitin conjugating enzyme (UbcA), putative    84.7    1e-16   
ref|XP_006001552.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  84.0    1e-16   
gb|KIM21145.1|  hypothetical protein M408DRAFT_38163                  84.0    1e-16   
gb|KDQ08360.1|  hypothetical protein BOTBODRAFT_139070                84.3    1e-16   
ref|XP_002007998.1|  GI13263                                          84.0    1e-16   
ref|XP_002047266.1|  GJ12033                                          84.0    1e-16   
ref|XP_002587797.1|  hypothetical protein BRAFLDRAFT_126583           84.0    1e-16   
dbj|GAM34939.1|  hypothetical protein TCE0_015r02853                  84.3    1e-16   
ref|XP_001956333.1|  GF25155                                          84.0    1e-16   
ref|NP_524010.2|  ubiquitin conjugating enzyme 4, isoform A           84.0    1e-16   
ref|XP_002062492.1|  GK16629                                          84.0    1e-16   
ref|XP_002029925.1|  GM25177                                          83.6    2e-16   
ref|XP_001972212.1|  GG15402                                          83.6    2e-16   
ref|XP_001353067.1|  GA20954                                          83.6    2e-16   
ref|XP_009256513.1|  hypothetical protein FPSE_05120                  84.0    2e-16   
gb|ACI68189.1|  Ubiquitin-conjugating enzyme E2 K                     82.0    2e-16   
ref|XP_011317901.1|  ubiquitin-conjugating enzyme E2-24 kDa           84.0    2e-16   
emb|CDR44408.1|  RHTO0S09e03796g1_1                                   84.0    2e-16   
emb|CEP17424.1|  hypothetical protein                                 82.4    2e-16   
emb|CDK28735.1|  unnamed protein product                              84.0    2e-16   
ref|XP_008470831.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  83.2    2e-16   
emb|CAA63424.1|  ubiquitin conjugating enzyme                         83.2    2e-16   
gb|KFB42674.1|  ubiquitin-conjugating enzyme E2-25kD                  83.2    2e-16   
dbj|GAN08337.1|  ubiquitin-conjugating enzyme E2 D4-like isoform 1    82.0    3e-16   
emb|CDR14128.1|  ubiquitin-conjugating enzyme, putative               83.2    3e-16   
ref|XP_004881753.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  83.6    3e-16   
ref|XP_003972207.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  83.2    3e-16   
gb|EHK19596.1|  hypothetical protein TRIVIDRAFT_46746                 83.6    3e-16   
ref|XP_002055124.1|  GJ18969                                          83.2    3e-16   
ref|XP_001984204.1|  GH16318                                          83.2    3e-16   
emb|CAP33756.2|  Protein CBR-UBC-21                                   83.2    3e-16   
gb|ACN69493.1|  ubiquitin conjugating enzyme                          83.6    3e-16   
gb|EPB83470.1|  ubiquitin-conjugating enzyme E2 D/E                   82.0    3e-16   
ref|XP_007696649.1|  hypothetical protein COCSADRAFT_34586            83.6    3e-16   
emb|CCF37754.1|  ubiquitin-conjugating enzyme                         83.6    3e-16   
gb|ETO33534.1|  Ubiquitin-conjugating enzyme family protein           82.8    3e-16   
ref|XP_008226313.1|  PREDICTED: ubiquitin-conjugating enzyme E2 1...  82.0    3e-16   
ref|XP_011503723.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  82.8    3e-16   
gb|EPE08569.1|  ubiquitin-conjugating enzyme                          83.6    3e-16   
ref|XP_008814881.1|  ubiquitin-conjugating enzyme (huntingtin int...  82.8    3e-16   
gb|KHJ34968.1|  putative ubiquitin conjugating enzyme                 83.2    4e-16   
ref|XP_003741326.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  82.8    4e-16   
ref|XP_007213111.1|  hypothetical protein PRUPE_ppa023630mg           81.6    4e-16   
ref|XP_002261329.1|  ubiquitin-conjugating enzyme                     82.8    4e-16   
gb|KEQ61811.1|  hypothetical protein M437DRAFT_75988                  83.2    4e-16   
ref|XP_001846293.1|  ubiquitin-conjugating enzyme E2-25kD             82.4    4e-16   
ref|XP_001616347.1|  Ubiquitin-conjugating enzyme family protein      82.8    4e-16   
ref|XP_007113940.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     80.5    4e-16   
ref|XP_001316746.1|  ubiquitin conjugating enzyme                     81.6    4e-16   
ref|XP_001648569.1|  AAEL004152-PA                                    82.4    4e-16   
gb|ABI98680.1|  ubiquitin-conjugating enzyme H1                       82.4    5e-16   
ref|XP_002112784.1|  hypothetical protein TRIADDRAFT_24883            82.4    5e-16   
pdb|1YLA|A  Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Hunt...  82.4    5e-16   
ref|XP_002769772.1|  ubiquitin-conjugating enzyme, putative           80.5    5e-16   
ref|XP_001458160.1|  hypothetical protein                             82.0    5e-16   
emb|CCD28097.1|  ubiquitin-conjugating enzyme                         82.0    6e-16   
ref|XP_002168516.2|  PREDICTED: uncharacterized protein LOC100209390  85.9    6e-16   
dbj|GAM86705.1|  hypothetical protein ANO11243_047240                 82.8    6e-16   
ref|XP_005467726.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    6e-16   
ref|XP_007781246.1|  ubiquitin-conjugating enzyme (huntingtin int...  82.8    6e-16   
emb|CEG70162.1|  Putative Ubiquitin-conjugating enzyme E2 D/E         81.3    6e-16   
gb|EFX77049.1|  hypothetical protein DAPPUDRAFT_305966                82.0    6e-16   
ref|XP_006629986.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    6e-16   
ref|XP_007274704.1|  ubiquitin conjugating enzyme                     82.4    6e-16   
ref|XP_005456929.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    6e-16   
ref|XP_010866881.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  82.0    6e-16   
ref|XP_006088557.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    7e-16   
ref|XP_002010226.1|  GI14815                                          82.0    7e-16   
ref|NP_001104582.1|  ubiquitin-conjugating enzyme E2 K isoform 2      81.3    7e-16   
gb|ABX10874.1|  huntingtin interacting protein 2-like protein         81.3    7e-16   
gb|ACI68198.1|  Ubiquitin-conjugating enzyme E2 K                     82.0    7e-16   
ref|XP_790028.2|  PREDICTED: ubiquitin-conjugating enzyme E2-22 k...  82.0    7e-16   
gb|EQB53190.1|  ubiquitin-conjugating enzyme                          82.4    7e-16   
gb|KFY89930.1|  hypothetical protein V498_06257                       82.4    7e-16   
emb|CEG75060.1|  Putative Ubiquitin-conjugating enzyme E2 D/E         80.9    7e-16   
gb|KFH45367.1|  Ubiquitin-conjugating enzyme E2-like protein          82.4    7e-16   
gb|KEQ76243.1|  hypothetical protein M436DRAFT_70611                  82.4    7e-16   
gb|KIN05847.1|  hypothetical protein OIDMADRAFT_154391                82.4    7e-16   
ref|XP_010776321.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     82.0    7e-16   
gb|ETO29102.1|  Ubiquitin-conjugating enzyme family protein           81.6    8e-16   
pdb|3K9P|A  Chain A, The Crystal Structure Of E2-25k And Ubiquiti...  82.0    8e-16   
gb|KFY62730.1|  hypothetical protein V496_04429                       82.8    8e-16   
gb|KEQ80287.1|  hypothetical protein M438DRAFT_304745                 82.4    8e-16   
pdb|2BEP|A  Chain A, Crystal Structure Of Ubiquitin Conjugating E...  80.9    9e-16   
ref|XP_008699725.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     82.4    9e-16   
gb|KIJ60726.1|  hypothetical protein HYDPIDRAFT_57268                 80.5    9e-16   
ref|XP_007887315.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     81.6    9e-16   
ref|XP_011503721.1|  PREDICTED: ubiquitin-conjugating enzyme E2-2...  81.6    9e-16   
ref|XP_004655870.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  80.9    9e-16   
ref|XP_007598738.1|  ubiquitin-conjugating enzyme                     82.0    1e-15   
gb|ETB60979.1|  hypothetical protein YYC_01935                        80.5    1e-15   
ref|XP_010746956.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     81.6    1e-15   
gb|KFH69424.1|  ubiquitin-conjugating enzyme E2 D/E                   80.5    1e-15   
dbj|GAA95025.1|  hypothetical protein E5Q_01680                       82.0    1e-15   
ref|XP_007548297.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_008410982.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     81.3    1e-15   
ref|XP_008325276.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     81.3    1e-15   
ref|XP_005795343.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_002745946.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_010895757.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_003444801.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
gb|KFY08929.1|  hypothetical protein V492_05782                       81.6    1e-15   
ref|NP_001026711.1|  ubiquitin-conjugating enzyme E2 K                81.3    1e-15   
gb|ELR02265.1|  hypothetical protein GMDG_05335                       81.6    1e-15   
ref|NP_001008611.1|  ubiquitin-conjugating enzyme E2 K                81.3    1e-15   
ref|NP_005330.1|  ubiquitin-conjugating enzyme E2 K isoform 1         81.3    1e-15   
ref|XP_674871.1|  ubiquitin-conjugating enzyme                        81.3    1e-15   
emb|CDQ72603.1|  unnamed protein product                              81.3    1e-15   
ref|NP_001270748.1|  uncharacterized protein LOC101865827             81.3    1e-15   
ref|XP_006629985.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_006088556.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K...  81.3    1e-15   
ref|XP_008831468.1|  PREDICTED: ubiquitin-conjugating enzyme E2 K     81.3    1e-15   
dbj|BAA24927.1|  huntingtin interacting protein-2                     81.3    1e-15   
emb|CBI15730.3|  unnamed protein product                              80.1    1e-15   
dbj|BAE38915.1|  unnamed protein product                              80.9    1e-15   
emb|CEI97330.1|  Putative Ubiquitin-conjugating enzyme (Huntingti...  80.5    1e-15   



>ref|NP_001275389.1| ubiquitin-conjugating enzyme E2 27-like [Solanum tuberosum]
 gb|ABB86282.1| ubiquitin-conjugating protein-like [Solanum tuberosum]
Length=194

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDL RVQKEL ECNRDVQVSGI V+ +GDSLTHL GTIPGP+GTPYEGGTFKIDITL D
Sbjct  1    MVDLARVQKELHECNRDVQVSGINVTLKGDSLTHLIGTIPGPVGTPYEGGTFKIDITLTD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKFATKVWHPNIS
Sbjct  61   GYPFEPPKMKFATKVWHPNIS  81



>ref|NP_001233964.1| ubiquitin conjugating enzyme [Solanum lycopersicum]
 emb|CAA58111.1| ubiquitin conjugating enzyme [Solanum lycopersicum]
Length=194

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDL RVQKEL ECNRDVQVSGI V+ +GDSLTHL GTIPGP+GTPYEGGTFKIDITL D
Sbjct  1    MVDLARVQKELHECNRDVQVSGINVTLKGDSLTHLIGTIPGPVGTPYEGGTFKIDITLTD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKFATKVWHPNIS
Sbjct  61   GYPFEPPKMKFATKVWHPNIS  81



>gb|ABB87105.1| ubiquitin conjugating enzyme-like [Solanum tuberosum]
Length=194

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDL RVQKEL ECNRDVQVSGI V+ +GDSLTHL GTIPGP+GTPYEGGTFKIDITL D
Sbjct  1    MVDLTRVQKELHECNRDVQVSGINVTLKGDSLTHLIGTIPGPVGTPYEGGTFKIDITLTD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKFATKVWHPNIS
Sbjct  61   GYPFEPPKMKFATKVWHPNIS  81



>emb|CDO98671.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDL RVQKELQECN+DV+VSGI+V+P+ DSL HL GTIPGP+GTPYEGGTF IDITLPD
Sbjct  1    MVDLTRVQKELQECNKDVEVSGIRVAPKADSLIHLIGTIPGPLGTPYEGGTFNIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMRFATKVWHPNIS  81



>ref|XP_011073121.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X2 [Sesamum 
indicum]
Length=195

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 75/82 (91%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQECNRD QVSGIKV P+G++ L HL GTIPGPIGTPYEGGTFKIDITLP
Sbjct  1    MVDFARVQKELQECNRDFQVSGIKVMPKGEANLAHLLGTIPGPIGTPYEGGTFKIDITLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKMKFATKVWHPNIS
Sbjct  61   DGYPFEPPKMKFATKVWHPNIS  82



>ref|XP_009615553.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nicotiana tomentosiformis]
 ref|XP_009780316.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nicotiana sylvestris]
 gb|AHG12636.1| ubiquitin conjugating enzyme [Nicotiana tabacum]
Length=192

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDL RVQKELQECNRDV VSGI V+ +GDSLTHL GTIPGP+GTPYEGG+FKIDITL D
Sbjct  1    MVDLARVQKELQECNRDVGVSGISVTLKGDSLTHLIGTIPGPLGTPYEGGSFKIDITLTD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMRFATKVWHPNIS  81



>gb|EYU32921.1| hypothetical protein MIMGU_mgv1a014267mg [Erythranthe guttata]
Length=195

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQECNRD QVSGIKVSP  ++ L HL GTIPGP+GTPYEGGTFKIDITLP
Sbjct  1    MVDFARVQKELQECNRDFQVSGIKVSPMAETNLAHLLGTIPGPLGTPYEGGTFKIDITLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKMKFATKVWHPN+S
Sbjct  61   DGYPFEPPKMKFATKVWHPNVS  82



>ref|XP_002284366.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Vitis vinifera]
Length=192

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDLGRVQKELQECN+++ VSGI V P+GDSLTHL GTIPGP+GTPYEGG F+IDI LPD
Sbjct  1    MVDLGRVQKELQECNKNMDVSGINVKPKGDSLTHLIGTIPGPMGTPYEGGIFQIDIVLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPP+M+FATKVWHPNIS
Sbjct  61   GYPFEPPRMQFATKVWHPNIS  81



>ref|XP_008464378.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Cucumis melo]
Length=194

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC +D++ SGI+V+P+ DSL+HL GTIPGPI TPYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECTKDIEASGIRVTPKSDSLSHLLGTIPGPISTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_002322290.2| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EEF06417.2| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=185

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L+GTIPGPIGTPYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECSRDMEASGIKVAPKSDNLGRLTGTIPGPIGTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_011002115.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Populus euphratica]
Length=194

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L+GTIPGPIGTPYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECSRDMEASGIKVAPKSDNLGRLTGTIPGPIGTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_011083414.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Sesamum indicum]
Length=195

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQECNRD +VSGI+V P G++ L HL GTIPGP+GTPYEGGTFKIDITLP
Sbjct  1    MVDFARVQKELQECNRDFEVSGIRVVPNGEANLAHLLGTIPGPLGTPYEGGTFKIDITLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKM+FATKVWHPNIS
Sbjct  61   DGYPFEPPKMRFATKVWHPNIS  82



>ref|XP_002511117.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis]
 gb|EEF51719.1| ubiquitin-conjugating enzyme E2-25kD, putative [Ricinus communis]
Length=194

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RDV+ SGIKV+P+ D+L+ L+GTIPGPIGTPYEGGTF+IDI+LPD
Sbjct  1    MMDFARVQKELQECSRDVESSGIKVTPKSDNLSRLTGTIPGPIGTPYEGGTFQIDISLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>gb|ABK92892.1| unknown [Populus trichocarpa]
Length=194

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L+GTIPGPIGTPYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECSRDMEASGIKVAPKSDNLGRLTGTIPGPIGTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_010037360.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Eucalyptus grandis]
 gb|KCW49068.1| hypothetical protein EUGRSUZ_K02668 [Eucalyptus grandis]
Length=194

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D GRVQKELQEC++D Q SGIKVSP+ D+L  L GTIPGPIGTPYEGGTF+IDITLPD
Sbjct  1    MIDFGRVQKELQECSKDSQASGIKVSPKADNLARLVGTIPGPIGTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF+PPKM+FATKVWHPNIS
Sbjct  61   AYPFQPPKMQFATKVWHPNIS  81



>gb|KDP22561.1| hypothetical protein JCGZ_26392 [Jatropha curcas]
Length=194

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L GTIPGPIGTPYEGGTF+IDI+LPD
Sbjct  1    MIDFSRVQKELQECSRDIEASGIKVTPKSDNLARLIGTIPGPIGTPYEGGTFQIDISLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_004138029.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Cucumis sativus]
 ref|XP_004161363.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Cucumis sativus]
 gb|KGN63451.1| hypothetical protein Csa_1G000740 [Cucumis sativus]
Length=194

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC +D++ SGI+V+P+ DSL+HL GTIPGPI TPYEGG F+IDITLPD
Sbjct  1    MIDFARVQKELQECTKDIEASGIRVTPKSDSLSHLLGTIPGPISTPYEGGIFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_002318760.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EEE96980.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=194

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L+GTIPGPI +PYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECSRDMEASGIKVAPKSDNLARLTGTIPGPISSPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_011042936.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Populus euphratica]
Length=194

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+RD++ SGIKV+P+ D+L  L+GTIPGPI +PYEGGTF+IDITLPD
Sbjct  1    MIDFARVQKELQECSRDMEASGIKVAPKSDNLARLTGTIPGPISSPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+FATKVWHPNIS
Sbjct  61   GYPFEPPKMQFATKVWHPNIS  81



>ref|XP_009594947.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   142 bits (359),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 74/82 (90%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSG--IKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVDLGRVQKE QECN+ VQVSG  I VSP+GDSLTHL GTIPGP  TPYEGGTFKIDITL
Sbjct  1    MVDLGRVQKEQQECNKVVQVSGTGIIVSPKGDSLTHLIGTIPGPSDTPYEGGTFKIDITL  60

Query  460  PDGYPFEPPKMKFATKVWHPNI  525
            PDGYPF+PPKM+FATKVWHPNI
Sbjct  61   PDGYPFKPPKMEFATKVWHPNI  82



>ref|XP_006436915.1| hypothetical protein CICLE_v10032815mg [Citrus clementina]
 ref|XP_006485127.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Citrus sinensis]
 gb|ESR50155.1| hypothetical protein CICLE_v10032815mg [Citrus clementina]
 gb|KDO44511.1| hypothetical protein CISIN_1g029412mg [Citrus sinensis]
Length=194

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC++D++ SGIKV+P  D+L HL+G IPGP+GTPYEGGTF++DITLPD
Sbjct  1    MIDFSRVQKELQECSKDIEASGIKVTPVSDNLVHLTGIIPGPVGTPYEGGTFRLDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM F TKVWHPNIS
Sbjct  61   GYPFEPPKMHFVTKVWHPNIS  81



>ref|XP_010555576.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Tarenaya hassleriana]
Length=192

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQ+C +D   SGI+VSP+ D+LT L GTIPGPIGTPYEGGTF+IDITLPD
Sbjct  1    MIDFSRVQKELQDCEKDKDASGIRVSPKSDNLTRLVGTIPGPIGTPYEGGTFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GYPFEPPKMQFTTKVWHPNIS  81



>ref|XP_010678313.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVD  RVQKELQECN+DV+VSGI V P+ DSL+HL GTIPGP+ +PYEGGTF IDI LPD
Sbjct  1    MVDFSRVQKELQECNKDVKVSGISVKPKADSLSHLIGTIPGPVDSPYEGGTFLIDIVLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPP MKF TKVWHPNIS
Sbjct  61   GYPFEPPLMKFLTKVWHPNIS  81



>ref|XP_007209522.1| hypothetical protein PRUPE_ppa010579mg [Prunus persica]
 gb|EMJ10721.1| hypothetical protein PRUPE_ppa010579mg [Prunus persica]
Length=244

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +1

Query  259  GETRRKDGKMVDLGRVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGG  435
             E   K  KMVD  RVQKELQEC+RDV+ SGIKVSP+GD SL  L GTIPGP GTPYEGG
Sbjct  41   SEILCKQLKMVDFARVQKELQECSRDVERSGIKVSPKGDGSLARLIGTIPGPTGTPYEGG  100

Query  436  TFKIDITLPDGYPFEPPKMKFATKVWHPNIS  528
            TF+IDI LPD YPFEPPKMKF TKVWHPNIS
Sbjct  101  TFQIDIALPDAYPFEPPKMKFTTKVWHPNIS  131



>ref|XP_010442437.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
 ref|XP_010442569.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
 ref|XP_010482396.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Camelina sativa]
Length=192

 Score =   143 bits (360),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQ+C+RD   SGI+VSP+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDFSRVQKELQDCSRDNDSSGIRVSPKADNLTRLTGTIPGPIGTPYEGGTFQIDITMPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+T+VWHPNIS
Sbjct  61   GYPFEPPKMQFSTRVWHPNIS  81



>ref|XP_007038089.1| Ubiquitin-conjugating enzyme 27 [Theobroma cacao]
 gb|EOY22590.1| Ubiquitin-conjugating enzyme 27 [Theobroma cacao]
Length=194

 Score =   142 bits (359),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+R+   SGIKVSP+ D+L  L+G IPGP+GTPYEGG+F+IDITLPD
Sbjct  1    MIDFARVQKELQECSREKDTSGIKVSPKSDNLARLTGIIPGPLGTPYEGGSFEIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKF TKVWHPNIS
Sbjct  61   GYPFEPPKMKFVTKVWHPNIS  81



>ref|XP_008239533.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Prunus mume]
Length=195

 Score =   142 bits (359),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQEC+RDV+ SGIKVSP+GD SL  L GTIPGP GTPYEGGTF+IDI LP
Sbjct  1    MVDFARVQKELQECSRDVERSGIKVSPKGDGSLARLIGTIPGPTGTPYEGGTFQIDIALP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPFEPPKMKF TKVWHPNIS
Sbjct  61   DAYPFEPPKMKFTTKVWHPNIS  82



>ref|XP_006402053.1| hypothetical protein EUTSA_v10014747mg [Eutrema salsugineum]
 gb|ESQ43506.1| hypothetical protein EUTSA_v10014747mg [Eutrema salsugineum]
Length=192

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQ+C +D   SGI+VSP+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDFSRVQKELQDCEKDKDASGIRVSPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITIPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|XP_006282380.1| hypothetical protein CARUB_v10028678mg [Capsella rubella]
 gb|EOA15278.1| hypothetical protein CARUB_v10028678mg [Capsella rubella]
Length=192

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  R+QKELQ+C RD   SGI+VSP+ D LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDFSRIQKELQDCGRDNDSSGIRVSPKADDLTRLTGTIPGPIGTPYEGGTFQIDITMPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|NP_199900.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
 sp|Q9FI61.1|UBC27_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 27; AltName: Full=Ubiquitin 
carrier protein 27 [Arabidopsis thaliana]
 dbj|BAB08733.1| ubiquitin-conjugating enzyme-like protein [Arabidopsis thaliana]
 gb|AAL38779.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AAM20069.1| putative ubiquitin-conjugating enzyme protein [Arabidopsis thaliana]
 gb|AAY44866.1| ubiquitinating enzyme [Arabidopsis thaliana]
 gb|ABG85247.1| ubiquitin conjugating enzyme [Arabidopsis thaliana]
 gb|AED96003.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
Length=192

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  R+QKELQ+C R+   SGI+V P+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+PD
Sbjct  1    MIDFSRIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|NP_001190508.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
 gb|AED96004.1| ubiquitin-conjugating enzyme E2 27 [Arabidopsis thaliana]
Length=203

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  R+QKELQ+C R+   SGI+V P+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+PD
Sbjct  1    MIDFSRIQKELQDCERNQDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>gb|KJB50908.1| hypothetical protein B456_008G209500 [Gossypium raimondii]
Length=194

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+R+   SGI+VSP+ D+L  L+G IPGP+GTPYEGG+F+IDITLPD
Sbjct  1    MIDFARVQKELQECSREKDSSGIRVSPKSDNLARLTGIIPGPLGTPYEGGSFEIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKF TKVWHPNIS
Sbjct  61   GYPFEPPKMKFVTKVWHPNIS  81



>ref|XP_002865827.1| ubiquitin-conjugating enzyme 26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42086.1| ubiquitin-conjugating enzyme 26 [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQ+C R+   SGI+V P+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDFSRVQKELQDCERNQDSSGIRVCPKADNLTRLTGTIPGPIGTPYEGGTFQIDITMPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>emb|CDY45812.1| BnaC03g16350D [Brassica napus]
Length=192

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKELQ+C +D   SGI+V P+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDISRVQKELQDCEKDRDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITIPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|XP_009132686.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Brassica rapa]
 emb|CDX84883.1| BnaA03g13470D [Brassica napus]
Length=192

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKELQ+C +D   SGI+V P+ D+LT L+GTIPGPIGTPYEGGTF+IDIT+P+
Sbjct  1    MIDISRVQKELQDCEKDRDSSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITIPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>gb|KHN23957.1| Ubiquitin-conjugating enzyme E2 27 [Glycine soja]
Length=192

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+DL RVQKEL EC++D + SGIKVSP+ D+L  L GTIPGP+GTPYEGG F+IDITLPD
Sbjct  1    MIDLARVQKELVECSKDAEGSGIKVSPKNDNLVLLIGTIPGPVGTPYEGGIFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GYPFEPPKMQFKTKVWHPNIS  81



>gb|KHN31276.1| Ubiquitin-conjugating enzyme E2 27 [Glycine soja]
Length=192

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+DL RVQKEL EC++D + SGIKV P+ D+L  L GTIPGP+GTPYEGG F+IDITLPD
Sbjct  1    MIDLARVQKELVECSKDAEGSGIKVCPKSDNLVLLIGTIPGPVGTPYEGGIFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKMKF TKVWHPNIS
Sbjct  61   GYPFEPPKMKFKTKVWHPNIS  81



>ref|XP_010093942.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis]
 gb|EXB54905.1| Ubiquitin-conjugating enzyme E2 27 [Morus notabilis]
Length=195

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M+D  RVQKELQEC +DV+ SGI+V+P+ D+ L  L GTIPGPIGTPYEGG F+IDITLP
Sbjct  1    MIDFARVQKELQECGKDVEGSGIRVAPKSDATLARLVGTIPGPIGTPYEGGVFQIDITLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKM+F+TKVWHPNIS
Sbjct  61   DGYPFEPPKMQFSTKVWHPNIS  82



>ref|XP_004501731.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like isoform X1 
[Cicer arietinum]
 ref|XP_004501732.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like isoform X2 
[Cicer arietinum]
Length=192

 Score =   137 bits (346),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKEL EC++D + SGI+V P+ D+L HL GTIPGPIGTPYEGG F+IDITLP+
Sbjct  1    MIDFARVQKELVECSKDAEGSGIRVIPKSDNLVHLIGTIPGPIGTPYEGGVFQIDITLPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|XP_004297507.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Fragaria vesca 
subsp. vesca]
Length=195

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKEL EC+RD++ SGIKV P+ D +L HL GTIPGP+GTPYEGGTF+IDI+LP
Sbjct  1    MVDFARVQKELLECSRDIERSGIKVVPKSDGNLAHLVGTIPGPMGTPYEGGTFQIDISLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPFEPPKM+F TKVWHPNIS
Sbjct  61   DAYPFEPPKMQFTTKVWHPNIS  82



>ref|XP_011073120.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X1 [Sesamum 
indicum]
Length=228

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 75/115 (65%), Gaps = 34/115 (30%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQECNRD QVSGIKV P+G++ L HL GTIPGPIGTPYEGGTFKIDITLP
Sbjct  1    MVDFARVQKELQECNRDFQVSGIKVMPKGEANLAHLLGTIPGPIGTPYEGGTFKIDITLP  60

Query  463  ---------------------------------DGYPFEPPKMKFATKVWHPNIS  528
                                             DGYPFEPPKMKFATKVWHPNIS
Sbjct  61   AVKLPVFPIYVVSECYQLVFSWTKELLTFFLCADGYPFEPPKMKFATKVWHPNIS  115



>ref|XP_008392720.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Malus domestica]
Length=195

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQEC+RD++ SGIKV P+ ++ L  L GTIPGP+GTPYEGGTF+IDI LP
Sbjct  1    MVDFARVQKELQECSRDIERSGIKVIPKSEATLARLIGTIPGPVGTPYEGGTFQIDIALP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPFEPPKM+F TKVWHPNIS
Sbjct  61   DAYPFEPPKMQFTTKVWHPNIS  82



>ref|XP_007137877.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 ref|XP_007137878.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 ref|XP_007137879.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09871.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09872.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
 gb|ESW09873.1| hypothetical protein PHAVU_009G163400g [Phaseolus vulgaris]
Length=192

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKEL EC++D + SGIKVSP+ D L  L GTIPGP+GTPYEGG F+IDITLP+
Sbjct  1    MIDFARVQKELVECSKDSEGSGIKVSPKSDDLVQLFGTIPGPVGTPYEGGIFQIDITLPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GYPFEPPKMQFKTKVWHPNIS  81



>ref|XP_010250584.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Nelumbo nucifera]
Length=230

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  271  RKDGKMVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKID  450
            R   KMVD  RVQKEL +CNRD  +SG+ +   G+ L+HLSGTI GP+ TPYEGGTFKID
Sbjct  32   RNRLKMVDFSRVQKELVDCNRDTAISGVSIMLLGNDLSHLSGTITGPVATPYEGGTFKID  91

Query  451  ITLPDGYPFEPPKMKFATKVWHPNIS  528
            I LPDGYPFEPPKM+F TKVWHPNIS
Sbjct  92   IRLPDGYPFEPPKMQFMTKVWHPNIS  117



>gb|KFK26715.1| hypothetical protein AALP_AA8G283800 [Arabis alpina]
Length=192

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+DL RVQKEL +C +++  S I+V P+ D+LT L+GTIPGP+GTPYEGGTF+IDIT+P+
Sbjct  1    MLDLSRVQKELHDCEKNIDGSNIRVCPKSDNLTRLTGTIPGPVGTPYEGGTFQIDITIPE  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMQFSTKVWHPNIS  81



>ref|XP_008364577.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Malus domestica]
Length=195

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKELQEC+RD++ SGIKV P+ ++ L  L GTIPGP+GTPYEGGTF+IDI LP
Sbjct  1    MVDFARVQKELQECSRDMERSGIKVIPKNEATLARLIGTIPGPMGTPYEGGTFQIDIALP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPFEPPKM+F TKVWHPNIS
Sbjct  61   DAYPFEPPKMQFTTKVWHPNIS  82



>gb|AFK44991.1| unknown [Lotus japonicus]
Length=193

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M+D  RVQKEL EC++D + SGI+V P+GD SL  L GTIPGP+GTPYEGG F+IDITLP
Sbjct  1    MIDFARVQKELVECSKDAEGSGIRVVPKGDTSLVLLLGTIPGPVGTPYEGGVFQIDITLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKM+F TKVWHPNIS
Sbjct  61   DGYPFEPPKMRFTTKVWHPNIS  82



>gb|KJB50909.1| hypothetical protein B456_008G209500 [Gossypium raimondii]
Length=201

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 7/88 (8%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP-  462
            M+D  RVQKELQEC+R+   SGI+VSP+ D+L  L+G IPGP+GTPYEGG+F+IDITLP 
Sbjct  1    MIDFARVQKELQECSREKDSSGIRVSPKSDNLARLTGIIPGPLGTPYEGGSFEIDITLPV  60

Query  463  ------DGYPFEPPKMKFATKVWHPNIS  528
                  DGYPFEPPKMKF TKVWHPNIS
Sbjct  61   IGFYFADGYPFEPPKMKFVTKVWHPNIS  88



>ref|XP_009337530.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Pyrus x bretschneideri]
Length=195

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD  RVQKEL EC+RD++ SGIKV P+ ++ L  L GTIPGP+GTPYEGGTF+IDI LP
Sbjct  1    MVDFARVQKELLECSRDIERSGIKVIPKNEATLARLIGTIPGPVGTPYEGGTFQIDIALP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPFEPPKM+F TKVWHPNIS
Sbjct  61   DAYPFEPPKMQFTTKVWHPNIS  82



>ref|XP_003602765.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES73016.1| ubiquitin-conjugating enzyme E2, putative [Medicago truncatula]
Length=216

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  283  KMVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            KMVD  RVQKEL +C +D + SGI+V+ + D+L +L GTIPGP GTPY+GG F+IDITLP
Sbjct  24   KMVDFARVQKELADCRKDAEGSGIRVALKSDNLVNLIGTIPGPTGTPYDGGVFQIDITLP  83

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            DGYPFEPPKM+F+TKVWHPNIS
Sbjct  84   DGYPFEPPKMRFSTKVWHPNIS  105



>ref|XP_003602764.1| Ubiquitin carrier protein [Medicago truncatula]
 gb|AES73015.1| ubiquitin-conjugating enzyme E2, putative [Medicago truncatula]
 gb|AFK47848.1| unknown [Medicago truncatula]
Length=192

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVD  RVQKEL +C +D + SGI+V+ + D+L +L GTIPGP GTPY+GG F+IDITLPD
Sbjct  1    MVDFARVQKELADCRKDAEGSGIRVALKSDNLVNLIGTIPGPTGTPYDGGVFQIDITLPD  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPFEPPKM+F+TKVWHPNIS
Sbjct  61   GYPFEPPKMRFSTKVWHPNIS  81



>ref|XP_006645263.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Oryza brachyantha]
Length=195

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G ++ HL+GTI GP+GTPYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGSTINHLTGTIAGPLGTPYEGGTFVIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFITKVWHPNIS  82



>ref|XP_010908214.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X2 [Elaeis 
guineensis]
Length=195

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M+D+ RVQKEL ECNRD  +SG+ +   G S L+HLSGTI GP+GTPYEGGTF+IDI LP
Sbjct  1    MLDVSRVQKELVECNRDKGISGVSIVHDGRSDLSHLSGTITGPVGTPYEGGTFQIDICLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   SGYPFEPPKMQFITKVWHPNIS  82



>gb|AGY80454.1| ubiquitin-conjugating enzyme [Dendrocalamus latiflorus]
Length=196

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVD+ RVQKEL ECNRD +VSG+ ++    G +++HL+G I GP+GTPYEGGTF IDI L
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGGSNISHLTGAIAGPVGTPYEGGTFLIDIHL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
            P GYPFEPPKM+F TKVWHPNIS
Sbjct  61   PGGYPFEPPKMQFVTKVWHPNIS  83



>ref|NP_001045259.1| Os01g0925800 [Oryza sativa Japonica Group]
 dbj|BAB89662.1| putative ubiquitin conjugating enzyme [Oryza sativa Japonica 
Group]
 dbj|BAB92885.1| putative ubiquitin conjugating enzyme [Oryza sativa Japonica 
Group]
 dbj|BAF07173.1| Os01g0925800 [Oryza sativa Japonica Group]
 gb|EAY77049.1| hypothetical protein OsI_05005 [Oryza sativa Indica Group]
 gb|EAZ14687.1| hypothetical protein OsJ_04611 [Oryza sativa Japonica Group]
 dbj|BAG93414.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G +++HL+GTI GP GTPYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGSTISHLTGTIAGPQGTPYEGGTFVIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFITKVWHPNIS  82



>ref|XP_009385499.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            M+D+ RVQKEL ECNRD  +SG+ ++    G  L+ LSGTI GP+ TPYEGGTF+IDI L
Sbjct  1    MLDVSRVQKELAECNRDTAISGVSIALHDGGSDLSRLSGTISGPVATPYEGGTFQIDIRL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
            P GYPFEPPKM+F TKVWHPNIS
Sbjct  61   PSGYPFEPPKMQFVTKVWHPNIS  83



>ref|XP_003564977.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Brachypodium distachyon]
Length=196

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVD+ RVQKEL ECNRD  +SG+ ++    G S++HL+GTI GP  TPYEGGTF+IDI L
Sbjct  1    MVDVSRVQKELTECNRDSAISGVSIALHDGGSSISHLTGTIAGPQDTPYEGGTFRIDIRL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
            P GYPFEPPKM+F TKVWHPNIS
Sbjct  61   PGGYPFEPPKMQFITKVWHPNIS  83



>emb|CDM85817.1| unnamed protein product [Triticum aestivum]
Length=196

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVD+ RVQKEL ECNRD  +SG+ ++    G S+THL+GTI GP  +PYEGGTF+IDI L
Sbjct  1    MVDVSRVQKELTECNRDSDISGVSIALHDGGSSITHLTGTIAGPRDSPYEGGTFRIDIRL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
            P GYPFEPPKM+F TKVWHPNIS
Sbjct  61   PGGYPFEPPKMQFITKVWHPNIS  83



>ref|XP_006844560.1| hypothetical protein AMTR_s00016p00186510 [Amborella trichopoda]
 gb|ERN06235.1| hypothetical protein AMTR_s00016p00186510 [Amborella trichopoda]
Length=192

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKEL E +RD ++SG+ ++  GD ++HLSGTI GPI TPYEGGTF+IDI LP 
Sbjct  1    MLDVSRVQKELVEIDRDKRISGVSITLHGDDISHLSGTISGPIETPYEGGTFQIDIQLPA  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKM+F TKVWHPNIS
Sbjct  61   SYPFEPPKMQFLTKVWHPNIS  81



>gb|EMT06415.1| Ubiquitin carrier protein E2 27 [Aegilops tauschii]
Length=227

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVD+ RVQKEL ECNRD  +SG+ ++    G S+THL+GTI GP  +PYEGGTF+IDI L
Sbjct  1    MVDVSRVQKELTECNRDSDISGVSIALHDGGSSITHLTGTIAGPRDSPYEGGTFRIDIRL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
            P GYPFEPPKM+F TKVWHPNIS
Sbjct  61   PGGYPFEPPKMQFITKVWHPNIS  83



>ref|XP_008801125.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 [Phoenix dactylifera]
Length=196

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            M+D+ RVQKEL ECNRD  +SG+ ++    G  L+HLSGTI GP+GTPYEGGTF+IDI L
Sbjct  1    MLDVSRVQKELVECNRDKAISGVNITLHDGGSDLSHLSGTITGPVGTPYEGGTFRIDIRL  60

Query  460  PDGYPFEPPKMKFATKVWHPNIS  528
               YPFEPPKM+F TKVWHPNIS
Sbjct  61   SSAYPFEPPKMQFITKVWHPNIS  83



>ref|XP_004971132.1| PREDICTED: ubiquitin-conjugating enzyme E2 27-like [Setaria italica]
Length=195

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G +++HL+GTI GP  +PYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSITLHDGANISHLTGTIAGPADSPYEGGTFTIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFVTKVWHPNIS  82



>gb|KHG10228.1| Ubiquitin-conjugating enzyme E2 27 -like protein [Gossypium arboreum]
Length=220

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D  RVQKELQEC+R+   SGI+VSP+ D+L  L+G IPGP+GTPYEGG+F+IDITLPD
Sbjct  1    MIDFARVQKELQECSREKDSSGIRVSPKSDNLARLTGIIPGPLGTPYEGGSFEIDITLPD  60

Query  466  GYPFEPPKMKFATK  507
            GYPFEPPKMKF TK
Sbjct  61   GYPFEPPKMKFVTK  74



>ref|XP_002459014.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor]
 gb|EES04134.1| hypothetical protein SORBIDRAFT_03g044480 [Sorghum bicolor]
Length=195

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G +++HL+GTI GP  +PYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGANISHLTGTIAGPADSPYEGGTFVIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFVTKVWHPNIS  82



>gb|AFW84086.1| hypothetical protein ZEAMMB73_619651 [Zea mays]
Length=156

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G +++HL+GTI GP  +PYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGANISHLTGTIAGPADSPYEGGTFVIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFITKVWHPNIS  82



>ref|NP_001150323.1| ubiquitin-conjugating enzyme E2-22 kDa [Zea mays]
 gb|ACG38646.1| ubiquitin-conjugating enzyme E2-22 kDa [Zea mays]
 gb|AFW84087.1| ubiquitin carrier protein [Zea mays]
Length=197

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR-GDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MVD+ RVQKEL ECNRD +VSG+ ++   G +++HL+GTI GP  +PYEGGTF IDI LP
Sbjct  1    MVDVSRVQKELTECNRDREVSGVSIALHDGANISHLTGTIAGPADSPYEGGTFVIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
             GYPFEPPKM+F TKVWHPNIS
Sbjct  61   GGYPFEPPKMQFITKVWHPNIS  82



>gb|EWM21093.1| ubiquitin-conjugating enzyme e2 27 [Nannochloropsis gaditana]
Length=149

 Score =   117 bits (294),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M D  R+QKEL+EC +D Q SG+  SP G SL HLSGTI GP GTPYE G FKIDI +P 
Sbjct  1    MGDFSRIQKELRECAKD-QKSGVTASPVGSSLNHLSGTITGPDGTPYEKGVFKIDIQIPT  59

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKMKF TK+WHPNIS
Sbjct  60   SYPFEPPKMKFVTKIWHPNIS  80



>emb|CCA27209.1| ubiquitinconjugating enzyme E2 putative [Albugo laibachii Nc14]
Length=196

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M   GR+QKEL EC +D+Q+SG+  S  GDSL HL GTI GP GTPYEGG F IDI +P 
Sbjct  1    MATRGRIQKELLECQKDLQLSGVSASQNGDSLDHLKGTICGPPGTPYEGGVFHIDIHIPS  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF PP M+F TK+WHPNIS
Sbjct  61   TYPFAPPTMQFTTKIWHPNIS  81



>emb|CBJ30375.1| ubiquitin-conjugating enzyme 1 [Ectocarpus siliculosus]
Length=357

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +1

Query  292  DLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGY  471
            D GR++KEL EC RD   SG+   P+GDSL  L GTI GP+GTP+EGGTF I+I +P GY
Sbjct  165  DAGRIRKELAECARDTD-SGVTAVPKGDSLARLEGTILGPVGTPFEGGTFLINIDIPSGY  223

Query  472  PFEPPKMKFATKVWHPNIS  528
            PFEPPKMKFATK+WHPNIS
Sbjct  224  PFEPPKMKFATKIWHPNIS  242



>gb|ABK21242.1| unknown [Picea sitchensis]
 gb|ADE77183.1| unknown [Picea sitchensis]
Length=195

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M+D+ R+QKEL E  RD + SGI  +  GDS L HL GTI GP+GTPYEGG F+IDI LP
Sbjct  1    MLDVSRIQKELTEIERDKKTSGISANLCGDSDLAHLCGTIAGPMGTPYEGGLFQIDIRLP  60

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPFEPPKM+F TKVWHPNIS
Sbjct  61   AAYPFEPPKMQFMTKVWHPNIS  82



>emb|CCI11036.1| unnamed protein product [Albugo candida]
Length=196

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M   GRV+KEL EC +D+Q+SG+  S  GDSL HL GTI GP GTPYEGG F IDI +P 
Sbjct  1    MATRGRVRKELLECQKDLQLSGVSASQNGDSLEHLKGTICGPPGTPYEGGVFHIDIHIPS  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF PP M+F TK+WHPNIS
Sbjct  61   TYPFAPPTMQFTTKIWHPNIS  81



>ref|XP_008360795.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-conjugating enzyme 
E2 27-like [Malus domestica]
Length=78

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            MV+  RVQKELQEC+RD++ SGIKV P+ +     L GTIPGP GTP EGGTF+IDI LP
Sbjct  1    MVBFARVQKELQECSRDIECSGIKVIPKSEXXJARLIGTIPGPFGTPXEGGTFQIDIALP  60

Query  463  DGYPFEPPKMKFATKV  510
            D YPFEPPKM+F TK+
Sbjct  61   DAYPFEPPKMQFTTKI  76



>ref|XP_010908213.1| PREDICTED: ubiquitin-conjugating enzyme E2 27 isoform X1 [Elaeis 
guineensis]
Length=215

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M+D+ RVQKEL ECNRD  +SG+ +   G S L+HLSGTI GP+GTPYEGGTF+IDI LP
Sbjct  1    MLDVSRVQKELVECNRDKGISGVSIVHDGRSDLSHLSGTITGPVGTPYEGGTFQIDICLP  60

Query  463  DGYPFEPPKMKFATKVW  513
             GYPFEPPKM+F TKVW
Sbjct  61   SGYPFEPPKMQFITKVW  77



>ref|XP_002971734.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
 gb|EFJ27483.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
Length=195

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKEL E  RD ++SG+ +    D L+ + GTI GPIGTPYEGG F +DI LP 
Sbjct  1    MLDVSRVQKELVEIERDKKLSGVSIQVFDDGLSRMRGTITGPIGTPYEGGIFTVDIQLPS  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKM+F TKVWHPNIS
Sbjct  61   AYPFEPPKMQFITKVWHPNIS  81



>ref|XP_002991561.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
 gb|EFJ07315.1| ubiquitin-conjugating enzyme 27, E2 [Selaginella moellendorffii]
Length=193

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKEL E  RD ++SG+ +    D L+ + GTI GPIGTPYEGG F +DI LP 
Sbjct  1    MLDVSRVQKELVEIERDKKLSGVSIQVFDDGLSRMRGTITGPIGTPYEGGIFTVDIQLPS  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKM+F TKVWHPNIS
Sbjct  61   AYPFEPPKMQFITKVWHPNIS  81



>gb|KJB40047.1| hypothetical protein B456_007G044100 [Gossypium raimondii]
Length=173

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M  L R+ KEL+ECN +   SGI +S + D+LT L G+I GP+GTPYEGG+F+I I LP 
Sbjct  1    MKHLDRILKELEECNTEQDSSGITLSLKPDNLTRLVGSIAGPLGTPYEGGSFQIHIALPG  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YP+EPP+MKF TK+WHPNIS
Sbjct  61   AYPYEPPRMKFITKIWHPNIS  81



>ref|XP_005853570.1| hypothetical protein NGA_0500800 [Nannochloropsis gaditana CCMP526]
 gb|EKU22791.1| hypothetical protein NGA_0500800 [Nannochloropsis gaditana CCMP526]
Length=80

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M D  R+QKEL+EC +D Q SG+  SP G SL HLSGTI GP GTPYE G FKIDI +P 
Sbjct  1    MGDFSRIQKELRECAKD-QKSGVTASPVGSSLNHLSGTITGPDGTPYEKGVFKIDIQIPT  59

Query  466  GYPFEPPKMKFATKVW  513
             YPFEPPKMKF TK+W
Sbjct  60   SYPFEPPKMKFVTKIW  75



>ref|XP_001755212.1| predicted protein [Physcomitrella patens]
 gb|EDQ80156.1| predicted protein [Physcomitrella patens]
Length=194

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M+D+ RVQKEL E  RD ++SG+ +      LT + GTI GP GTPYEGG F +DI LP 
Sbjct  1    MLDVSRVQKELVEIKRDEKLSGVSIEISEGDLTRMRGTIGGPHGTPYEGGVFIVDIQLPS  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKM+F TKVWHPNIS
Sbjct  61   AYPFEPPKMQFVTKVWHPNIS  81



>gb|EMS62075.1| Ubiquitin-conjugating enzyme E2 27 [Triticum urartu]
Length=207

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITL  459
            MVD+ RVQKEL ECNRD  +SG+ ++    G S+THL+GTI GP  +PYEGGTF+IDI L
Sbjct  1    MVDVSRVQKELTECNRDSDISGVSIALHDGGSSITHLTGTIAGPRDSPYEGGTFRIDIRL  60

Query  460  PDGYPFEPPKMKFATK  507
            P GYPFEPPKM+F TK
Sbjct  61   PGGYPFEPPKMQFITK  76



>emb|CEF98001.1| Ubiquitin-conjugating enzyme, active site [Ostreococcus tauri]
Length=192

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M D  R+ KEL+E   D   SG+ VS  GDSLTH+ GTI GP  T YEGG F IDI +  
Sbjct  1    MADTNRIMKELREIASDA-ASGVTVSQHGDSLTHMKGTICGPSDTVYEGGVFHIDIQIGQ  59

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKMKF TKVWHPN+S
Sbjct  60   SYPFEPPKMKFLTKVWHPNVS  80



>ref|XP_001417769.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96062.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=192

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M D  R+ KEL+E   DV  S +KV+  GDSL H+ GTI GP  T YEGGTF IDI +  
Sbjct  1    MADTNRIMKELREIASDV-ASQVKVTQHGDSLVHMKGTIAGPSETVYEGGTFHIDIQIGA  59

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPFEPPKMKF TKVWHPN+S
Sbjct  60   SYPFEPPKMKFLTKVWHPNVS  80



>ref|XP_009032291.1| hypothetical protein AURANDRAFT_69594 [Aureococcus anophagefferens]
 gb|EGB12630.1| hypothetical protein AURANDRAFT_69594 [Aureococcus anophagefferens]
Length=196

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query  292  DLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGY  471
            D GR++KEL E  RD + SG+ V  +   +  L G I GP GTPYEGGT++I IT+P GY
Sbjct  4    DRGRLKKELTELTRDTK-SGVTVEVKSSDMMELEGVITGPEGTPYEGGTYQIGITIPSGY  62

Query  472  PFEPPKMKFATKVWHPNIS  528
            PFEPPKMKF TK+WHPNIS
Sbjct  63   PFEPPKMKFLTKIWHPNIS  81



>ref|XP_008862080.1| hypothetical protein H310_00902 [Aphanomyces invadans]
 gb|ETW08275.1| hypothetical protein H310_00902 [Aphanomyces invadans]
Length=194

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRGDSL-THLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GR++KEL+EC R V++SG+  S R D +   L GTI GP+GTPYEGG F ++I +P  YP
Sbjct  3    GRIRKELEECQRGVELSGVSASLRSDGVWDALVGTIRGPVGTPYEGGHFVLEINIPKTYP  62

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPPK++F TK+WHPNIS
Sbjct  63   FEPPKVRFETKIWHPNIS  80



>ref|XP_001689734.1| ubiquitin conjugating enzyme [Chlamydomonas reinhardtii]
 gb|EDP09472.1| ubiquitin conjugating enzyme [Chlamydomonas reinhardtii]
Length=194

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 2/81 (2%)
 Frame = +1

Query  289  VDLGRVQKEL-QECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            VDLGR+QKEL QE  RD   SG+ V  + +SL HL+G +PGP  TPYEGG F ++I L +
Sbjct  3    VDLGRIQKELKQEIERDT-ASGVTVHLKNNSLQHLTGYVPGPKDTPYEGGLFAVEINLDN  61

Query  466  GYPFEPPKMKFATKVWHPNIS  528
            GYPF PPKM+F  KVWHPN+S
Sbjct  62   GYPFVPPKMRFINKVWHPNVS  82



>ref|XP_008862082.1| hypothetical protein H310_00904 [Aphanomyces invadans]
 gb|ETW08277.1| hypothetical protein H310_00904 [Aphanomyces invadans]
Length=194

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRGDSL-THLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GR++KEL+EC R V++SG+  S R D +   L GTI GP+GTPYEGG F ++I +P  YP
Sbjct  3    GRIRKELEECQRGVELSGVSASLRSDGVWDALVGTIRGPVGTPYEGGHFVLEINIPKTYP  62

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPPK++F TK+WHPNIS
Sbjct  63   FEPPKVRFETKIWHPNIS  80



>ref|XP_009842907.1| hypothetical protein H257_16240 [Aphanomyces astaci]
 gb|ETV67650.1| hypothetical protein H257_16240 [Aphanomyces astaci]
Length=194

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRGDSL-THLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GR++KEL+EC R V+VSG+  S R D +   L GTI GP GTPYEGG F ++I +P  YP
Sbjct  3    GRIRKELEECQRGVEVSGVSASLRTDGVYDALVGTIRGPAGTPYEGGHFVLEINIPKTYP  62

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPPK++F TK+WHPNIS
Sbjct  63   FEPPKVRFDTKIWHPNIS  80



>ref|XP_007514447.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15884.1| predicted protein [Bathycoccus prasinos]
Length=195

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  289  VDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            +D  R+ KEL+E   D + SG+ V   GDSL H+ GTI GP  TPY+GGTF +DI + + 
Sbjct  1    MDTNRLSKELREIASD-KASGVSVELVGDSLAHMRGTITGPSETPYQGGTFLVDIHITNS  59

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPFEPPKMKF TKVWHPN+S
Sbjct  60   YPFEPPKMKFLTKVWHPNVS  79



>ref|XP_005651685.1| hypothetical protein COCSUDRAFT_52084 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27141.1| hypothetical protein COCSUDRAFT_52084 [Coccomyxa subellipsoidea 
C-169]
Length=195

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVDLGR+QKEL+E +RD + SG+ V   G +L  L+G + GP  T YEGG F +DI L D
Sbjct  1    MVDLGRIQKELKEIDRD-RTSGVTVQLTGSNLQRLTGFVEGPRDTAYEGGYFVVDIQLDD  59

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF PPKM+F +KVWHPN+S
Sbjct  60   QYPFVPPKMRFRSKVWHPNVS  80



>ref|XP_009519397.1| hypothetical protein PHYSODRAFT_261502, partial [Phytophthora 
sojae]
 gb|EGZ24109.1| hypothetical protein PHYSODRAFT_261502 [Phytophthora sojae]
Length=178

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L GTI GP  TPYEGG F+++I +P  YP
Sbjct  5    GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGTIQGPKATPYEGGHFELEIVIPPKYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  65   FEPPQMRFITKIWHPNIS  82



>ref|XP_009533884.1| hypothetical protein PHYSODRAFT_518528, partial [Phytophthora 
sojae]
 gb|EGZ11139.1| hypothetical protein PHYSODRAFT_518528 [Phytophthora sojae]
Length=195

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L GTI GP  TPYEGG F+++I +P  YP
Sbjct  4    GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGTIQGPEATPYEGGHFELEIVIPPKYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  64   FEPPQMRFITKIWHPNIS  81



>ref|XP_009533974.1| hypothetical protein PHYSODRAFT_518543, partial [Phytophthora 
sojae]
 gb|EGZ11229.1| hypothetical protein PHYSODRAFT_518543 [Phytophthora sojae]
Length=195

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L GTI GP  TPYEGG F+++I +P  YP
Sbjct  4    GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGTIQGPEATPYEGGHFELEIVIPPKYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  64   FEPPQMRFITKIWHPNIS  81



>ref|XP_008900048.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI54310.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK94162.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL47554.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM00646.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM53827.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN14478.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETP24129.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=196

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYEGG F+++I +P  YP
Sbjct  5    GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGSIKGPEATPYEGGHFELEIVIPPKYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  65   FEPPQMRFLTKIWHPNIS  82



>ref|XP_008900047.1| hypothetical protein PPTG_07524 [Phytophthora parasitica INRA-310]
 gb|ETM00645.1| hypothetical protein L917_02649 [Phytophthora parasitica]
 gb|ETN14477.1| hypothetical protein PPTG_07524 [Phytophthora parasitica INRA-310]
Length=217

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYEGG F+++I +P  YP
Sbjct  26   GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGSIKGPEATPYEGGHFELEIVIPPKYP  85

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  86   FEPPQMRFLTKIWHPNIS  103



>gb|ETI54309.1| hypothetical protein F443_02851 [Phytophthora parasitica P1569]
 gb|ETK94161.1| hypothetical protein L915_02737 [Phytophthora parasitica]
 gb|ETL47553.1| hypothetical protein L916_02711 [Phytophthora parasitica]
 gb|ETM53826.1| hypothetical protein L914_02731 [Phytophthora parasitica]
 gb|ETP24128.1| hypothetical protein F441_02829 [Phytophthora parasitica CJ01A1]
Length=217

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYEGG F+++I +P  YP
Sbjct  26   GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGSIKGPEATPYEGGHFELEIVIPPKYP  85

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  86   FEPPQMRFLTKIWHPNIS  103



>gb|EAR87660.4| ubiquitin-conjugating enzyme [Tetrahymena thermophila SB210]
Length=196

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            GR+QKEL + +++ + S IKV   GD++ H  G I GP  TPY GG F+IDI LP+ YP+
Sbjct  8    GRIQKELSDFSKNAESSNIKVCTVGDNINHWKGYINGPEDTPYHGGVFQIDIQLPNDYPY  67

Query  478  EPPKMKFATKVWHPNIS  528
            +PPKMKF T++WHPNIS
Sbjct  68   KPPKMKFDTRIWHPNIS  84



>gb|ETO83061.1| hypothetical protein, variant [Phytophthora parasitica P1976]
Length=196

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRG-DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYEGG F+++I +P  YP
Sbjct  5    GRVRKELEECQKDSHLSGVTAVPVNVASLSELRGSIKGPEATPYEGGHFELEIVIPPKYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  65   FEPPQMRFLTKIWHPNIS  82



>ref|XP_002906044.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
 gb|EEY67396.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
Length=196

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPY+GG F+++I +P  YP
Sbjct  5    GRVRKELEECQKDSDLSGVTAEPVNAASLSELRGSIQGPEATPYDGGHFELEIIIPPKYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  65   FEPPQMRFLTKIWHPNIS  82



>gb|KIJ45921.1| hypothetical protein M422DRAFT_29567, partial [Sphaerobolus stellatus 
SS14]
Length=221

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RVQKE+ +C  D + S I +S   +SL HL G+ PGP GTPYEGGT+++DI +PD YPF+
Sbjct  7    RVQKEIADCQND-KTSSITISLVDNSLFHLKGSFPGPEGTPYEGGTYEVDIQIPDSYPFQ  65

Query  481  PPKMKFATKVWHPNIS  528
            P KMKF TKV+HPN+S
Sbjct  66   PVKMKFITKVYHPNVS  81



>gb|ETO83060.1| hypothetical protein F444_02862 [Phytophthora parasitica P1976]
Length=217

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRG-DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYEGG F+++I +P  YP
Sbjct  26   GRVRKELEECQKDSHLSGVTAVPVNVASLSELRGSIKGPEATPYEGGHFELEIVIPPKYP  85

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  86   FEPPQMRFLTKIWHPNIS  103



>gb|EWC47763.1| hypothetical protein DRE_02963 [Drechslerella stenobrocha 248]
Length=242

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KE+++  +D  +SG+K  P GD ++HL GT+ GP GTPYEGG F +DI +P+ YPF+
Sbjct  7    RINKEMEDLRKDA-LSGMKADPVGDDISHLRGTLRGPPGTPYEGGVFIVDIKIPNEYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
            PP+M+F TKVWHPN+S
Sbjct  66   PPQMRFETKVWHPNVS  81



>gb|ETP52116.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=196

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYE G F+++I +P  YP
Sbjct  5    GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGSIKGPEATPYEDGHFELEIVIPPKYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  65   FEPPQMRFLTKIWHPNIS  82



>gb|ETP52115.1| hypothetical protein F442_02826 [Phytophthora parasitica P10297]
Length=217

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GRV+KEL+EC +D  +SG+   P    SL+ L G+I GP  TPYE G F+++I +P  YP
Sbjct  26   GRVRKELEECQKDSHLSGVTAVPVNAASLSELRGSIKGPEATPYEDGHFELEIVIPPKYP  85

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPP+M+F TK+WHPNIS
Sbjct  86   FEPPQMRFLTKIWHPNIS  103



>gb|KDO32440.1| hypothetical protein SPRG_02917 [Saprolegnia parasitica CBS 223.65]
Length=195

 Score = 98.2 bits (243),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRG-DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GR++KEL+EC +DV+ SG+    R    L  L GTI GP GTPY  GTF ++I +P  YP
Sbjct  5    GRIRKELEECQKDVETSGVSAHARQPGVLDALVGTIRGPEGTPYANGTFVLEINIPKTYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPPK++F TKVWHPN+S
Sbjct  65   FEPPKVRFETKVWHPNVS  82



>emb|CCE31918.1| probable ubiquitin--protein ligase [Claviceps purpurea 20.1]
Length=235

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KELQ+   D + SG+ V P  G SLTHL GTI  P  TPY GGTF IDI +PD YPF
Sbjct  8    RIAKELQDIQADKETSGVNVVPLNGYSLTHLKGTITAPPDTPYAGGTFTIDIQIPDNYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P MKF TK+WHPN+S
Sbjct  68   KSPAMKFETKIWHPNVS  84



>ref|XP_002502493.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63751.1| predicted protein [Micromonas sp. RCC299]
Length=191

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +1

Query  289  VDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            +D  R+ KEL+E   D + SG+ V   GD+L H+ GT+ GP  +PYEGG F +DI L + 
Sbjct  1    MDTNRLAKELREIQSDTK-SGVTVEVLGDNLAHMQGTLKGPEESPYEGGKFYVDIQLTNS  59

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPFE PKM+F TKVWHPN+S
Sbjct  60   YPFEAPKMRFITKVWHPNVS  79



>ref|XP_003056945.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58590.1| predicted protein [Micromonas pusilla CCMP1545]
Length=191

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +1

Query  289  VDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            +D  R+ KEL+E   D   SG+ V   GD++ H+ GTI GP  +PY+GG F +DI L + 
Sbjct  1    MDTNRLAKELKEIQADT-TSGVTVRVLGDNMAHMQGTILGPEESPYQGGKFVVDIQLTNA  59

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPFEPPKM+F TKVWHPN+S
Sbjct  60   YPFEPPKMRFITKVWHPNVS  79



>ref|XP_007413145.1| hypothetical protein MELLADRAFT_37906 [Melampsora larici-populina 
98AG31]
 gb|EGG03698.1| hypothetical protein MELLADRAFT_37906 [Melampsora larici-populina 
98AG31]
Length=215

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KE+Q+C +D+ VS I + P G  ++ L G  PGP  +PYEGG F++ I +PD YPFE
Sbjct  7    RVMKEIQDCQKDIGVSHIDIEPVGSDMSKLRGKFPGPPNSPYEGGIFEVSIDIPDRYPFE  66

Query  481  PPKMKFATKVWHPNIS  528
            P KMKF TKV+HPN+S
Sbjct  67   PLKMKFITKVYHPNVS  82



>gb|KIY62972.1| hypothetical protein CYLTODRAFT_494274 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=218

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D   SGI++    DS  HL GT PGP GT YEGGTFK+DI +PD YP
Sbjct  5    LRRVNKEISDCKADTS-SGIQIELIDDSPFHLLGTFPGPEGTAYEGGTFKVDINIPDSYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F P KMKF TKV+HPN+S
Sbjct  64   FTPVKMKFITKVYHPNVS  81



>ref|XP_459396.1| DEHA2E01562p [Debaryomyces hansenii CBS767]
 emb|CAG87607.1| DEHA2E01562p [Debaryomyces hansenii CBS767]
Length=220

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    ++ LTHLSG   GP GTPYEGG F++DI +P
Sbjct  1    MSRVRRIAKELEECGQDTQ-SGVSLQLVNETDLTHLSGFFRGPPGTPYEGGLFQVDINIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP+MKFATK++HPNIS
Sbjct  60   NEYPFKPPQMKFATKIYHPNIS  81



>gb|EDK39920.2| hypothetical protein PGUG_04018 [Meyerozyma guilliermondii ATCC 
6260]
Length=221

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D   SGI +S   +S LTHL+G   GP GTPYEGG F +DI +P
Sbjct  1    MSRVKRINKELEECRQDTH-SGISLSLNNESDLTHLTGYFKGPPGTPYEGGVFSVDINIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP MKF TKV+HPNIS
Sbjct  60   NEYPFKPPVMKFLTKVYHPNIS  81



>ref|XP_008604446.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Saprolegnia diclina VS20]
 gb|EQC41877.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Saprolegnia diclina VS20]
Length=195

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRG-DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            GR++KEL+EC +DV  SG+    R       L GTI GP GTPY  GTF ++I++P  YP
Sbjct  5    GRIRKELEECQKDVDTSGVSAHARQPGVFDALVGTIRGPEGTPYANGTFVLEISIPKTYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEPPK++F TKVWHPN+S
Sbjct  65   FEPPKVRFETKVWHPNVS  82



>ref|XP_002952512.1| hypothetical protein VOLCADRAFT_62621 [Volvox carteri f. nagariensis]
 gb|EFJ46359.1| hypothetical protein VOLCADRAFT_62621 [Volvox carteri f. nagariensis]
Length=214

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  304  VQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFEP  483
             QKEL+E  RD + SG+ V  + +SL HL G +PGP  TPYEGG FK+DI L   YPF P
Sbjct  27   AQKELKEIERD-KASGVTVELKNNSLQHLIGYVPGPKDTPYEGGLFKVDIKLESSYPFVP  85

Query  484  PKMKFATKVWHPNIS  528
            PKM F TKVWHPN+S
Sbjct  86   PKMTFLTKVWHPNVS  100



>dbj|GAA92909.1| ubiquitin conjugating enzyme [Aspergillus kawachii IFO 4308]
Length=246

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D Q S I   P   GD LTHL GT PGP GTPYEGGT+ IDI +P+ YP
Sbjct  8    RIAKEIADIHADTQ-SQITAEPLHGGDDLTHLRGTFPGPPGTPYEGGTYTIDIKIPNDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPHMKFVTKVWHPNVS  84



>ref|XP_011116574.1| hypothetical protein H072_11229 [Dactylellina haptotyla CBS 200.50]
 gb|EPS35419.1| hypothetical protein H072_11229 [Dactylellina haptotyla CBS 200.50]
Length=238

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KEL++ ++DV  SGI  S  G+ ++HL G I GP GTPYEGGTFKIDI +P+ YPF+
Sbjct  7    RILKELEDLHKDVH-SGITASLIGEDISHLLGKITGPPGTPYEGGTFKIDIKIPNEYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
            PP+MKF T V+HPN+S
Sbjct  66   PPQMKFETSVYHPNVS  81



>ref|XP_003710343.1| hypothetical protein MGG_05478 [Magnaporthe oryzae 70-15]
 gb|EHA57731.1| hypothetical protein MGG_05478 [Magnaporthe oryzae 70-15]
 gb|ELQ40382.1| ubiquitin-conjugating enzyme [Magnaporthe oryzae Y34]
 gb|ELQ67754.1| ubiquitin-conjugating enzyme [Magnaporthe oryzae P131]
Length=239

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLPDGY  471
            L RV KELQ+   D   SG+  S   +S LTHL G+ PGP GTPYEGGT+ +DI +PD Y
Sbjct  7    LRRVAKELQDIQNDRDNSGVMASAINESDLTHLRGSFPGPPGTPYEGGTYVVDIIIPDTY  66

Query  472  PFEPPKMKFATKVWHPNIS  528
            PF+ P MKF TK+WHPN+S
Sbjct  67   PFKSPIMKFETKMWHPNVS  85



>dbj|GAK62134.1| ubiquitin-conjugating enzyme e2-24 kda [Pseudozyma antarctica]
Length=227

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D + SGI+VS   DS  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKND-KASGIQVSLIDDSPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>dbj|GAC73762.1| ubiquitin-protein ligase [Pseudozyma antarctica T-34]
 gb|ETS63765.1| hypothetical protein PaG_02083 [Pseudozyma aphidis DSM 70725]
Length=227

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D + SGI+VS   DS  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKND-KASGIQVSLIDDSPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>gb|EST06461.1| ubiquitin-protein ligase [Pseudozyma brasiliensis GHG001]
Length=227

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D +VSGI+VS   +S  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKND-KVSGIQVSLIDESPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>ref|XP_007768847.1| hypothetical protein CONPUDRAFT_165646 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW81534.1| hypothetical protein CONPUDRAFT_165646 [Coniophora puteana RWD-64-598 
SS2]
Length=224

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +   GDS  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEISDCKND-KTSNITIDLIGDSPFHLKGSFPGPSGTPYEGGHFEVDIAIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_011386364.1| putative E2 ubiquitin-conjugating protein UBC1 [Ustilago maydis 
521]
 gb|KIS72103.1| putative E2 ubiquitin-conjugating protein UBC1 [Ustilago maydis 
521]
Length=227

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D +VSGI+VS   +S  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKND-KVSGIQVSLIDESPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>ref|XP_004032164.1| ubiquitin-conjugating enzyme family protein, putative [Ichthyophthirius 
multifiliis]
 gb|EGR30577.1| ubiquitin-conjugating enzyme family protein, putative [Ichthyophthirius 
multifiliis]
Length=196

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  298  GRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            GR+QKE+ + ++  + S IKV   G+ L H  G I GP  TPY GG F+IDI LP  YP+
Sbjct  8    GRIQKEITDFHKTAETSNIKVQIVGNDLNHWKGYIAGPEDTPYGGGVFQIDIQLPSEYPY  67

Query  478  EPPKMKFATKVWHPNIS  528
            +PPKMKF T++WHPNIS
Sbjct  68   KPPKMKFDTRIWHPNIS  84



>gb|EJW79559.1| ubiquitin carrier protein [Wuchereria bancrofti]
Length=201

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   RVQ+E +E   N+++  +G+ +  R DSLT + G I GP  +PYEGGT+ +DIT+P
Sbjct  5    IAFSRVQRECKEIITNKELAETGVMIEIRNDSLTKIRGEIRGPPDSPYEGGTYALDITIP  64

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP  KF TK+WHPNIS
Sbjct  65   DEYPFQPPVCKFITKIWHPNIS  86



>ref|XP_003146009.1| hypothetical protein LOAG_10437 [Loa loa]
 gb|EFO18058.1| hypothetical protein LOAG_10437 [Loa loa]
Length=201

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   RVQ+E +E   N+++  +G+ +  R DSLT + G I GP  +PYEGGT+ +DIT+P
Sbjct  5    IAFSRVQRECKEIITNKELAETGVMIEIRNDSLTKIRGEIRGPPDSPYEGGTYALDITIP  64

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP  KF TK+WHPNIS
Sbjct  65   DEYPFQPPICKFITKIWHPNIS  86



>ref|XP_001900771.1| Ubiquitin-conjugating enzyme E2-25 kDa [Brugia malayi]
Length=221

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   RVQ+E +E   N+++  +G+ +  R DSLT + G I GP  +PYEGGT+ +DIT+P
Sbjct  5    IAFSRVQRECKEIITNKELAETGVMIEIRNDSLTKIRGEIRGPPDSPYEGGTYALDITIP  64

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP  KF TK+WHPNIS
Sbjct  65   DEYPFQPPVCKFITKIWHPNIS  86



>emb|CBQ67936.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Sporisorium reilianum 
SRZ2]
Length=227

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D +VSGI++S   +S  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEISDCKND-KVSGIQISLIDESPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>gb|KFG87301.1| ubiquitin-conjugating enzyme E2-24 kDa [Metarhizium anisopliae]
 gb|KID60891.1| ubiquitin-conjugating enzyme E2-24 kDa, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID75503.1| ubiquitin-conjugating enzyme E2-24 kDa, partial [Metarhizium 
brunneum ARSEF 3297]
 gb|KID88274.1| ubiquitin-conjugating enzyme E2-24 kDa [Metarhizium guizhouense 
ARSEF 977]
 gb|KID97775.1| ubiquitin-conjugating enzyme E2-24 kDa, partial [Metarhizium 
majus ARSEF 297]
Length=234

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            RV KELQ+   D   SG+  +P  D +L HL GTIPGP  TPY GGTF IDI +PD YPF
Sbjct  8    RVAKELQDIQADRDNSGVYAAPIDDVNLKHLKGTIPGPPDTPYYGGTFIIDIRIPDNYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P M F+TK+WHPN+S
Sbjct  68   KSPSMSFSTKIWHPNVS  84



>ref|XP_007808316.1| ubiquitin conjugating enzyme (UbcA), putative [Metarhizium acridum 
CQMa 102]
 gb|EFY92028.1| ubiquitin conjugating enzyme (UbcA), putative [Metarhizium acridum 
CQMa 102]
Length=234

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            RV KELQ+   D   SG+  +P  D +L HL GTIPGP  TPY GGTF IDI +PD YPF
Sbjct  8    RVAKELQDIQADRDNSGVYAAPIDDVNLKHLKGTIPGPPDTPYYGGTFIIDIRIPDNYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P M F+TK+WHPN+S
Sbjct  68   KSPSMSFSTKIWHPNVS  84



>ref|XP_007821019.1| Ubiquitin-conjugating enzyme, E2 [Metarhizium robertsii ARSEF 
23]
 gb|EFY99803.1| Ubiquitin-conjugating enzyme, E2 [Metarhizium robertsii ARSEF 
23]
 gb|EXV06492.1| ubiquitin-activating enzyme E2 family protein [Metarhizium robertsii]
Length=234

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            RV KELQ+   D   SG+  +P  D +L HL GTIPGP  TPY GGTF IDI +PD YPF
Sbjct  8    RVAKELQDIQADRDNSGVYAAPIDDVNLKHLKGTIPGPPDTPYYGGTFIIDIRIPDNYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P M F+TK+WHPN+S
Sbjct  68   KSPSMSFSTKIWHPNVS  84



>ref|XP_002615191.1| hypothetical protein CLUG_05206 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ41078.1| hypothetical protein CLUG_05206 [Clavispora lusitaniae ATCC 42720]
Length=219

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D + SG+ +    +S LTHL+G   GP GTPYEGG FK+DI +P
Sbjct  1    MSRVKRIAKELEECRQDSK-SGVSLELVNESDLTHLTGYFKGPPGTPYEGGLFKVDINIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP MKF TK++HPNIS
Sbjct  60   NEYPFKPPVMKFTTKIYHPNIS  81



>gb|EHA22307.1| hypothetical protein ASPNIDRAFT_57253 [Aspergillus niger ATCC 
1015]
Length=246

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D Q S I   P   G+ LTHL GT PGP GTPYEGGT+ IDI +P+ YP
Sbjct  8    RIAKEIADIHADTQ-SQITAEPLHGGEDLTHLRGTFPGPPGTPYEGGTYTIDIKIPNDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPHMKFVTKVWHPNVS  84



>ref|XP_001398255.1| ubiquitin conjugating enzyme (UbcA) [Aspergillus niger CBS 513.88]
 emb|CAK97386.1| unnamed protein product [Aspergillus niger]
Length=246

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D Q S I   P   G+ LTHL GT PGP GTPYEGGT+ IDI +P+ YP
Sbjct  8    RIAKEIADIHADTQ-SQITAEPLHGGEDLTHLRGTFPGPPGTPYEGGTYTIDIKIPNDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPHMKFVTKVWHPNVS  84



>emb|CEJ94406.1| Putative Ubiquitin-conjugating enzyme [Torrubiella hemipterigena]
Length=236

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KELQ+   D   SG+  +P  G +LT L GT P P  TPY G TF++DIT+PD YPF
Sbjct  8    RIAKELQDLQADRDSSGVYAAPIDGVNLTKLLGTFPAPPDTPYAGATFEVDITIPDTYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            +PP+MKF TK+WHPN+S
Sbjct  68   KPPQMKFRTKIWHPNVS  84



>gb|ACO12956.1| Ubiquitin-conjugating enzyme E2 K [Lepeophtheirus salmonis]
Length=200

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  RVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+++E +E   + +V  SG+++S   D LT+LSGTI GP  TPYEGGT+K++I +P+ YP
Sbjct  9    RIKREFREVVKSEEVSNSGVQLSLVNDDLTNLSGTILGPPDTPYEGGTYKLEIKIPESYP  68

Query  475  FEPPKMKFATKVWHPNIS  528
            F PPK++F TK+WHPNIS
Sbjct  69   FMPPKVRFVTKIWHPNIS  86



>ref|XP_001823145.1| ubiquitin conjugating enzyme (UbcA) [Aspergillus oryzae RIB40]
 ref|XP_002378481.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus flavus 
NRRL3357]
 dbj|BAE62012.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED51474.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus flavus 
NRRL3357]
 gb|EIT80697.1| ubiquitin-protein ligase [Aspergillus oryzae 3.042]
 gb|KDE80859.1| ubiquitin-protein [Aspergillus oryzae 100-8]
Length=246

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D Q SGI   P G  + LTHL GT PGP GTPYEGGT+ +DI +P  YP
Sbjct  8    RIAKEIADIHADTQ-SGITAEPVGSDEDLTHLRGTFPGPPGTPYEGGTYVVDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPNIS
Sbjct  67   FRPPVMKFHTKVWHPNIS  84



>emb|CCF54274.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Ustilago hordei]
Length=222

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D +VSGI+V+   +S  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKND-KVSGIQVTLIDESPFHLVGTFPGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>gb|KFH62915.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Mortierella verticillata NRRL 6337]
Length=235

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            + R+QKE+ +C +D Q S I+++    ++ HL G  PGP  TPYEGG F++DI L D YP
Sbjct  5    IRRIQKEISDCQKD-QASLIQLTLEDGNIMHLKGRFPGPPATPYEGGVFQVDIILSDNYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+PPK+KF TKV+HPN+S
Sbjct  64   FQPPKVKFDTKVYHPNVS  81



>emb|CDP99145.1| Protein BM-UBC-20, isoform b [Brugia malayi]
Length=249

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   RVQ+E +E   N+++  +G+ +  R DSLT + G I GP  +PYEGGT+ +DIT+P
Sbjct  53   IAFSRVQRECKEIITNKELAETGVMIEIRNDSLTKIRGEIRGPPDSPYEGGTYALDITIP  112

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP  KF TK+WHPNIS
Sbjct  113  DEYPFQPPVCKFITKIWHPNIS  134



>gb|EPS34742.1| hypothetical protein PDE_09706 [Penicillium oxalicum 114-2]
Length=234

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            RV KEL + + DV  S I V P G  D +THL GT PGP  TPYEGGT+ +DI +P  YP
Sbjct  8    RVAKELADIHADVH-SKITVQPIGNQDDVTHLRGTFPGPPDTPYEGGTYNVDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPTMKFETKVWHPNVS  84



>ref|XP_004204757.1| Piso0_000027 [Millerozyma farinosa CBS 7064]
 emb|CCE72456.1| Piso0_000027 [Millerozyma farinosa CBS 7064]
Length=220

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    ++ LTHL+G   GP GTPYEGG F++DI +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLQLVNENDLTHLTGFFKGPPGTPYEGGIFQVDIKIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP+M+F TK++HPNIS
Sbjct  60   NEYPFKPPQMRFTTKIYHPNIS  81



>gb|KIM36530.1| hypothetical protein M413DRAFT_288264 [Hebeloma cylindrosporum 
h7]
Length=223

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEITDCKND-KTSQIKIETIDESPFHLKGSFPGPEGTPYEGGLFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>ref|XP_001483289.1| hypothetical protein PGUG_04018 [Meyerozyma guilliermondii ATCC 
6260]
Length=221

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D   SGI +    +S LTHL+G   GP GTPYEGG F +DI +P
Sbjct  1    MSRVKRINKELEECRQDTH-SGISLLLNNESDLTHLTGYFKGPPGTPYEGGVFLVDINIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP MKF TKV+HPNIS
Sbjct  60   NEYPFKPPVMKFLTKVYHPNIS  81



>gb|KIR48771.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii CA1280]
 gb|KIR67596.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii CA1873]
Length=220

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++C +D + SGI +    DS  HL G  PGP  TPYEGG +++DI +P+ YP
Sbjct  6    LRRVQKEIKDCAKD-KTSGITIEMIDDSPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPVKMKFITKVYHPNIS  82



>gb|KIR56151.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii Ru294]
 gb|KIR87383.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii IND107]
Length=220

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++C +D + SGI +    DS  HL G  PGP  TPYEGG +++DI +P+ YP
Sbjct  6    LRRVQKEIKDCAKD-KTSGITIEMIDDSPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPVKMKFITKVYHPNIS  82



>gb|EGU87777.1| hypothetical protein FOXB_01702 [Fusarium oxysporum Fo5176]
Length=227

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KEL++   D   SG+  SP  + L HL GT P P  TPY GGTF +DI +PD YPF+
Sbjct  6    RVAKELKDIEADHDDSGVNASPVNNDLKHLKGTFPAPPDTPYAGGTFTVDIQIPDQYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
             P ++F TK+WHPNIS
Sbjct  66   APAIRFDTKIWHPNIS  81



>ref|XP_008717136.1| hypothetical protein HMPREF1541_04569 [Cyphellophora europaea 
CBS 101466]
 gb|ETN40293.1| hypothetical protein HMPREF1541_04569 [Cyphellophora europaea 
CBS 101466]
Length=244

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KEL +   D  VS I V    DS+T L G+  GP GTPYEGGTF++DI++P+ YPF+
Sbjct  8    RVTKELADIKSD-NVSHINVDTVNDSVTKLKGSFSGPPGTPYEGGTFEVDISIPNEYPFK  66

Query  481  PPKMKFATKVWHPNIS  528
            PP MKF TK+WHPN+S
Sbjct  67   PPVMKFLTKIWHPNVS  82



>ref|XP_002548462.1| ubiquitin-conjugating enzyme E2-24 kDa [Candida tropicalis MYA-3404]
 gb|EER33941.1| ubiquitin-conjugating enzyme E2-24 kDa [Candida tropicalis MYA-3404]
Length=220

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +S   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLSLNNENDLTHLTGVFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_006684159.1| hypothetical protein CANTEDRAFT_112466 [Candida tenuis ATCC 10573]
 gb|EGV65585.1| hypothetical protein CANTEDRAFT_112466 [Candida tenuis ATCC 10573]
Length=219

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D   SG+ +    ++ LTHL+G   GP GTPYEGG F++DI +P
Sbjct  1    MSRVKRIAKELEECKQDSH-SGVSLKLNNETDLTHLTGVFKGPPGTPYEGGNFQVDINVP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   SEYPFKPPQMKFITKIYHPNIS  81



>emb|CDM35914.1| Ubiquitin-conjugating enzyme E2 1 [Penicillium roqueforti FM164]
Length=237

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            + R+ KE+ + + DV  S IK  P G  D LTHL G+ PGP GTPYEGG + IDI +P  
Sbjct  6    MRRIGKEIADIHADVH-SHIKAEPFGNLDDLTHLRGSFPGPPGTPYEGGIYDIDIKIPTD  64

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPF PP MKF TKVWHPN+S
Sbjct  65   YPFRPPTMKFETKVWHPNVS  84



>ref|XP_005784046.1| hypothetical protein EMIHUDRAFT_429671 [Emiliania huxleyi CCMP1516]
 gb|EOD31617.1| hypothetical protein EMIHUDRAFT_429671 [Emiliania huxleyi CCMP1516]
Length=197

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDV----QVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDI  453
            M D+ R++KEL+EC++D     +V    +    + L  + G + GP+GTPYEGG F +DI
Sbjct  1    MSDVNRIKKELKECSKDALMEKEVVWASLVSEANLLEWI-GKLKGPVGTPYEGGVFIVDI  59

Query  454  TLPDGYPFEPPKMKFATKVWHPNIS  528
            +LP  YPF PPKMKF T+VWHPN+S
Sbjct  60   SLPSDYPFVPPKMKFRTRVWHPNVS  84



>emb|CCG82392.1| Ubiquitin-conjugating enzyme E2 1 [Taphrina deformans PYCC 5710]
Length=219

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KE+++C +    S + V   GD L+HL GT  GP  TPYEGG F +DI +P+ YPF 
Sbjct  7    RIAKEIEDCQK-ADTSNLSVHTIGDDLSHLKGTFHGPTETPYEGGLFTVDIQIPNDYPFR  65

Query  481  PPKMKFATKVWHPNIS  528
            PPKMKF TK++HPNIS
Sbjct  66   PPKMKFDTKIYHPNIS  81



>gb|EMT66236.1| Ubiquitin-conjugating enzyme E2 1 [Fusarium oxysporum f. sp. 
cubense race 4]
 gb|ENH65301.1| Ubiquitin-conjugating enzyme E2 1 [Fusarium oxysporum f. sp. 
cubense race 1]
 gb|EWZ00560.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum FOSC 3-a]
 gb|EWZ00561.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum FOSC 3-a]
 gb|EWZ46603.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum Fo47]
 gb|EWZ46604.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum Fo47]
 gb|EWZ84611.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EWZ84612.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA43824.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXL47288.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL47289.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL81151.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXL81152.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM02232.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. cubense tropical race 4 54006]
 gb|EXM33438.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|EXM33439.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=233

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KEL++   D   SG+  SP  + L HL GT P P  TPY GGTF +DI +PD YPF+
Sbjct  6    RVAKELKDIEADHDDSGVNASPVNNDLKHLKGTFPAPPDTPYAGGTFTVDIQIPDQYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
             P ++F TK+WHPNIS
Sbjct  66   APAIRFDTKIWHPNIS  81



>gb|EXK87438.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXK87439.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. raphani 54005]
Length=233

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KEL++   D   SG+  SP  + L HL GT P P  TPY GGTF +DI +PD YPF+
Sbjct  6    RVAKELKDIEADHDDSGVNASPVNNDLKHLKGTFPAPPDTPYAGGTFTVDIQIPDQYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
             P ++F TK+WHPNIS
Sbjct  66   APAIRFDTKIWHPNIS  81



>gb|KIN98175.1| hypothetical protein M404DRAFT_1005540 [Pisolithus tinctorius 
Marx 270]
Length=155

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R  KE++ CN DV  SGIKV     S  HL G+ PGP GTPYEGG F++DI  P+ YPF+
Sbjct  7    RATKEIRVCNEDVH-SGIKVEQFDSSPFHLKGSFPGPRGTPYEGGIFEVDIVFPELYPFQ  65

Query  481  PPKMKFATKVWHPNIS  528
            P ++KF TKV+HPNIS
Sbjct  66   PLQIKFITKVYHPNIS  81



>gb|KIM52727.1| hypothetical protein SCLCIDRAFT_487418 [Scleroderma citrinum 
Foug A]
Length=219

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+     S  HL G+ PGP  TPYEGG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KSSSIKIDLVDSSPFHLKGSFPGPSDTPYEGGLFEVDIVIPDAYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>ref|XP_002565396.1| Pc22g14750 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98763.1| Pc22g14750 [Penicillium rubens Wisconsin 54-1255]
Length=236

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            + R+ KE+ + + D   S IK  P G  D +THL G+ PGP GTPYEGGT+ IDI +P  
Sbjct  6    MRRIGKEIADIHADAH-SQIKAEPFGNQDDVTHLRGSFPGPPGTPYEGGTYNIDIKIPTD  64

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPF PP MKF TKVWHPN+S
Sbjct  65   YPFRPPTMKFETKVWHPNVS  84



>gb|EJT45143.1| ubiquitin-conjugating enzyme e2-24 kda [Trichosporon asahii var. 
asahii CBS 2479]
 gb|EKD00541.1| ubiquitin-conjugating enzyme e2-24 kda [Trichosporon asahii var. 
asahii CBS 8904]
Length=217

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE++ C RD + S I +    ++  HL G  PGP  TPYEGG +++DI +PD YP
Sbjct  6    LRRVQKEIKAC-RDDKTSQISIELVDENPFHLIGAFPGPSDTPYEGGYYEVDIVIPDAYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            FEP KMKF TKV+HPNIS
Sbjct  65   FEPVKMKFITKVYHPNIS  82



>gb|EJY66901.1| Ubiquitin-conjugating enzyme, putative [Oxytricha trifallax]
 gb|EJY74558.1| Ubiquitin-conjugating enzyme, putative [Oxytricha trifallax]
Length=195

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +1

Query  286  MVDLGRVQKEL---QECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDIT  456
            M D GR+ KEL   QE  R+     ++    GD+L H  GTI GP  T YEGG F+IDI 
Sbjct  1    MQDNGRIMKELKELQEATRNTTSPTVQAQLVGDNLRHWHGTIFGPKDTCYEGGIFQIDIE  60

Query  457  LPDGYPFEPPKMKFATKVWHPNIS  528
            +P  YPF+PPKM+F TK+WHPNIS
Sbjct  61   IPSEYPFKPPKMRFITKIWHPNIS  84



>gb|KIJ98078.1| hypothetical protein K443DRAFT_221603 [Laccaria amethystina LaAM-08-1]
Length=222

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIRIELIDESPFHLKGSFPGPDGTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>gb|EJU02948.1| hypothetical protein DACRYDRAFT_94114 [Dacryopinax sp. DJM-731 
SS1]
Length=225

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+ +C +D +++ I ++P  +S  HL G   GP GTPYEGG +++D+ +PD YP
Sbjct  6    LRRVQKEISDCQKD-KLTRITLTPIDNSPFHLVGAFDGPSGTPYEGGRYEVDVVVPDSYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPIKMKFITKVYHPNIS  82



>ref|XP_001887589.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR01776.1| predicted protein [Laccaria bicolor S238N-H82]
Length=222

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIRIELIDESPFHLKGSFPGPDGTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>dbj|GAC93359.1| hypothetical protein PHSY_000924 [Pseudozyma hubeiensis SY62]
Length=235

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D +VSGI+VS   +S  HL GT  GP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKTD-KVSGIQVSLIDESPFHLVGTFAGPENSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>gb|KJA16294.1| hypothetical protein HYPSUDRAFT_147916 [Hypholoma sublateritium 
FD-334 SS-4]
Length=221

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEITDCKND-KTSQIKIDLFDESPFHLKGSFPGPEGTPYEGGLFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_002125172.1| PREDICTED: ubiquitin-conjugating enzyme E2 K-like isoform X2 
[Ciona intestinalis]
 ref|XP_004226890.1| PREDICTED: ubiquitin-conjugating enzyme E2 K-like isoform X1 
[Ciona intestinalis]
Length=197

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RVQ+EL++ N +     I++    D   HL G I GP GTPY+GG FK+ I +P+ YPF 
Sbjct  8    RVQRELKDINSECSGQNIRIELMNDQFEHLKGEIIGPPGTPYQGGKFKLSIHIPETYPFN  67

Query  481  PPKMKFATKVWHPNIS  528
            PPK+KF TK+WHPNIS
Sbjct  68   PPKVKFETKIWHPNIS  83



>emb|CDI51448.1| probable UBC1-E2 ubiquitin-conjugating enzyme [Melanopsichium 
pennsylvanicum 4]
Length=227

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D + SGI+VS   +S  HL GT PGP  +PYE GTF +DI +P+GYP
Sbjct  6    LRRINKEINDCKTD-KASGIQVSLIDESPFHLVGTFPGPEHSPYEKGTFDVDIVVPEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF T+V+HPNIS
Sbjct  65   FQPIKMKFITRVYHPNIS  82



>ref|XP_007851632.1| ubiquitin-conjugating enzyme e2-24 kda [Moniliophthora roreri 
MCA 2997]
 gb|ESK89064.1| ubiquitin-conjugating enzyme e2-24 kda [Moniliophthora roreri 
MCA 2997]
Length=225

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    +S  HL G+ PGP GTPYEGG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KTSNIALDLIDNSPFHLKGSFPGPEGTPYEGGHFEVDIVIPDAYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFLTKVYHPNVS  81



>emb|CCE39620.1| hypothetical protein CPAR2_600330 [Candida parapsilosis]
Length=225

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    D+ LTHL+G   GP GTPY+GG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDKQ-SGVTLELNNDADLTHLTGYFAGPPGTPYQGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP+MKF TK++HPNIS
Sbjct  60   NEYPFKPPQMKFTTKIYHPNIS  81



>gb|KHG15935.1| Ubiquitin-conjugating enzyme E2 27 -like protein [Gossypium arboreum]
Length=165

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 6/81 (7%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M  L R+ KEL+ECN +   SGI +S + D+LT L G+I GP+GTPYEGG+F+I I LP 
Sbjct  1    MKHLARILKELEECNTEQDSSGITLSLKPDNLTRLIGSIAGPLGTPYEGGSFQIHIALPG  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YP+EPP+M       HPNIS
Sbjct  61   AYPYEPPRMT------HPNIS  75



>gb|KHN97238.1| Ubiquitin-conjugating enzyme/RWD-like protein [Metarhizium album 
ARSEF 1941]
Length=234

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            RV KELQ+   D   SG+  +P  G +L HL GTI GP  TPY GGTF IDI +PD YPF
Sbjct  8    RVAKELQDIQADRDTSGVYAAPIDGVNLKHLKGTISGPPDTPYYGGTFMIDIRIPDNYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P M F TK+WHPN+S
Sbjct  68   KSPSMSFNTKIWHPNVS  84



>gb|KDQ26171.1| hypothetical protein PLEOSDRAFT_52152 [Pleurotus ostreatus PC15]
Length=217

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV +E+ +C  D + S IK+    +S  HL G+ PGP GTPY+GG F+IDI +P+ YP
Sbjct  5    LRRVTREIADCKND-KTSSIKIETIDESPFHLKGSFPGPEGTPYQGGNFEIDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_002767170.1| ubiquitin-conjugating enzyme E2-25 kDa, putative [Perkinsus marinus 
ATCC 50983]
 gb|EEQ99887.1| ubiquitin-conjugating enzyme E2-25 kDa, putative [Perkinsus marinus 
ATCC 50983]
Length=133

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KEL +     + S I     GD LTH  G + GP  TPYEGG F IDIT+P  YP+ 
Sbjct  10   RLNKELDDIRSQSEESSINADIVGDDLTHWKGHLDGPPATPYEGGHFVIDITIPADYPYT  69

Query  481  PPKMKFATKVWHPNIS  528
            PPKMKF TK+WHPNIS
Sbjct  70   PPKMKFDTKIWHPNIS  85



>ref|XP_007377517.1| hypothetical protein SPAPADRAFT_63387 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30546.1| hypothetical protein SPAPADRAFT_63387 [Spathaspora passalidarum 
NRRL Y-27907]
Length=222

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            M  + R+ KEL+EC +D Q   I      + LTHL+G   GP GTPY+GG F+++I +P+
Sbjct  1    MSRVKRIAKELEECRQDSQSGVILKLNNENDLTHLTGYFKGPPGTPYQGGVFQVNIDIPN  60

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF+PP+MKF TK++HPNIS
Sbjct  61   EYPFKPPQMKFTTKIYHPNIS  81



>gb|ESX01368.1| Ubiquitin-conjugating enzyme that mediates selective degradation 
of short-lived and abnormal protein [Ogataea parapolymorpha 
DL-1]
Length=230

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVS-PRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL++  +D  +SG+ +S    D L+HL GT  GP GTPYEGG F++DI +P
Sbjct  1    MSRVKRIAKELEDVKKDA-LSGVTLSLVSEDDLSHLKGTFVGPPGTPYEGGLFEVDIQIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP MKF TK++HPNIS
Sbjct  60   DAYPFKPPIMKFDTKIYHPNIS  81



>gb|EIF46667.1| ubiquitin-conjugating enzyme that mediates selective degradation 
of short-lived and abnormal protein [Brettanomyces bruxellensis 
AWRI1499]
Length=234

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL++  RD ++S + + P   D+L HL GT  GP GTPYEGG F++DI +P
Sbjct  1    MSRVKRISKELEDVKRD-KLSHVTLVPVDEDNLEHLKGTFEGPPGTPYEGGLFEVDIKIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP MKF TK++HPNIS
Sbjct  60   DEYPFKPPNMKFDTKIYHPNIS  81



>gb|KDB11497.1| putative ubiquitin conjugating enzyme (UbcA) [Ustilaginoidea 
virens]
Length=232

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGI-KVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KEL +   D   SG+   S  G SL HL GT+PGP  TPY GG+F IDI +PD YPF
Sbjct  6    RIAKELIDIQADRDDSGVFATSADGHSLNHLKGTVPGPPDTPYAGGSFTIDIQIPDSYPF  65

Query  478  EPPKMKFATKVWHPNIS  528
            + P MKF TK+WHPN+S
Sbjct  66   KSPTMKFDTKIWHPNVS  82



>gb|EMG50146.1| Ubiquitin carrier protein [Candida maltosa Xu316]
Length=220

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ ++   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLTLNNENDLTHLTGYFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFTTKIYHPNIS  81



>gb|KDR77462.1| hypothetical protein GALMADRAFT_95199 [Galerina marginata CBS 
339.88]
Length=220

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEITDCKND-KTSQIKIDLIDESPFHLKGSFPGPEGTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_003661904.1| hypothetical protein MYCTH_2301813 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56659.1| hypothetical protein MYCTH_2301813 [Myceliophthora thermophila 
ATCC 42464]
Length=235

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KEL + + D   SG+  +P   S LTHL GT PGP  TPY GGT+KIDI +PD YPF
Sbjct  8    RIAKELADIHNDKDNSGVYANPVDPSDLTHLKGTFPGPPDTPYAGGTYKIDIVIPDMYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P MKF TK+WHPN+S
Sbjct  68   KSPIMKFDTKIWHPNVS  84



>ref|XP_003871480.1| Ubc1 protein [Candida orthopsilosis Co 90-125]
 emb|CCG25356.1| Ubc1 protein [Candida orthopsilosis]
Length=226

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    D+ LTHL+G   GP GTPY+GG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDKQ-SGVTLELNNDADLTHLTGYFAGPPGTPYQGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP+MKF TK++HPNIS
Sbjct  60   NEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_569863.1| ubiquitin-conjugating enzyme e2-24 kda [Cryptococcus neoformans 
var. neoformans JEC21]
 ref|XP_776710.1| hypothetical protein CNBC2010 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL22063.1| hypothetical protein CNBC2010 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW42556.1| ubiquitin-conjugating enzyme e2-24 kda, putative [Cryptococcus 
neoformans var. neoformans JEC21]
Length=220

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++C +D + SGI +    D+  HL G  PGP  TPYEGG +++DI +P+ YP
Sbjct  6    LRRVQKEIKDCAKD-KTSGIAIEMIDDNPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  65   FQPVKMKFITKVYHPNVS  82



>ref|XP_001383781.2| hypothetical protein PICST_71285 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN65752.2| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=220

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    ++ LT L+G   GP GTPY+GG F +DIT+P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLKLNNENDLTKLTGFFKGPPGTPYQGGVFSVDITIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP MKF+TK++HPNIS
Sbjct  60   NEYPFKPPVMKFSTKIYHPNIS  81



>ref|XP_009546801.1| hypothetical protein HETIRDRAFT_434426 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW82266.1| hypothetical protein HETIRDRAFT_434426 [Heterobasidion irregulare 
TC 32-1]
Length=221

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S + +     S  HL G+ PGP GTPYE GTF++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KSSNVSIDLVDSSPFHLIGSFPGPDGTPYEKGTFQVDIVIPDAYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFLTKVYHPNVS  81



>ref|XP_007867121.1| hypothetical protein GLOTRDRAFT_139354 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ54899.1| hypothetical protein GLOTRDRAFT_139354 [Gloeophyllum trabeum 
ATCC 11539]
Length=221

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP GTPYEGG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KSSKIQLDLVDESPFHLKGSFPGPEGTPYEGGRFEVDIRIPDSYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPLKMKFITKVYHPNVS  81



>gb|AFR93785.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus neoformans var. grubii H99]
Length=220

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++C +D + SGI +    D+  HL G  PGP  TPYEGG +++DI +P+ YP
Sbjct  6    LRRVQKEIKDCAKD-KTSGIAIEMIDDNPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  65   FQPVKMKFITKVYHPNVS  82



>ref|XP_004204199.1| Piso0_000027 [Millerozyma farinosa CBS 7064]
 emb|CCE73017.1| Piso0_000027 [Millerozyma farinosa CBS 7064]
Length=220

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ +    ++ LTHL+G   GP  TPYEGG F++DI +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLQLVNENDLTHLTGFFKGPPSTPYEGGIFQVDIKIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF+PP+M+F TK++HPNIS
Sbjct  60   NEYPFKPPQMRFTTKIYHPNIS  81



>gb|KDQ51574.1| hypothetical protein JAAARDRAFT_41035 [Jaapia argillacea MUCL 
33604]
Length=224

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    +S  HL G  PGP GTPYEGG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KTSKITLELVDESPFHLKGAFPGPEGTPYEGGHFEVDIRIPDSYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPLKMKFITKVYHPNIS  81



>gb|KDB33821.1| hypothetical protein H112_04211, partial [Trichophyton rubrum 
D6]
Length=86

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KE+ + + D   S I V P   D LT L G+ PGP GT YEGGTFK+DIT+P  YPF
Sbjct  8    RITKEIADIHADRH-SQITVDPISEDDLTRLKGSFPGPPGTAYEGGTFKVDITIPTEYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF T+VWHPNIS
Sbjct  67   RPPVMKFDTRVWHPNIS  83



>ref|XP_005827196.1| hypothetical protein GUITHDRAFT_154189 [Guillardia theta CCMP2712]
 gb|EKX40216.1| hypothetical protein GUITHDRAFT_154189 [Guillardia theta CCMP2712]
Length=191

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +1

Query  289  VDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            +DL R++KE  E    ++  G+  SP  + L+H  G I GP  T Y GG F+IDI L   
Sbjct  1    MDLKRLKKESVELQEPIEKCGVTASPIKEDLSHWKGYILGPDDTAYAGGKFEIDIVLTSS  60

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPFEPPKMKF TK+WHPN+S
Sbjct  61   YPFEPPKMKFNTKIWHPNVS  80



>emb|CEL56875.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Rhizoctonia solani AG-1 IB]
Length=223

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    D+  HL G+ PGP  TPY+GGT+++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KTSKISIELIDDNPFHLCGSFPGPEDTPYQGGTYQVDIVIPDSYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>ref|XP_001274030.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW12604.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus clavatus 
NRRL 1]
Length=271

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDS--LTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ +   D   S I   P GD   +THL GT PGP GTPYEGGT+KID+ +P  YP
Sbjct  8    RIAKEIADIQADT-YSQITAEPVGDDDDITHLRGTFPGPPGTPYEGGTYKIDVKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPVMKFETKVWHPNVS  84



>ref|XP_003332230.1| ubiquitin-conjugating enzyme [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP87811.1| ubiquitin-conjugating enzyme [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=286

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KE+Q+C R+   + I +   GD L++L G  PGP  +PYEGGTF++ I +P  YPFE
Sbjct  7    RVMKEIQDCQRESASTQINIKMVGDDLSNLRGQFPGPPNSPYEGGTFEVAIEVPPRYPFE  66

Query  481  PPKMKFATKVWHPNIS  528
            P KMKF TKV+HPN+S
Sbjct  67   PLKMKFVTKVYHPNVS  82



>ref|XP_004344504.1| ubiquitin-conjugating enzyme [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96580.1| ubiquitin-conjugating enzyme [Capsaspora owczarzaki ATCC 30864]
Length=220

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +1

Query  295  LGRVQKELQECNRD--VQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            + RV+KE  EC  D  ++   IK+S   DS   L G IPGP+GTP+EGG F++ I +P  
Sbjct  29   IARVKKEYVECQSDEGMKSCNIKLSLVEDSFVKLRGEIPGPLGTPFEGGVFQLLIDIPQN  88

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPF PP +KF TKVWHPN+S
Sbjct  89   YPFNPPIVKFETKVWHPNVS  108



>ref|XP_007379770.1| hypothetical protein PUNSTDRAFT_81407 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN12203.1| hypothetical protein PUNSTDRAFT_81407 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=222

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    DS  HL G+  GP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIRIELIDDSPYHLKGSFNGPEGTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|EEQ46595.1| hypothetical protein CAWG_04951 [Candida albicans WO-1]
Length=228

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ ++   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLNLNNENDLTHLTGYFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_002421181.1| ubiquitin carrier protein, putative; ubiquitin-conjugating enzyme, 
putative; ubiquitin-protein ligase, putative [Candida 
dubliniensis CD36]
 emb|CAX41342.1| ubiquitin carrier protein, putative [Candida dubliniensis CD36]
Length=224

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ ++   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLNLNNENDLTHLTGYFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_712073.1| likely ubiquitin-conjugating enzyme Ubc1p [Candida albicans SC5314]
 gb|EAK92876.1| likely ubiquitin-conjugating enzyme Ubc1p [Candida albicans SC5314]
Length=230

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ ++   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLNLNNENDLTHLTGYFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_712098.1| likely ubiquitin-conjugating enzyme Ubc1p [Candida albicans SC5314]
 gb|EAK92902.1| likely ubiquitin-conjugating enzyme Ubc1p [Candida albicans SC5314]
 gb|KGQ84409.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P94015]
 gb|KGQ85607.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P37005]
 gb|KGQ87464.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans GC75]
 gb|KGQ87671.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans GC75]
 gb|KGR03986.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P57072]
 gb|KGR06128.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P78048]
 gb|KGR09982.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P37037]
 gb|KGT65701.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans 12C]
 gb|KGU04177.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P87]
 gb|KGU05111.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans L26]
 gb|KGU05710.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans 19F]
 gb|KGU21212.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P34048]
 gb|KGU21213.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P34048]
 gb|KGU24585.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P57055]
 gb|KGU24646.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P75063]
 gb|KHC30889.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P76055]
 gb|KHC31396.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P76067]
 gb|KHC32569.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans Ca6]
 gb|KHC47340.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P60002]
 gb|KHC50590.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P37039]
 gb|KHC57738.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P75010]
 gb|KHC63184.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P75016]
 gb|KHC69609.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans P78042]
 gb|KHC73565.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans SC5314]
 gb|KHC82355.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Candida albicans SC5314]
Length=232

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M  + R+ KEL+EC +D Q SG+ ++   ++ LTHL+G   GP GTPYEGG F++ I +P
Sbjct  1    MSRVKRIAKELEECRQDTQ-SGVSLNLNNENDLTHLTGYFKGPPGTPYEGGLFQVAIDIP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
              YPF+PP+MKF TK++HPNIS
Sbjct  60   QEYPFKPPQMKFITKIYHPNIS  81



>ref|XP_002840834.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ85025.1| unnamed protein product [Tuber melanosporum]
Length=253

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            M    R+ KEL +  +D   SG+  +P  ++ +THL G   GP GTPYEGG F +DI LP
Sbjct  1    MATRRRILKELDDMAKDT-TSGMHATPLDEADMTHLQGRFAGPPGTPYEGGEFVVDIKLP  59

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PP+MKF TK+WHPN+S
Sbjct  60   DNYPFMPPRMKFITKIWHPNVS  81



>ref|XP_006681813.1| hypothetical protein BATDEDRAFT_91378 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77716.1| hypothetical protein BATDEDRAFT_91378 [Batrachochytrium dendrobatidis 
JAM81]
Length=203

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  286  MVDLGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            MVD+ R+++E+++C+ D   + I V P  D+L H+ G   GP  T YEGG F IDI LPD
Sbjct  1    MVDIKRIEREIRQCHADKDTT-ISVQPVNDNLCHIKGFFQGPSETVYEGGKFVIDIKLPD  59

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF+PPKM F T ++HPNIS
Sbjct  60   EYPFKPPKMVFDTPIYHPNIS  80



>gb|EXK43901.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK43902.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Fusarium oxysporum f. sp. melonis 26406]
Length=233

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            RV KEL++   D   SG+  SP  + L HL GT P P  TPY GGTF +DI +P+ YPF+
Sbjct  6    RVAKELKDIEADHDDSGVNASPVNNDLKHLKGTFPAPPDTPYAGGTFTVDIQIPEQYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
             P ++F TK+WHPNIS
Sbjct  66   APAIRFDTKIWHPNIS  81



>ref|XP_753930.1| ubiquitin conjugating enzyme (UbcA) [Aspergillus fumigatus Af293]
 gb|EAL91892.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus fumigatus 
Af293]
 gb|EDP51452.1| ubiquitin conjugating enzyme (UbcA), putative [Aspergillus fumigatus 
A1163]
 gb|KEY81768.1| ubiquitin conjugating enzyme UbcA [Aspergillus fumigatus var. 
RP-2014]
Length=272

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KE+ +   D   S I   P   D +THL GT PGP GTPYEGGT+++DI +P+ YPF
Sbjct  8    RIAKEIADIRADTH-SQITAEPVEDDDVTHLRGTFPGPPGTPYEGGTYEVDIKIPNDYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF TKVWHPN+S
Sbjct  67   RPPVMKFVTKVWHPNVS  83



>gb|EKV12164.1| Cyclin Ccl1, putative [Penicillium digitatum Pd1]
 gb|EKV14336.1| Cyclin Ccl1, putative [Penicillium digitatum PHI26]
Length=672

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D   S IK  P G  D +THL G+ PGP GTPYEGGT+ IDI +P  YP
Sbjct  8    RIGKEIADIHADAH-SQIKAEPFGNQDDVTHLRGSFPGPPGTPYEGGTYNIDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPTMKFETKVWHPNVS  84



>gb|KGO78022.1| Ubiquitin-conjugating enzyme, E2 [Penicillium italicum]
Length=669

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D   S IK  P G  D +THL G+ PGP GTPYEGGT+ IDI +P  YP
Sbjct  8    RIGKEIADIHADAH-SQIKAEPFGNQDDVTHLRGSFPGPPGTPYEGGTYNIDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPTMKFETKVWHPNVS  84



>gb|AGN29610.1| ubiquitin-conjugating enzyme E2- 22kDa-like protein [Acartia 
pacifica]
Length=199

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  RVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+Q+E +E   ++++  SG+ +    D LT L+GTI GP  TPY+GG +K++I +PD YP
Sbjct  8    RIQREFREVVKSKEIAESGVHLELIKDDLTELAGTIAGPPDTPYQGGKYKLEIKIPDTYP  67

Query  475  FEPPKMKFATKVWHPNIS  528
            F PPK++F TK+WHPNIS
Sbjct  68   FNPPKVRFITKIWHPNIS  85



>ref|XP_001259977.1| ubiquitin conjugating enzyme (UbcA), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW18080.1| ubiquitin conjugating enzyme (UbcA), putative [Neosartorya fischeri 
NRRL 181]
Length=245

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KE+ +   D   S I   P   D +THL GT PGP GTPYEGGT+++DI +P+ YPF
Sbjct  8    RIAKEIADIRADTH-SQITAEPVEDDDVTHLRGTFPGPPGTPYEGGTYEVDIKIPNDYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF TKVWHPN+S
Sbjct  67   RPPVMKFVTKVWHPNVS  83



>ref|XP_003033703.1| hypothetical protein SCHCODRAFT_256390 [Schizophyllum commune 
H4-8]
 gb|EFI98800.1| hypothetical protein SCHCODRAFT_256390 [Schizophyllum commune 
H4-8]
Length=216

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S +K+    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNVKIDLIDESPFHLKGSFPGPEGTPYEGGHFEVDIRIPETYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|KIK93632.1| hypothetical protein PAXRUDRAFT_502682 [Paxillus rubicundulus 
Ve08.2h10]
Length=219

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP  TPYEGGTF++DI +P+ YP
Sbjct  5    LRRVNKEISDCKGD-KSSSIRIDLIDNSPFHLKGSFPGPKDTPYEGGTFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFLTKVYHPNVS  81



>gb|ERG81184.1| putative ubiquitin-conjugating enzyme e2 21 [Ascaris suum]
Length=200

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   RVQ+E +E   ++++  +G+ +  R DSLT + G I GP  +PYE GT+ +DIT+P
Sbjct  4    IAFSRVQRECKEIITSKELNETGVMIEVRNDSLTKIRGEIKGPPDSPYEHGTYSLDITIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF+PP  KF TK+WHPNIS
Sbjct  64   DEYPFQPPVCKFITKIWHPNIS  85



>ref|XP_659816.1| hypothetical protein AN2212.2 [Aspergillus nidulans FGSC A4]
 gb|EAA63869.1| hypothetical protein AN2212.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF86393.1| TPA: ubiquitin conjugating enzyme (UbcA), putative (AFU_orthologue; 
AFUA_5G07040) [Aspergillus nidulans FGSC A4]
Length=246

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDS--LTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ +   D   S I   P GD   +THL G+ PGP GTPYEGGT+K+DI +P  YP
Sbjct  8    RIAKEIADIRADTH-SQITAEPLGDDDDVTHLRGSFPGPPGTPYEGGTYKVDIKIPTEYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPVMKFITKVWHPNVS  84



>ref|XP_007881930.1| hypothetical protein PFL1_06200 [Pseudozyma flocculosa PF-1]
 gb|EPQ26265.1| hypothetical protein PFL1_06200 [Pseudozyma flocculosa PF-1]
Length=228

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + SG+ V    +S  HL GT PGP  +PY+GG F +DI + +GYP
Sbjct  6    LRRVTKEINDCKND-KSSGVDVVMVDESPYHLIGTFPGPENSPYDGGMFDVDIHISEGYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+PPKMKF TKV+HPNIS
Sbjct  65   FQPPKMKFITKVYHPNIS  82



>gb|KGO45663.1| Ubiquitin-conjugating enzyme, C-terminal fungi [Penicillium expansum]
 gb|KGO52044.1| Ubiquitin-conjugating enzyme, C-terminal fungi [Penicillium expansum]
 gb|KGO62838.1| Ubiquitin-conjugating enzyme, C-terminal fungi [Penicillium expansum]
Length=668

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 45/78 (58%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ + + D   S IK  P G  D +THL G+ PGP GTPYEGGT+ IDI +P  YP
Sbjct  8    RIGKEIADIHADAH-SQIKAEPFGSQDDVTHLRGSFPGPPGTPYEGGTYNIDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPN+S
Sbjct  67   FRPPTMKFETKVWHPNVS  84



>gb|EKG10354.1| Ubiquitin-conjugating enzyme E2 [Macrophomina phaseolina MS6]
Length=245

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            RV KE+Q+  +D   SGI+V   R D LTHL G   GP  TPYEGG + +DI +P+ YPF
Sbjct  8    RVAKEIQDIKQDTH-SGIRVDTFRDDDLTHLRGFFKGPPDTPYEGGEYAVDIKIPNDYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF TK+WHPN+S
Sbjct  67   RPPVMKFETKIWHPNVS  83



>gb|KIJ14982.1| hypothetical protein PAXINDRAFT_115361 [Paxillus involutus ATCC 
200175]
Length=219

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP  TPYEGGTF++DI +P+ YP
Sbjct  5    LRRVNKEISDCKGD-KSSSIRIDLIDNSPFHLKGSFPGPKDTPYEGGTFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_009222625.1| hypothetical protein GGTG_06542 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT76625.1| hypothetical protein GGTG_06542 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=237

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGD-SLTHLSGTIPGPIGTPYEGGTFKIDITLPDGY  471
            L R+ KELQ+   D + S I V P  +  +THL GT P P  TPY GGT+ +DI +PD Y
Sbjct  6    LRRIAKELQDIQADAEKSQIMVVPINEQEITHLKGTFPAPPDTPYTGGTYTVDIVIPDTY  65

Query  472  PFEPPKMKFATKVWHPNIS  528
            PF+ P MKF TK+WHPNIS
Sbjct  66   PFKSPIMKFDTKIWHPNIS  84



>gb|KIJ61091.1| hypothetical protein HYDPIDRAFT_159944 [Hydnomerulius pinastri 
MD-312]
Length=219

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+     S  HL G+ PGP  TPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KSSNIKIDLVDSSPFHLKGSFPGPQDTPYEGGHFEVDIVIPEAYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>emb|CDJ85762.1| Ubiquitin-conjugating enzyme and Ubiquitin-associated translation 
elongation factor EF1B domain containing protein [Haemonchus 
contortus]
Length=200

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   R+Q+E +E   N+++  +GI +    DSL+ + G I GP  TPY+GG+F ++I +P
Sbjct  4    IAFTRIQRECKEVVTNKEIAETGIMIEILNDSLSEIKGQIRGPPDTPYQGGSFDLEIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PPK+KF TK+WHPNIS
Sbjct  64   DSYPFTPPKIKFLTKIWHPNIS  85



>emb|CDJ83787.1| Ubiquitin-conjugating enzyme and Ubiquitin-associated translation 
elongation factor EF1B domain containing protein [Haemonchus 
contortus]
Length=200

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   R+Q+E +E   N+++  +GI +    DSL+ + G I GP  TPY+GG+F ++I +P
Sbjct  4    IAFTRIQRECKEVVTNKEIAETGIMIEILNDSLSEIKGQIRGPPDTPYQGGSFDLEIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PPK+KF TK+WHPNIS
Sbjct  64   DSYPFTPPKIKFLTKIWHPNIS  85



>ref|XP_002785618.1| ubiquitin-conjugating enzyme E2-25 kDa, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER17414.1| ubiquitin-conjugating enzyme E2-25 kDa, putative [Perkinsus marinus 
ATCC 50983]
Length=187

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KEL +     + S I     GD LTH  G + GP  TPYEGG F IDIT+P  YP+ 
Sbjct  10   RLNKELDDIRSQSEESSINADIVGDDLTHWKGHLDGPPATPYEGGHFVIDITIPADYPYT  69

Query  481  PPKMKFATKVWHPNIS  528
            PPKMKF TK+WHPNIS
Sbjct  70   PPKMKFDTKIWHPNIS  85



>emb|CCX32307.1| Similar to Ubiquitin-conjugating enzyme E2 1; acc. no. P21734 
[Pyronema omphalodes CBS 100304]
Length=219

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 55/77 (71%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVS-PRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KEL + ++DV  SG++ + P  D+L  + G   GP  TPY GGTF+IDI LP+ YPF
Sbjct  7    RIMKELDDMSKDV-ASGVRFTIPNSDNLQQIRGIFTGPPDTPYAGGTFEIDIQLPENYPF  65

Query  478  EPPKMKFATKVWHPNIS  528
             PPKMKF T+VWHPN+S
Sbjct  66   VPPKMKFITRVWHPNVS  82



>ref|XP_004990689.1| ubiquitin-conjugating enzyme E2-25kD [Salpingoeca rosetta]
 gb|EGD77345.1| ubiquitin-conjugating enzyme E2-25kD [Salpingoeca rosetta]
Length=185

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = +1

Query  298  GRVQKELQECNRDVQV--SG--IKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPD  465
            GR+++E+ E  +D Q+  SG  IK    GD  THL G+I G   TPYEGGTF++DI +PD
Sbjct  10   GRIKREIAEVKKDKQLLESGTVIKQVKEGD-YTHLHGSIRGAPDTPYEGGTFELDIQIPD  68

Query  466  GYPFEPPKMKFATKVWHPNIS  528
             YPF PPK+KF T++WHPN+S
Sbjct  69   TYPFSPPKVKFLTRIWHPNVS  89



>ref|XP_007797254.1| putative ubiquitin-conjugating enzyme protein [Eutypa lata UCREL1]
 gb|EMR63640.1| putative ubiquitin-conjugating enzyme protein [Eutypa lata UCREL1]
Length=238

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPR--GDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDG  468
            L RV KEL +   D  VS I   P      LTHL  +I GP GTPYEGG F +D+ +P  
Sbjct  6    LRRVAKELADIQADASVSHITAQPADVNADLTHLKASITGPPGTPYEGGKFVVDVKIPTE  65

Query  469  YPFEPPKMKFATKVWHPNIS  528
            YPF PP MKF TKVWHPNIS
Sbjct  66   YPFRPPIMKFDTKVWHPNIS  85



>gb|KIL61916.1| hypothetical protein M378DRAFT_814229 [Amanita muscaria Koide 
BX008]
Length=220

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    DS  HL G+ PGP  TPYEGG F +DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIHIELIDDSPFHLKGSFPGPEETPYEGGKFDVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>gb|KIO15436.1| hypothetical protein M407DRAFT_98351 [Tulasnella calospora MUT 
4182]
Length=217

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C +D + S +++    ++  HL GT PGP  TPYEGG F +DI +PD YP
Sbjct  6    LRRVNKEIADCRKD-KASNVEIDLVEENPFHLIGTFPGPPDTPYEGGRFSVDIVIPDSYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  65   FQPVKMKFLTKVYHPNVS  82



>gb|KII90998.1| hypothetical protein PLICRDRAFT_697404 [Plicaturopsis crispa 
FD-325 SS-3]
Length=220

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++    +S  HL G+ PGP  TPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIRIDLIDESPFHLKGSFPGPEDTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>ref|XP_007837763.1| hypothetical protein PFICI_10991 [Pestalotiopsis fici W106-1]
 gb|ETS77117.1| hypothetical protein PFICI_10991 [Pestalotiopsis fici W106-1]
Length=240

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDS--LTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            RV KEL +  +D   SGI  +   DS  LTHL   I GP GTPYEGG F +D+ +P+ YP
Sbjct  8    RVAKELGDIVKDNDKSGITAAATNDSGDLTHLKACIKGPPGTPYEGGNFNVDVKIPNEYP  67

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TK+WHPN+S
Sbjct  68   FRPPIMKFDTKIWHPNVS  85



>ref|XP_001242202.1| hypothetical protein CIMG_06098 [Coccidioides immitis RS]
 ref|XP_003069471.1| ubiquitin-conjugating enzyme, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER27326.1| ubiquitin-conjugating enzyme, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW23097.1| ubiquitin conjugating enzyme [Coccidioides posadasii str. Silveira]
 gb|EAS30619.3| ubiquitin conjugating enzyme [Coccidioides immitis RS]
Length=246

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP--RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KEL + + D   S + V P   GD LTHL GT  GP GTPYEGGT+++DI +P+ YP
Sbjct  8    RIAKELADIHDDSH-SQVAVEPIGGGDDLTHLKGTFQGPPGTPYEGGTYRVDIRIPNEYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP M+F TK+WHPN+S
Sbjct  67   FRPPVMRFDTKLWHPNVS  84



>ref|XP_007319170.1| hypothetical protein SERLADRAFT_469290 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN97817.1| hypothetical protein SERLA73DRAFT_182565 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO23408.1| hypothetical protein SERLADRAFT_469290 [Serpula lacrymans var. 
lacrymans S7.9]
Length=220

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+    +S  HL G+ PGP  TPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEITDCKND-KSSNIKIDLIDESPFHLKGSFPGPQDTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|KIH61984.1| ubiquitin--protein ligase [Ancylostoma duodenale]
Length=200

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   R+Q+E +E   N+++  +GI +    DSL+ + G I GP  TPY+GG+F ++I +P
Sbjct  4    IAFTRIQRECKEVVTNKEIAETGIMIEILNDSLSEIKGQIRGPPDTPYQGGSFDLEIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PPK+KF TK+WHPNIS
Sbjct  64   DTYPFTPPKIKFLTKIWHPNIS  85



>gb|EYC42200.1| hypothetical protein Y032_0540g3169 [Ancylostoma ceylanicum]
Length=200

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   R+Q+E +E   N+++  +GI +    DSL+ + G I GP  TPY+GG+F ++I +P
Sbjct  4    IAFTRIQRECKEVVTNKEIAETGIMIEILNDSLSEIKGQIRGPPDTPYQGGSFDLEIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PPK+KF TK+WHPNIS
Sbjct  64   DTYPFTPPKIKFLTKIWHPNIS  85



>ref|XP_007002050.1| hypothetical protein TREMEDRAFT_70845 [Tremella mesenterica DSM 
1558]
 gb|EIW72887.1| hypothetical protein TREMEDRAFT_70845 [Tremella mesenterica DSM 
1558]
Length=219

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++C +D + S I +    ++  HL G  PGP  TPYEGG +++DI +PD YP
Sbjct  6    LRRVQKEIRDCAKD-KTSQISLEMIDENPFHLIGAFPGPPDTPYEGGYYEVDIVVPDAYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPVKMKFITKVYHPNIS  82



>ref|XP_001217927.1| hypothetical protein ATEG_09305 [Aspergillus terreus NIH2624]
 gb|EAU30442.1| hypothetical protein ATEG_09305 [Aspergillus terreus NIH2624]
Length=246

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRG--DSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KEL + + D     I V P G  D +THL G+ PGP GTPYEGGT+++D+ +P  YP
Sbjct  8    RIAKELADIHADTHSQIIAV-PVGNDDDITHLRGSFPGPPGTPYEGGTYEVDVRIPAEYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TKVWHPNIS
Sbjct  67   FRPPVMKFITKVWHPNIS  84



>ref|XP_002844999.1| ubiquitin-protein ligase UBC1 [Arthroderma otae CBS 113480]
 gb|EEQ34144.1| ubiquitin-protein ligase UBC1 [Arthroderma otae CBS 113480]
Length=249

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KE+ + + D   S I V P   D LT L GT PGP GT YEGGTFKIDIT+P  YPF
Sbjct  8    RITKEIADIHADRH-SQISVDPVSEDDLTRLKGTFPGPPGTAYEGGTFKIDITIPTEYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF T+VWHPNIS
Sbjct  67   RPPVMKFDTRVWHPNIS  83



>ref|XP_011122559.1| hypothetical protein AOL_s00079g382 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX48743.1| hypothetical protein AOL_s00079g382 [Arthrobotrys oligospora 
ATCC 24927]
Length=241

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ KE+++  +D  +SG+      D ++HL G+  GP GTPYEGG + +DI +P+ YPF+
Sbjct  7    RIGKEMEDLRKDA-LSGMSAEAINDDISHLRGSFKGPPGTPYEGGVYHVDIKIPNEYPFK  65

Query  481  PPKMKFATKVWHPNIS  528
            PP+M+F TKVWHPN+S
Sbjct  66   PPQMRFETKVWHPNVS  81



>ref|XP_003844689.1| similar to ubiquitin conjugating enzyme [Leptosphaeria maculans 
JN3]
 emb|CBY01210.1| similar to ubiquitin conjugating enzyme [Leptosphaeria maculans 
JN3]
Length=246

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP--RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KEL + N D Q+S I V P   GD LTHL G   GP  TPYEG T+ +DI +P  YP
Sbjct  8    RIAKELADINND-QLSQIIVEPAGNGDDLTHLRGQFFGPPDTPYEGATYFVDIKIPTDYP  66

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP MKF TK+WHPN+S
Sbjct  67   FRPPNMKFETKIWHPNVS  84



>ref|XP_001799373.1| hypothetical protein SNOG_09070 [Phaeosphaeria nodorum SN15]
 gb|EAT83262.1| hypothetical protein SNOG_09070 [Phaeosphaeria nodorum SN15]
Length=247

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 3/78 (4%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP--RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+ KE+ +   D Q+S I V P   GD LTHL G   GP  TPYEGGTF++DI +P  YP
Sbjct  9    RIAKEIADIQND-QLSKIVVEPAGNGDDLTHLKGQFYGPPDTPYEGGTFQVDIKVPSEYP  67

Query  475  FEPPKMKFATKVWHPNIS  528
            F PP M+F TK+WHPN+S
Sbjct  68   FRPPVMRFETKIWHPNVS  85



>gb|KDN46991.1| putative UBC1-E2 ubiquitin-conjugating enzyme [Tilletiaria anomala 
UBC 951]
Length=232

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L R+ KE+ +C  D + SGI+V+   DS  HL GT PGP  +PYE G F +DI +P+ YP
Sbjct  6    LRRINKEIADCAND-KTSGIEVAMVDDSPFHLVGTFPGPENSPYERGMFDVDIVVPEQYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPVKMKFITKVYHPNIS  82



>ref|XP_001225086.1| hypothetical protein CHGG_07430 [Chaetomium globosum CBS 148.51]
 gb|EAQ86177.1| hypothetical protein CHGG_07430 [Chaetomium globosum CBS 148.51]
Length=240

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDS-LTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KEL + + D   SG+  +P   S LTHL GT PGP  TPY GGT++IDI +PD YPF
Sbjct  8    RIAKELADIHNDKDNSGVLANPVDPSNLTHLKGTFPGPPDTPYAGGTYQIDIVVPDMYPF  67

Query  478  EPPKMKFATKVWHPNIS  528
            + P MKF TK+WHPN+S
Sbjct  68   KSPIMKFDTKIWHPNVS  84



>ref|XP_009166937.1| hypothetical protein T265_04038 [Opisthorchis viverrini]
 gb|KER29288.1| hypothetical protein T265_04038 [Opisthorchis viverrini]
Length=199

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSG--IKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+QKEL E  R  +V+   I++ P GD + HL G I GP  TPY G  F+++I +P  YP
Sbjct  8    RIQKELAELLRSDEVAQNQIEIKPSGDDIMHLQGVINGPPDTPYNGAKFQLEIIIPSNYP  67

Query  475  FEPPKMKFATKVWHPNIS  528
            F PPK+KF T++WHPNIS
Sbjct  68   FVPPKVKFLTRIWHPNIS  85



>dbj|GAA48666.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Clonorchis sinensis]
Length=199

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSG--IKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            R+QKEL E  R  +V+   I++ P GD + HL G I GP  TPY G  F+++I +P  YP
Sbjct  8    RIQKELAELLRSDEVAQNQIEIKPSGDDIMHLQGVINGPPDTPYNGAKFQLEIIIPSNYP  67

Query  475  FEPPKMKFATKVWHPNIS  528
            F PPK+KF T++WHPNIS
Sbjct  68   FVPPKVKFLTRIWHPNIS  85



>gb|KIY52476.1| hypothetical protein FISHEDRAFT_63819 [Fistulina hepatica ATCC 
64428]
Length=227

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    +S  HL G+ PGP GTPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEILDCKND-KTSTIAIELIDESPFHLKGSFPGPEGTPYEGGHFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|KIN97703.1| hypothetical protein M404DRAFT_1005878 [Pisolithus tinctorius 
Marx 270]
Length=219

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S IK+     S  HL G+ PGP  TPYEGG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KASNIKIDLVDSSPFHLKGSFPGPKDTPYEGGVFEVDIVVPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+  KMKF TKV+HPNIS
Sbjct  64   FQAVKMKFITKVYHPNIS  81



>ref|XP_007369389.1| hypothetical protein DICSQDRAFT_149491 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF57892.1| hypothetical protein DICSQDRAFT_149491 [Dichomitus squalens LYAD-421 
SS1]
Length=220

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D Q S + +    +S  HL G+  GP GTPYEGG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKSDKQ-SSVTIDLVDESPFHLIGSFDGPEGTPYEGGRFQVDIVIPDNYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|EZF28705.1| hypothetical protein H101_07617 [Trichophyton interdigitale H6]
Length=193

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSP-RGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPF  477
            R+ KE+ + + D   S I V P   D LT L G+ PGP GT YEGGTFK+DIT+P  YPF
Sbjct  8    RITKEIADIHADRH-SQITVDPISEDDLTRLKGSFPGPPGTAYEGGTFKVDITIPTEYPF  66

Query  478  EPPKMKFATKVWHPNIS  528
             PP MKF T+VWHPNIS
Sbjct  67   RPPVMKFDTRVWHPNIS  83



>ref|XP_007735747.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Capronia epimyces CBS 606.96]
 gb|EXJ81159.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Capronia epimyces CBS 606.96]
Length=244

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ K+L +   D  VS I     GDS+T+L G+  GP GTPYEGGT+++ I +P+ YPF+
Sbjct  8    RIAKDLADIRAD-SVSQIFAETVGDSITNLRGSFKGPAGTPYEGGTYEVSINIPNEYPFK  66

Query  481  PPKMKFATKVWHPNIS  528
            PP MKF TK+WHPNIS
Sbjct  67   PPVMKFITKIWHPNIS  82



>gb|KIK24253.1| hypothetical protein PISMIDRAFT_98853 [Pisolithus microcarpus 
441]
Length=219

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I++     S  HL G+ PGP  TPY+GG F++DI +P+ YP
Sbjct  5    LRRVNKEIADCKND-KTSNIRIDLIDSSPFHLKGSFPGPKDTPYDGGVFEVDIVIPESYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  64   FQPVKMKFITKVYHPNIS  81



>ref|XP_001631613.1| predicted protein [Nematostella vectensis]
 gb|EDO39550.1| predicted protein [Nematostella vectensis]
Length=201

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQE--CNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            + + RV++E +E   + + Q SGIKV    ++ T L G I GP  TP+EGGT+ +DI +P
Sbjct  4    IAVSRVKREFREIITSEEDQKSGIKVELVDETFTKLKGEIRGPPETPFEGGTYNLDIVIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            + YPF PPK+KF TK+WHPNIS
Sbjct  64   ETYPFNPPKVKFTTKIWHPNIS  85



>gb|KIK69992.1| hypothetical protein GYMLUDRAFT_34400 [Gymnopus luxurians FD-317 
M1]
Length=219

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RV KE+ +C  D + S I +    +S  HL G+ PGP  TPY+GG F++DI +PD YP
Sbjct  5    LRRVNKEIADCKND-KTSNITLELVDNSPFHLRGSFPGPEDTPYQGGVFQVDIVIPDAYP  63

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPN+S
Sbjct  64   FQPVKMKFITKVYHPNVS  81



>gb|EMS22894.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Rhodosporidium toruloides NP11]
Length=233

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 2/76 (3%)
 Frame = +1

Query  301  RVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYPFE  480
            R+ +E Q+  +D   +G+K+   GDSL H  G+ PGP G+PYEGG F++DI  P  YPFE
Sbjct  9    RLLREFQDIQKDT--TGLKIEQVGDSLDHFVGSFPGPSGSPYEGGRFEVDIQPPPRYPFE  66

Query  481  PPKMKFATKVWHPNIS  528
            P KMKF TKV+HPNIS
Sbjct  67   PLKMKFRTKVYHPNIS  82



>ref|XP_003100903.1| CRE-UBC-20 protein [Caenorhabditis remanei]
 gb|EFP08430.1| CRE-UBC-20 protein [Caenorhabditis remanei]
Length=200

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            + L R+Q+E +E   N ++  +GI +    ++LT + G I GP  TPY GG+F +DI +P
Sbjct  4    IALNRLQRECKEVVTNSEISETGIMIEILNENLTEIRGHIRGPPDTPYAGGSFDLDIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PP +KFATK+WHPN+S
Sbjct  64   DQYPFSPPNVKFATKIWHPNVS  85



>gb|ETN72541.1| ubiquitin--protein ligase [Necator americanus]
Length=264

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +1

Query  289  VDLGRVQKELQEC--NRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLP  462
            +   R+Q+E +E   N+++  +GI +    DSL+ + G I GP  TPY+GG+F ++I +P
Sbjct  4    IAFTRIQRECKEVVTNKEIAETGIMIEILNDSLSEIKGQIRGPPDTPYQGGSFDLEIKIP  63

Query  463  DGYPFEPPKMKFATKVWHPNIS  528
            D YPF PPK+KF TK+WHPNIS
Sbjct  64   DTYPFTPPKIKFLTKIWHPNIS  85



>ref|XP_003193038.1| ubiquitin-conjugating enzyme e2-24 kDa [Cryptococcus gattii WM276]
 gb|ADV21251.1| ubiquitin-conjugating enzyme e2-24 kDa, putative [Cryptococcus 
gattii WM276]
 gb|KIR81765.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii EJB2]
 gb|KIY36664.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii E566]
 gb|KJE04465.1| ubiquitin-conjugating enzyme (huntingtin interacting protein 
2) [Cryptococcus gattii NT-10]
Length=220

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +1

Query  295  LGRVQKELQECNRDVQVSGIKVSPRGDSLTHLSGTIPGPIGTPYEGGTFKIDITLPDGYP  474
            L RVQKE+++  +D + SGI +    DS  HL G  PGP  TPYEGG +++DI +P+ YP
Sbjct  6    LRRVQKEIKDFAKD-KTSGITIEMIDDSPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYP  64

Query  475  FEPPKMKFATKVWHPNIS  528
            F+P KMKF TKV+HPNIS
Sbjct  65   FQPVKMKFITKVYHPNIS  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400