BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033N17

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096567.1|  PREDICTED: cullin-4-like                           184   9e-51   Sesamum indicum [beniseed]
ref|XP_006361548.1|  PREDICTED: cullin-4-like                           181   1e-49   Solanum tuberosum [potatoes]
ref|NP_001234356.1|  cullin 4                                           175   1e-47   
gb|KJB66936.1|  hypothetical protein B456_010G166800                    174   2e-47   Gossypium raimondii
gb|KJB66935.1|  hypothetical protein B456_010G166800                    174   3e-47   Gossypium raimondii
ref|XP_011085242.1|  PREDICTED: cullin-4                                172   2e-46   
ref|XP_007025065.1|  Cullin-4B isoform 2                                171   3e-46   
ref|XP_007025064.1|  Cullin-4B isoform 1                                171   4e-46   
ref|XP_009759464.1|  PREDICTED: cullin-4                                168   5e-45   Nicotiana sylvestris
ref|XP_009599227.1|  PREDICTED: cullin-4                                166   4e-44   Nicotiana tomentosiformis
gb|KJB69828.1|  hypothetical protein B456_011G044900                    163   2e-43   Gossypium raimondii
gb|KJB69827.1|  hypothetical protein B456_011G044900                    163   3e-43   Gossypium raimondii
gb|KHG10035.1|  Cullin-4 -like protein                                  162   7e-43   Gossypium arboreum [tree cotton]
gb|KHG21020.1|  Cullin-4 -like protein                                  161   2e-42   Gossypium arboreum [tree cotton]
ref|XP_009360892.1|  PREDICTED: cullin-4                                159   1e-41   Pyrus x bretschneideri [bai li]
gb|KJB68319.1|  hypothetical protein B456_010G238300                    158   1e-41   Gossypium raimondii
gb|EYU43260.1|  hypothetical protein MIMGU_mgv1a001310mg                158   2e-41   Erythranthe guttata [common monkey flower]
gb|KJB68318.1|  hypothetical protein B456_010G238300                    157   3e-41   Gossypium raimondii
ref|XP_006467460.1|  PREDICTED: cullin-4-like isoform X2                157   5e-41   
ref|XP_007214632.1|  hypothetical protein PRUPE_ppa001433mg             157   8e-41   Prunus persica
ref|XP_008225565.1|  PREDICTED: cullin-4                                156   1e-40   Prunus mume [ume]
ref|XP_011013417.1|  PREDICTED: cullin-4-like                           156   1e-40   Populus euphratica
gb|AAL27655.2|  putative cullin protein                                 156   1e-40   Olea europaea
gb|KJB68315.1|  hypothetical protein B456_010G238300                    154   3e-40   Gossypium raimondii
ref|XP_006467459.1|  PREDICTED: cullin-4-like isoform X1                155   4e-40   Citrus sinensis [apfelsine]
ref|XP_006449702.1|  hypothetical protein CICLE_v10014310mg             154   4e-40   Citrus clementina [clementine]
gb|KDO78190.1|  hypothetical protein CISIN_1g003648mg                   154   4e-40   Citrus sinensis [apfelsine]
ref|XP_006449703.1|  hypothetical protein CICLE_v10014310mg             154   4e-40   
gb|KDO78192.1|  hypothetical protein CISIN_1g003648mg                   154   4e-40   Citrus sinensis [apfelsine]
gb|KDO78191.1|  hypothetical protein CISIN_1g003648mg                   154   4e-40   Citrus sinensis [apfelsine]
ref|XP_006377605.1|  hypothetical protein POPTR_0011s08280g             152   3e-39   
ref|XP_006377604.1|  hypothetical protein POPTR_0011s08280g             152   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008349190.1|  PREDICTED: cullin-4-like                           150   4e-39   
gb|KGN65538.1|  hypothetical protein Csa_1G435830                       144   2e-38   Cucumis sativus [cucumbers]
ref|XP_011011309.1|  PREDICTED: cullin-4-like isoform X2                146   1e-37   Populus euphratica
ref|XP_006352972.1|  PREDICTED: cullin-4-like                           147   2e-37   Solanum tuberosum [potatoes]
gb|KDP37982.1|  hypothetical protein JCGZ_04625                         147   2e-37   Jatropha curcas
ref|XP_011011308.1|  PREDICTED: cullin-4-like isoform X1                147   2e-37   Populus euphratica
gb|EPS64061.1|  cullin 4                                                145   4e-37   Genlisea aurea
ref|XP_002305340.2|  hypothetical protein POPTR_0004s14020g             146   6e-37   Populus trichocarpa [western balsam poplar]
ref|XP_008371761.1|  PREDICTED: cullin-4                                145   7e-37   
ref|XP_004149667.1|  PREDICTED: cullin-4-like                           144   3e-36   Cucumis sativus [cucumbers]
ref|XP_004162809.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      144   3e-36   
ref|XP_002270764.2|  PREDICTED: cullin-4                                143   4e-36   Vitis vinifera
ref|XP_002519675.1|  cullin, putative                                   142   1e-35   
ref|XP_008444359.1|  PREDICTED: cullin-4                                141   3e-35   Cucumis melo [Oriental melon]
emb|CAN75926.1|  hypothetical protein VITISV_010491                     140   4e-35   Vitis vinifera
emb|CBI30911.3|  unnamed protein product                                140   6e-35   Vitis vinifera
ref|XP_010274939.1|  PREDICTED: cullin-4-like                           139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010247871.1|  PREDICTED: cullin-4-like isoform X2                139   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010247870.1|  PREDICTED: cullin-4-like isoform X1                139   2e-34   Nelumbo nucifera [Indian lotus]
gb|KCW73811.1|  hypothetical protein EUGRSUZ_E02414                     138   2e-34   Eucalyptus grandis [rose gum]
gb|KCW73810.1|  hypothetical protein EUGRSUZ_E02414                     138   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010056896.1|  PREDICTED: cullin-4                                138   3e-34   Eucalyptus grandis [rose gum]
ref|XP_009408525.1|  PREDICTED: cullin-4-like                           137   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787803.1|  PREDICTED: cullin-4-like isoform X1                135   3e-33   Phoenix dactylifera
ref|XP_008787804.1|  PREDICTED: cullin-4-like isoform X2                135   3e-33   Phoenix dactylifera
ref|XP_010110959.1|  hypothetical protein L484_021653                   135   4e-33   
ref|XP_009398338.1|  PREDICTED: cullin-4-like                           135   5e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11994.1|  Cullin-4 -like protein                                  132   1e-32   Gossypium arboreum [tree cotton]
ref|XP_010666663.1|  PREDICTED: cullin-4                                133   2e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN06973.1|  Cullin-4                                                133   2e-32   Glycine soja [wild soybean]
ref|XP_010941311.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      132   3e-32   Elaeis guineensis
ref|XP_004233125.1|  PREDICTED: cullin-4                                132   5e-32   Solanum lycopersicum
ref|XP_010923713.1|  PREDICTED: cullin-4-like isoform X2                132   6e-32   Elaeis guineensis
ref|XP_010923712.1|  PREDICTED: cullin-4-like isoform X1                132   7e-32   Elaeis guineensis
gb|KHN47328.1|  Cullin-4                                                126   6e-30   Glycine soja [wild soybean]
ref|XP_003546083.1|  PREDICTED: cullin-4-like                           124   3e-29   Glycine max [soybeans]
ref|XP_008809585.1|  PREDICTED: cullin-4-like                           123   6e-29   
ref|XP_007147910.1|  hypothetical protein PHAVU_006G165300g             119   2e-27   Phaseolus vulgaris [French bean]
ref|XP_003593913.1|  Cullin                                             118   2e-27   
ref|XP_003593911.1|  Cullin                                             118   3e-27   
ref|XP_003593912.1|  Cullin                                             118   3e-27   Medicago truncatula
ref|XP_004981509.1|  PREDICTED: cullin-4-like isoform X1                116   2e-26   
ref|XP_004981510.1|  PREDICTED: cullin-4-like isoform X2                116   2e-26   Setaria italica
ref|XP_003524860.1|  PREDICTED: cullin-4-like                           115   2e-26   Glycine max [soybeans]
ref|XP_009101534.1|  PREDICTED: cullin-4-like                           115   2e-26   Brassica rapa
ref|XP_006414121.1|  hypothetical protein EUTSA_v10024458mg             114   5e-26   Eutrema salsugineum [saltwater cress]
gb|KHN12460.1|  Cullin-4                                                114   8e-26   Glycine soja [wild soybean]
emb|CDX77644.1|  BnaC07g18980D                                          114   9e-26   
ref|XP_006398310.1|  hypothetical protein EUTSA_v10000782mg             111   2e-25   
ref|XP_008383554.1|  PREDICTED: cullin-4-like                           110   2e-25   
ref|XP_006398309.1|  hypothetical protein EUTSA_v10000782mg             111   3e-25   
ref|XP_004486019.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like      112   3e-25   Cicer arietinum [garbanzo]
ref|XP_006585082.1|  PREDICTED: cullin-4-like isoform X2                111   6e-25   Glycine max [soybeans]
ref|XP_003532695.2|  PREDICTED: cullin-4-like isoform X1                111   7e-25   Glycine max [soybeans]
ref|XP_006398308.1|  hypothetical protein EUTSA_v10000782mg             111   7e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006836434.1|  hypothetical protein AMTR_s00092p00163840          111   1e-24   Amborella trichopoda
emb|CDY33461.1|  BnaA06g36120D                                          110   1e-24   Brassica napus [oilseed rape]
emb|CDY35152.1|  BnaA09g17890D                                          110   1e-24   Brassica napus [oilseed rape]
ref|NP_568658.1|  cullin4                                               110   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650698.1|  PREDICTED: cullin-4-like                           109   5e-24   Oryza brachyantha
gb|EMT18857.1|  Cullin-4B                                               108   6e-24   
ref|XP_002863417.1|  hypothetical protein ARALYDRAFT_916814             108   6e-24   Arabidopsis lyrata subsp. lyrata
gb|AAM14063.1|  putative cullin                                         108   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114369.1|  PREDICTED: cullin-4-like                           107   2e-23   Brassica rapa
dbj|BAK02870.1|  predicted protein                                      107   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010529158.1|  PREDICTED: cullin-4                                107   2e-23   Tarenaya hassleriana [spider flower]
emb|CDY03235.1|  BnaC09g19210D                                          106   4e-23   
ref|XP_002466340.1|  hypothetical protein SORBIDRAFT_01g005920          106   5e-23   Sorghum bicolor [broomcorn]
ref|XP_003558082.1|  PREDICTED: cullin-4                                106   6e-23   Brachypodium distachyon [annual false brome]
emb|CDY43957.1|  BnaA02g24350D                                          105   7e-23   Brassica napus [oilseed rape]
gb|KHN46079.1|  Cullin-4                                                105   1e-22   Glycine soja [wild soybean]
ref|XP_008644442.1|  PREDICTED: cullin-4                                104   2e-22   Zea mays [maize]
tpg|DAA51790.1|  TPA: hypothetical protein ZEAMMB73_453479              102   6e-22   
gb|KFK31486.1|  cullin                                                  103   6e-22   Arabis alpina [alpine rockcress]
ref|XP_009128848.1|  PREDICTED: cullin-4                                102   8e-22   Brassica rapa
ref|XP_010495750.1|  PREDICTED: cullin-4-like                           102   1e-21   Camelina sativa [gold-of-pleasure]
emb|CDX87735.1|  BnaC02g32140D                                          102   1e-21   
ref|XP_010484784.1|  PREDICTED: cullin-4-like                           102   1e-21   Camelina sativa [gold-of-pleasure]
gb|KFK28509.1|  cullin 4                                                102   1e-21   Arabis alpina [alpine rockcress]
gb|EEE60060.1|  hypothetical protein OsJ_12866                          102   1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AAT75245.1|  putative cullin protein                                 101   2e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76292.1|  hypothetical protein OsI_13805                          101   2e-21   Oryza sativa Indica Group [Indian rice]
gb|ABF99238.1|  Cullin-4B, putative, expressed                          101   3e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KHN29857.1|  Cullin-4                                              97.4    4e-21   Glycine soja [wild soybean]
emb|CAC85265.1|  cullin 4                                               100   5e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281916.1|  hypothetical protein CARUB_v10028121mg             100   5e-21   Capsella rubella
ref|XP_010441611.1|  PREDICTED: cullin-4                                100   5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010518764.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4-like    99.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_011460204.1|  PREDICTED: cullin-4                              99.0    2e-20   Fragaria vesca subsp. vesca
ref|XP_001764780.1|  predicted protein                                95.9    2e-19   
ref|XP_002984123.1|  ubiquitin-protein ligase, cullin 4               92.4    3e-18   
ref|XP_002972211.1|  ubiquitin-protein ligase, Cullin 4               92.4    3e-18   
ref|XP_001776334.1|  predicted protein                                92.0    4e-18   
tpg|DAA51791.1|  TPA: hypothetical protein ZEAMMB73_453479            87.0    1e-16   
gb|ACA52121.1|  cullin 4                                              75.5    8e-14   Vitis vinifera
gb|KIZ03018.1|  cullin 4                                              69.3    1e-10   Monoraphidium neglectum
ref|XP_002947918.1|  hypothetical protein VOLCADRAFT_57881            67.4    7e-10   Volvox carteri f. nagariensis
ref|XP_001703219.1|  cullin                                           63.9    1e-08   Chlamydomonas reinhardtii
ref|XP_005825979.1|  hypothetical protein GUITHDRAFT_160035           63.5    1e-08   Guillardia theta CCMP2712
emb|CBJ49182.1|  conserved unknown protein                            63.2    2e-08   Ectocarpus siliculosus
gb|ESA04652.1|  hypothetical protein GLOINDRAFT_85233                 62.8    2e-08   
ref|XP_005644988.1|  Cullin-domain-containing protein                 62.0    4e-08   Coccomyxa subellipsoidea C-169
ref|XP_002504743.1|  predicted protein                                60.5    1e-07   Micromonas commoda
ref|XP_003729103.1|  PREDICTED: cullin-4A-like                        59.7    3e-07   
gb|ERL94806.1|  hypothetical protein D910_12080                       58.5    5e-07   Dendroctonus ponderosae
gb|ENN80292.1|  hypothetical protein YQE_03285                        58.5    6e-07   Dendroctonus ponderosae
gb|EWM25493.1|  ubiquitin-protein cullin 4                            57.8    1e-06   Nannochloropsis gaditana
gb|ACE75802.1|  cullin-4A (predicted)                                 57.8    1e-06   Sorex araneus [Eurasian shrew]
ref|XP_001656862.1|  AAEL003466-PB                                    57.4    1e-06   Aedes aegypti
ref|XP_006823839.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like   57.0    2e-06   Saccoglossus kowalevskii
ref|XP_001870810.1|  cullin                                           55.8    4e-06   Culex quinquefasciatus
ref|XP_006677802.1|  hypothetical protein BATDEDRAFT_19177            55.1    6e-06   Batrachochytrium dendrobatidis JAM81
ref|XP_001360920.1|  GA21273                                          55.1    7e-06   Drosophila pseudoobscura pseudoobscura
ref|XP_001961024.1|  GF11213                                          55.1    7e-06   Drosophila ananassae
ref|XP_009534475.1|  hypothetical protein PHYSODRAFT_361833           55.1    8e-06   Phytophthora sojae
ref|XP_005176013.1|  PREDICTED: cullin-4A                             54.7    9e-06   Musca domestica
ref|XP_003800032.1|  PREDICTED: cullin-4A                             54.7    9e-06   Otolemur garnettii
ref|XP_001987405.1|  GH19988                                          54.7    9e-06   Drosophila grimshawi
ref|XP_004537530.1|  PREDICTED: cullin-4B-like                        54.3    1e-05   Ceratitis capitata [medfly]
ref|XP_002005082.1|  GI20275                                          54.3    1e-05   Drosophila mojavensis
gb|EHJ64739.1|  putative cullin 4B                                    54.3    1e-05   
ref|XP_002050396.1|  GJ20228                                          54.3    2e-05   Drosophila virilis
ref|XP_008909273.1|  hypothetical protein PPTG_14065                  53.9    2e-05   Phytophthora parasitica INRA-310
gb|ETP38764.1|  hypothetical protein F442_13690                       53.9    2e-05   Phytophthora parasitica P10297
gb|ETK80929.1|  hypothetical protein L915_13497                       53.9    2e-05   Phytophthora parasitica
ref|XP_004923897.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like   53.9    2e-05   
gb|ETM40851.1|  hypothetical protein L914_13297                       53.9    2e-05   Phytophthora parasitica
gb|ACG69447.2|  cullin 4A isoform 1 (predicted)                       53.9    2e-05   Otolemur garnettii
ref|XP_001814199.1|  PREDICTED: cullin-4A                             53.9    2e-05   Tribolium castaneum [rust-red flour beetle]
gb|ELT94808.1|  hypothetical protein CAPTEDRAFT_227595                53.5    2e-05   Capitella teleta
gb|ETN61630.1|  cullin                                                53.5    2e-05   Anopheles darlingi [American malaria mosquito]
gb|EKC31501.1|  Cullin-4A                                             53.1    3e-05   Crassostrea gigas
ref|XP_001638137.1|  predicted protein                                52.4    3e-05   Nematostella vectensis
ref|XP_001970515.1|  GG10678                                          53.1    3e-05   Drosophila erecta
ref|NP_610352.2|  cullin 4, isoform A                                 53.1    3e-05   Drosophila melanogaster
ref|XP_003690323.1|  PREDICTED: cullin-4B-like                        53.1    3e-05   Apis florea [dwarf honeybee]
ref|XP_003397436.1|  PREDICTED: cullin-4B-like                        53.1    3e-05   Bombus terrestris [large earth bumblebee]
ref|XP_392800.3|  PREDICTED: cullin-4B-like                           53.1    3e-05   Apis mellifera [bee]
gb|EGI59840.1|  Cullin-4B                                             53.1    3e-05   Acromyrmex echinatior
ref|XP_002089579.1|  GE23323                                          53.1    3e-05   Drosophila yakuba
ref|XP_011063503.1|  PREDICTED: cullin-4A                             53.1    3e-05   Acromyrmex echinatior
ref|XP_003707650.1|  PREDICTED: cullin-4B-like                        53.1    3e-05   Megachile rotundata
ref|XP_008171287.1|  PREDICTED: cullin-4B isoform X2                  53.1    3e-05   Chrysemys picta bellii
ref|XP_011440066.1|  PREDICTED: cullin-4A-like                        52.8    3e-05   
emb|CDQ76383.1|  unnamed protein product                              50.1    3e-05   Oncorhynchus mykiss
ref|XP_002032862.1|  GM20725                                          52.8    4e-05   Drosophila sechellia
gb|EFZ12693.1|  hypothetical protein SINV_14510                       52.8    4e-05   
ref|XP_010139394.1|  PREDICTED: cullin-4B                             52.8    4e-05   Buceros rhinoceros silvestris
gb|KFO92809.1|  Cullin-4B                                             52.8    4e-05   Buceros rhinoceros silvestris
ref|XP_003445252.1|  PREDICTED: cullin-4B                             52.8    4e-05   Oreochromis niloticus
gb|KFV68186.1|  Cullin-4B                                             52.8    4e-05   Picoides pubescens
ref|XP_004545810.1|  PREDICTED: cullin-4B-like                        52.8    4e-05   
ref|XP_009899852.1|  PREDICTED: cullin-4B                             52.8    4e-05   Picoides pubescens
ref|XP_005913219.1|  PREDICTED: cullin-4B-like                        52.8    4e-05   Haplochromis burtoni
ref|XP_011168244.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        52.8    4e-05   
ref|XP_011351411.1|  PREDICTED: cullin-4A                             52.8    4e-05   Ooceraea biroi
ref|XP_011258663.1|  PREDICTED: cullin-4A                             52.8    5e-05   
gb|EFA11597.1|  DNA methyltransferase 1                               52.8    5e-05   
ref|XP_010287736.1|  PREDICTED: cullin-4B                             52.8    5e-05   Phaethon lepturus
ref|XP_009073198.1|  PREDICTED: cullin-4B                             52.8    5e-05   Acanthisitta chloris
gb|KFQ77299.1|  Cullin-4B                                             52.8    5e-05   Phaethon lepturus
ref|XP_005432498.1|  PREDICTED: cullin-4B                             52.8    5e-05   Falco cherrug
ref|XP_003208504.1|  PREDICTED: cullin-4B                             52.8    5e-05   Meleagris gallopavo [common turkey]
ref|XP_005022179.1|  PREDICTED: cullin-4B                             52.8    5e-05   
ref|XP_009968477.1|  PREDICTED: cullin-4B                             52.8    5e-05   Tyto alba [Schleiereule]
ref|XP_010020149.1|  PREDICTED: cullin-4B                             52.8    5e-05   Nestor notabilis
ref|XP_009915406.1|  PREDICTED: cullin-4B isoform X1                  52.8    5e-05   Haliaeetus albicilla
ref|XP_009871272.1|  PREDICTED: cullin-4B                             52.8    5e-05   Apaloderma vittatum
ref|XP_009578947.1|  PREDICTED: cullin-4B                             52.8    5e-05   Fulmarus glacialis
ref|XP_009487693.1|  PREDICTED: cullin-4B                             52.8    5e-05   Pelecanus crispus
ref|XP_009273579.1|  PREDICTED: cullin-4B                             52.8    5e-05   Aptenodytes forsteri
gb|KFQ89647.1|  Cullin-4B                                             52.8    5e-05   Phoenicopterus ruber ruber
gb|KFQ64788.1|  Cullin-4B                                             52.8    5e-05   Pelecanus crispus
gb|KFQ56289.1|  Cullin-4B                                             52.8    5e-05   Nestor notabilis
gb|KFP38487.1|  Cullin-4B                                             52.8    5e-05   Chlamydotis macqueenii
gb|KFO06527.1|  Cullin-4B                                             52.8    5e-05   Balearica regulorum gibbericeps
ref|XP_005045907.1|  PREDICTED: cullin-4B                             52.8    5e-05   Ficedula albicollis
ref|XP_011311356.1|  PREDICTED: cullin-4A                             52.8    5e-05   Fopius arisanus
ref|XP_010150094.1|  PREDICTED: cullin-4B                             52.8    5e-05   Eurypyga helias
ref|XP_009564621.1|  PREDICTED: cullin-4B                             52.8    5e-05   Cuculus canorus
gb|KFZ62825.1|  Cullin-4B                                             52.8    5e-05   Podiceps cristatus
gb|KFV93759.1|  Cullin-4B                                             52.8    5e-05   Fulmarus glacialis
gb|KFQ02433.1|  Cullin-4B                                             52.8    5e-05   Haliaeetus albicilla
gb|KFP90614.1|  Cullin-4B                                             52.8    5e-05   Apaloderma vittatum
gb|KFP57528.1|  Cullin-4B                                             52.8    5e-05   Cathartes aura
gb|KFM04851.1|  Cullin-4B                                             52.8    5e-05   Aptenodytes forsteri
ref|XP_010162624.1|  PREDICTED: cullin-4B                             52.8    5e-05   Antrostomus carolinensis
gb|KFZ46418.1|  Cullin-4B                                             52.8    5e-05   Antrostomus carolinensis
gb|KFV04835.1|  Cullin-4B                                             52.8    5e-05   Tauraco erythrolophus
ref|XP_009887578.1|  PREDICTED: cullin-4B                             52.8    5e-05   Charadrius vociferus
gb|KFW86599.1|  Cullin-4B                                             52.8    5e-05   Manacus vitellinus
ref|XP_005504485.1|  PREDICTED: cullin-4B                             52.8    5e-05   Columba livia [carrier pigeon]
ref|XP_005484500.1|  PREDICTED: cullin-4B                             52.8    5e-05   Zonotrichia albicollis
ref|XP_005148357.1|  PREDICTED: cullin-4B                             52.8    5e-05   
ref|XP_009981623.1|  PREDICTED: cullin-4B                             52.8    5e-05   Tauraco erythrolophus
ref|XP_009943501.1|  PREDICTED: cullin-4B                             52.8    5e-05   Opisthocomus hoazin [hoatzin]
gb|KFV55551.1|  Cullin-4B                                             52.8    5e-05   Tyto alba [Schleiereule]
ref|XP_002196531.1|  PREDICTED: cullin-4B                             52.8    5e-05   Taeniopygia guttata
gb|KFU89258.1|  Cullin-4B                                             52.8    5e-05   Chaetura pelagica
gb|KGL96725.1|  Cullin-4B                                             52.8    5e-05   Charadrius vociferus
ref|XP_011146247.1|  PREDICTED: cullin-4A                             52.8    5e-05   Harpegnathos saltator
gb|KFR04226.1|  Cullin-4B                                             52.8    5e-05   Opisthocomus hoazin [hoatzin]
gb|KFP13940.1|  Cullin-4B                                             52.8    5e-05   Egretta garzetta
ref|XP_002433105.1|  Cullin-4A, putative                              52.4    5e-05   Pediculus humanus corporis [human body lice]
gb|KFW05399.1|  Cullin-4B                                             52.8    5e-05   Eurypyga helias
ref|XP_009088610.1|  PREDICTED: cullin-4B                             52.8    5e-05   Serinus canaria [canary]
ref|XP_009995422.1|  PREDICTED: cullin-4B                             52.8    5e-05   Chaetura pelagica
ref|XP_005241130.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        52.4    5e-05   Falco peregrinus [peregrine]
ref|XP_010206238.1|  PREDICTED: cullin-4B                             52.4    5e-05   Colius striatus
ref|XP_005438905.1|  PREDICTED: cullin-4A                             52.4    5e-05   
ref|XP_007060188.1|  PREDICTED: cullin-4B                             52.4    5e-05   Chelonia mydas [green seaturtle]
gb|EMC88699.1|  Cullin-4B                                             52.4    5e-05   
gb|KFP80278.1|  Cullin-4B                                             52.4    5e-05   Acanthisitta chloris
ref|XP_002170287.2|  PREDICTED: cullin-4B-like                        52.4    5e-05   
gb|EFN66773.1|  Cullin-4B                                             52.4    5e-05   Camponotus floridanus
ref|XP_011420105.1|  PREDICTED: cullin-4A-like                        52.4    5e-05   Crassostrea gigas
gb|KFO64284.1|  Cullin-4B                                             52.4    5e-05   Corvus brachyrhynchos
gb|KFP00724.1|  Cullin-4B                                             52.4    5e-05   Calypte anna
ref|XP_009670270.1|  PREDICTED: cullin-4B                             52.4    5e-05   Struthio camelus australis
ref|XP_006260081.1|  PREDICTED: cullin-4B                             52.4    5e-05   
ref|XP_006028559.1|  PREDICTED: cullin-4B                             52.4    5e-05   Alligator sinensis
ref|XP_007436244.1|  PREDICTED: cullin-4B                             52.4    5e-05   Python bivittatus
ref|XP_005307468.2|  PREDICTED: cullin-4B isoform X1                  52.4    5e-05   Chrysemys picta bellii
ref|XP_008638702.1|  PREDICTED: cullin-4B                             52.4    5e-05   Corvus brachyrhynchos
ref|XP_008491853.1|  PREDICTED: cullin-4B                             52.4    5e-05   Calypte anna
gb|KJE89856.1|  Cullin 4                                              52.4    6e-05   Capsaspora owczarzaki ATCC 30864
ref|XP_002998367.1|  Cullin family protein, putative                  52.4    6e-05   Phytophthora infestans T30-4
ref|XP_006115461.1|  PREDICTED: cullin-4B                             52.4    6e-05   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010210224.1|  PREDICTED: cullin-4B                             52.4    6e-05   Tinamus guttatus
gb|EPZ30829.1|  Cullin 4-like protein                                 52.4    6e-05   Rozella allomycis CSF55
ref|XP_004349795.2|  Cullin 4                                         52.4    6e-05   Capsaspora owczarzaki ATCC 30864
gb|KFV79701.1|  Cullin-4B                                             52.4    6e-05   Struthio camelus australis
ref|XP_003064653.1|  predicted protein                                52.4    6e-05   Micromonas pusilla CCMP1545
dbj|BAC41443.3|  mKIAA0695 protein                                    52.4    6e-05   Mus musculus [mouse]
ref|XP_006803308.1|  PREDICTED: cullin-4B-like                        52.0    6e-05   Neolamprologus brichardi [lyretail cichlid]
gb|KGL72508.1|  Cullin-4B                                             52.4    6e-05   Tinamus guttatus
ref|XP_002074597.1|  GK23161                                          52.4    6e-05   Drosophila willistoni
gb|EKC23794.1|  Cullin-4A                                             52.0    7e-05   Crassostrea gigas
ref|XP_011208828.1|  PREDICTED: cullin-4A                             52.0    7e-05   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011478226.1|  PREDICTED: cullin-4B                             52.0    8e-05   Oryzias latipes [Japanese rice fish]
ref|XP_003970600.1|  PREDICTED: cullin-4B-like                        51.6    9e-05   Takifugu rubripes [tiger puffer]
ref|XP_010764721.1|  PREDICTED: cullin-4B                             51.6    9e-05   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005687851.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        51.6    9e-05   
ref|XP_010730305.1|  PREDICTED: cullin-4B                             51.6    9e-05   
ref|XP_008555895.1|  PREDICTED: cullin-4A                             51.6    9e-05   Microplitis demolitor
ref|XP_001603521.1|  PREDICTED: cullin-4A                             51.6    1e-04   Nasonia vitripennis
ref|XP_875362.3|  PREDICTED: cullin-4A                                51.6    1e-04   
ref|XP_006076682.1|  PREDICTED: cullin-4A                             51.6    1e-04   
ref|XP_010829841.1|  PREDICTED: cullin-4A                             51.6    1e-04   
tpg|DAA23688.1|  TPA: cullin 4A                                       51.6    1e-04   
ref|XP_005969110.1|  PREDICTED: cullin-4A                             51.6    1e-04   
ref|XP_010981119.1|  PREDICTED: cullin-4A                             51.6    1e-04   
ref|XP_005799582.1|  PREDICTED: cullin-4B-like                        51.6    1e-04   
ref|XP_005902314.1|  PREDICTED: cullin-4A                             51.6    1e-04   
ref|XP_011504999.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A-like   51.6    1e-04   
ref|XP_011177899.1|  PREDICTED: cullin-4A                             51.6    1e-04   
dbj|BAB28222.2|  unnamed protein product                              51.6    1e-04   
ref|XP_008274104.1|  PREDICTED: cullin-4B                             51.2    1e-04   
ref|XP_008418856.1|  PREDICTED: cullin-4B                             51.2    1e-04   
ref|XP_003131149.1|  PREDICTED: cullin-4A                             51.2    1e-04   
ref|XP_007569758.1|  PREDICTED: cullin-4B                             51.2    1e-04   
emb|CAG08361.1|  unnamed protein product                              51.2    1e-04   
ref|XP_006218259.1|  PREDICTED: cullin-4A                             51.2    1e-04   
ref|XP_010950632.1|  PREDICTED: cullin-4A                             51.2    1e-04   
ref|XP_004012417.1|  PREDICTED: cullin-4A                             51.2    1e-04   
ref|XP_010894682.1|  PREDICTED: cullin-4B isoform X3                  51.2    1e-04   
ref|XP_004713105.1|  PREDICTED: cullin-4B isoform X2                  51.2    1e-04   
ref|XP_004713104.1|  PREDICTED: cullin-4B isoform X1                  51.2    1e-04   
ref|XP_006632966.1|  PREDICTED: cullin-4B-like                        51.2    1e-04   
gb|KFQ18028.1|  Cullin-4B                                             51.2    1e-04   
ref|XP_008935860.1|  PREDICTED: cullin-4B                             51.2    1e-04   
dbj|BAC27992.1|  unnamed protein product                              51.2    1e-04   
ref|XP_006883869.1|  PREDICTED: cullin-4A                             51.2    1e-04   
dbj|BAE36141.1|  unnamed protein product                              51.2    1e-04   
ref|NP_001103612.1|  cullin-4B                                        51.2    1e-04   
dbj|BAB64445.1|  hypothetical protein                                 50.8    2e-04   
emb|CDQ70188.1|  unnamed protein product                              51.2    2e-04   
ref|NP_001116316.1|  cullin-4B                                        50.8    2e-04   
ref|NP_001133455.1|  cullin-4B                                        50.8    2e-04   
ref|XP_007537520.1|  PREDICTED: cullin-4A                             50.8    2e-04   
ref|XP_005094691.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like   50.8    2e-04   
ref|XP_009011915.1|  hypothetical protein HELRODRAFT_185316           50.8    2e-04   
ref|XP_009556241.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        50.8    2e-04   
ref|XP_008324704.1|  PREDICTED: cullin-4B                             50.4    2e-04   
gb|KFM58690.1|  Cullin-4B                                             48.9    2e-04   
ref|XP_003797087.1|  PREDICTED: cullin-4B-like                        50.4    2e-04   
ref|XP_006981365.1|  PREDICTED: cullin-4A                             50.4    2e-04   
ref|XP_008479487.1|  PREDICTED: cullin-4B                             50.4    2e-04   
ref|XP_004704475.1|  PREDICTED: cullin-4A                             50.4    2e-04   
ref|XP_007940575.1|  PREDICTED: cullin-4A                             50.4    3e-04   
ref|XP_005767862.1|  hypothetical protein EMIHUDRAFT_427672           50.4    3e-04   
ref|XP_004273640.1|  PREDICTED: cullin-4A                             50.4    3e-04   
ref|XP_007466424.1|  PREDICTED: cullin-4A                             50.4    3e-04   
ref|XP_005782887.1|  hypothetical protein EMIHUDRAFT_468368           50.1    3e-04   
ref|XP_004450824.1|  PREDICTED: cullin-4A                             50.1    3e-04   
ref|XP_005374279.1|  PREDICTED: cullin-4A                             50.1    3e-04   
ref|XP_004383008.1|  PREDICTED: cullin-4A                             50.1    3e-04   
ref|XP_004631217.1|  PREDICTED: cullin-4A                             50.1    3e-04   
gb|KFW96883.1|  Cullin-4B                                             50.1    4e-04   
ref|XP_008154342.1|  PREDICTED: cullin-4B isoform X2                  50.1    4e-04   
ref|XP_004022403.1|  PREDICTED: cullin-4B isoform 2                   50.1    4e-04   
ref|XP_007530425.1|  PREDICTED: cullin-4B isoform X2                  50.1    4e-04   
ref|XP_006877535.1|  PREDICTED: cullin-4B isoform X2                  50.1    4e-04   
ref|XP_006885131.1|  PREDICTED: cullin-4B-like isoform X2             50.1    4e-04   
ref|XP_005319407.1|  PREDICTED: cullin-4B isoform X2                  50.1    4e-04   
ref|XP_004685824.1|  PREDICTED: cullin-4B isoform X2                  50.1    4e-04   
ref|XP_004713106.1|  PREDICTED: cullin-4B isoform X3                  50.1    4e-04   
ref|XP_004379638.1|  PREDICTED: cullin-4B isoform 2                   50.1    4e-04   
ref|XP_004285635.1|  PREDICTED: cullin-4B isoform 2                   50.1    4e-04   
gb|EAX11877.1|  cullin 4B, isoform CRA_b                              50.1    4e-04   
ref|XP_009506519.1|  PREDICTED: cullin-4B                             50.1    4e-04   
ref|XP_009196472.1|  PREDICTED: cullin-4B isoform X5                  50.1    4e-04   
pdb|4A0L|E  Chain E, Structure Of Ddb1-Ddb2-Cul4b-Rbx1 Bound To A...  50.1    4e-04   
ref|XP_008988097.1|  PREDICTED: cullin-4B isoform X5                  50.1    4e-04   
pdb|4A0C|C  Chain C, Structure Of The Cand1-Cul4b-Rbx1 Complex        50.1    4e-04   
ref|XP_004423239.1|  PREDICTED: cullin-4A                             50.1    4e-04   
ref|XP_001510185.3|  PREDICTED: cullin-4B                             50.1    4e-04   
ref|XP_849542.3|  PREDICTED: cullin-4A                                49.7    4e-04   
ref|XP_007507207.1|  PREDICTED: cullin-4B isoform X4                  50.1    4e-04   
ref|XP_002930544.1|  PREDICTED: cullin-4A isoform X1                  49.7    4e-04   
gb|EFB23437.1|  hypothetical protein PANDA_021021                     49.7    4e-04   
ref|XP_007507206.1|  PREDICTED: cullin-4B isoform X3                  50.1    4e-04   
ref|XP_008683174.1|  PREDICTED: cullin-4A                             49.7    4e-04   
ref|XP_007507205.1|  PREDICTED: cullin-4B isoform X2                  49.7    4e-04   
ref|XP_006909411.1|  PREDICTED: cullin-4A                             49.7    4e-04   
ref|XP_010819678.1|  PREDICTED: cullin-4B isoform X5                  49.7    4e-04   
ref|XP_008271384.1|  PREDICTED: cullin-4B isoform X5                  49.7    4e-04   
gb|ELK07572.1|  Cullin-4B                                             49.7    4e-04   
ref|XP_007507204.1|  PREDICTED: cullin-4B isoform X1                  49.7    4e-04   
ref|XP_007254497.1|  PREDICTED: cullin-4B-like                        49.7    4e-04   
ref|XP_006191373.1|  PREDICTED: cullin-4B-like isoform X2             49.7    4e-04   
dbj|BAA31670.2|  KIAA0695 protein                                     49.7    4e-04   
ref|XP_011376545.1|  PREDICTED: cullin-4B isoform X2                  49.7    4e-04   
gb|AAK16812.1|AF212995_1  cullin CUL4B                                49.7    4e-04   
ref|XP_006191372.1|  PREDICTED: cullin-4B-like isoform X1             49.7    4e-04   
ref|NP_001041617.1|  cullin-4B                                        49.7    4e-04   
gb|ELK14877.1|  Cullin-4A                                             49.7    4e-04   
gb|ERE90280.1|  cullin-4A                                             49.7    4e-04   
ref|XP_003229259.1|  PREDICTED: cullin-4B                             49.7    4e-04   
ref|XP_005413716.1|  PREDICTED: cullin-4B isoform X4                  49.7    4e-04   
ref|XP_005790994.1|  hypothetical protein EMIHUDRAFT_224320           49.3    4e-04   
gb|EGW01006.1|  Cullin-4B                                             49.7    4e-04   
ref|XP_004325971.1|  PREDICTED: cullin-4A-like                        49.7    4e-04   
gb|EPB90727.1|  hypothetical protein HMPREF1544_02472                 49.7    5e-04   
ref|XP_420335.2|  PREDICTED: cullin-4B                                49.7    5e-04   
ref|XP_005366325.1|  PREDICTED: cullin-4A                             49.7    5e-04   
ref|XP_007642800.1|  PREDICTED: cullin-4A isoform X1                  49.7    5e-04   
ref|XP_007630482.1|  PREDICTED: cullin-4A isoform X2                  49.7    5e-04   
gb|ERE90278.1|  cullin-4A                                             49.7    5e-04   
ref|XP_008846647.1|  PREDICTED: cullin-4A                             49.3    5e-04   
ref|XP_005673908.1|  PREDICTED: cullin-4B-like                        49.3    5e-04   
ref|XP_005884540.1|  PREDICTED: cullin-4A                             49.3    5e-04   
gb|ELK26001.1|  Cullin-4A                                             49.3    5e-04   
ref|XP_006102095.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4A        49.3    5e-04   
ref|XP_008142137.1|  PREDICTED: cullin-4A                             49.3    5e-04   
ref|XP_004746221.1|  PREDICTED: cullin-4A                             49.3    5e-04   
ref|XP_003774810.1|  PREDICTED: cullin-4B                             49.3    5e-04   
ref|XP_006769372.1|  PREDICTED: cullin-4A                             49.3    5e-04   
ref|XP_005007188.1|  PREDICTED: cullin-4A isoform X2                  49.3    5e-04   
gb|KFV08408.1|  Cullin-4B                                             49.3    5e-04   
ref|XP_010073509.1|  PREDICTED: cullin-4B                             49.3    5e-04   
ref|NP_666319.2|  cullin-4A                                           49.3    5e-04   
dbj|BAE40173.1|  unnamed protein product                              49.3    5e-04   
gb|EDM08876.1|  similar to cullin 4A (predicted), isoform CRA_b       49.3    5e-04   
ref|NP_001120773.1|  cullin-4A                                        49.3    6e-04   
gb|EDL22120.1|  mCG3701, isoform CRA_b                                49.3    6e-04   
ref|XP_003477616.1|  PREDICTED: cullin-4A isoform X1                  49.3    6e-04   
gb|EPQ19199.1|  Cullin-4B                                             49.3    6e-04   
ref|XP_007647173.1|  PREDICTED: cullin-4B isoform X1                  49.3    6e-04   
ref|XP_011279428.1|  PREDICTED: cullin-4A                             49.3    6e-04   
ref|XP_006003900.1|  PREDICTED: cullin-4B                             49.3    6e-04   
gb|AAI23910.1|  cul4a protein                                         49.3    6e-04   
ref|XP_007610124.1|  PREDICTED: cullin-4B isoform X2                  49.3    6e-04   
ref|NP_001015893.1|  cullin 4A                                        49.3    6e-04   
ref|XP_005601443.1|  PREDICTED: cullin-4A                             49.3    6e-04   
ref|XP_005884739.1|  PREDICTED: cullin-4B                             49.3    7e-04   
ref|NP_001120891.1|  cullin 4B                                        49.3    7e-04   
ref|XP_009196470.1|  PREDICTED: cullin-4B isoform X3                  49.3    7e-04   
ref|XP_006257551.1|  PREDICTED: cullin-4B isoform X1                  49.3    7e-04   
ref|XP_003365917.2|  PREDICTED: cullin-4B                             49.3    7e-04   
dbj|BAG53936.1|  unnamed protein product                              48.9    7e-04   
gb|ELK27187.1|  Cullin-4B                                             48.9    7e-04   
ref|XP_007122106.1|  PREDICTED: cullin-4B-like isoform X2             48.9    7e-04   
ref|XP_007122105.1|  PREDICTED: cullin-4B-like isoform X1             48.9    7e-04   
ref|XP_008988093.1|  PREDICTED: cullin-4B isoform X1                  48.9    7e-04   
ref|XP_004285634.1|  PREDICTED: cullin-4B isoform 1                   48.9    7e-04   
ref|XP_004587715.1|  PREDICTED: cullin-4B                             48.9    7e-04   
ref|XP_002723510.1|  PREDICTED: cullin-4A                             48.9    7e-04   
ref|XP_010627872.1|  PREDICTED: cullin-4B isoform X1                  48.9    7e-04   
ref|XP_010627873.1|  PREDICTED: cullin-4B isoform X2                  48.9    7e-04   
ref|XP_004412313.1|  PREDICTED: cullin-4A                             48.9    7e-04   
ref|XP_004352887.1|  cullin 4B, putative                              48.9    7e-04   
ref|XP_007178671.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.9    7e-04   
gb|AAR13073.1|  cullin 4B                                             48.9    7e-04   
ref|XP_009196468.1|  PREDICTED: cullin-4B isoform X1                  48.9    7e-04   
emb|CAD97843.1|  hypothetical protein                                 48.9    7e-04   
ref|XP_006981625.1|  PREDICTED: cullin-4B isoform X1                  48.9    7e-04   
ref|XP_006082210.1|  PREDICTED: cullin-4B isoform X1                  48.9    7e-04   
gb|KFO30994.1|  Cullin-4B                                             48.9    8e-04   
ref|NP_001073341.1|  cullin-4B isoform 2                              48.9    8e-04   
ref|XP_008988095.1|  PREDICTED: cullin-4B isoform X3                  48.9    8e-04   
ref|XP_001086195.1|  PREDICTED: cullin-4B isoform 1                   48.9    8e-04   
ref|XP_011376543.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_006981626.1|  PREDICTED: cullin-4B isoform X2                  48.9    8e-04   
ref|XP_006724848.1|  PREDICTED: cullin-4B isoform X3                  48.9    8e-04   
ref|XP_008988094.1|  PREDICTED: cullin-4B isoform X2                  48.9    8e-04   
ref|XP_006724847.1|  PREDICTED: cullin-4B isoform X2                  48.9    8e-04   
ref|XP_009859220.1|  PREDICTED: cullin-4A                             48.9    8e-04   
ref|XP_005262538.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_008988096.1|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_008017651.1|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_004663475.1|  PREDICTED: cullin-4A                             48.9    8e-04   
ref|XP_006272538.1|  PREDICTED: cullin-4A                             48.9    8e-04   
ref|XP_006917880.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_006082212.1|  PREDICTED: cullin-4B isoform X3                  48.9    8e-04   
ref|XP_006082211.1|  PREDICTED: cullin-4B isoform X2                  48.9    8e-04   
gb|AAH36216.1|  Cullin 4B                                             48.9    8e-04   
ref|XP_011376546.1|  PREDICTED: cullin-4B isoform X3                  48.9    8e-04   
ref|XP_004647716.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_004379637.1|  PREDICTED: cullin-4B isoform 1                   48.9    8e-04   
ref|XP_006215961.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_004762117.1|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_004064858.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.9    8e-04   
ref|NP_003579.3|  cullin-4B isoform 1                                 48.9    8e-04   
ref|XP_010989951.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.9    8e-04   
ref|XP_008017652.1|  PREDICTED: cullin-4B isoform X5                  48.9    8e-04   
ref|XP_006767871.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_003465638.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_006082213.1|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_006877534.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_006851582.1|  PREDICTED: cullin-4A                             48.9    8e-04   
ref|XP_008832150.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_010962238.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_006215962.1|  PREDICTED: cullin-4B isoform X2                  48.9    8e-04   
ref|XP_005700400.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_006048867.1|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_002699556.2|  PREDICTED: cullin-4B isoform X4                  48.9    8e-04   
ref|XP_007951543.1|  PREDICTED: cullin-4B                             48.9    8e-04   
ref|XP_008974985.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_003262326.2|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B is...  48.9    8e-04   
ref|XP_007076303.1|  PREDICTED: cullin-4B isoform X3                  48.9    8e-04   
ref|XP_011277733.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_007076301.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_004685823.1|  PREDICTED: cullin-4B isoform X1                  48.9    8e-04   
ref|XP_004022402.1|  PREDICTED: cullin-4B isoform 1                   48.9    9e-04   
ref|XP_008271382.1|  PREDICTED: cullin-4B isoform X3                  48.9    9e-04   
ref|XP_004762115.1|  PREDICTED: cullin-4B isoform X2                  48.9    9e-04   
ref|XP_005594545.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.9    9e-04   
ref|XP_010798617.1|  PREDICTED: cullin-4B isoform X1                  48.9    9e-04   
ref|XP_007530424.1|  PREDICTED: cullin-4B isoform X1                  48.9    9e-04   
ref|XP_011277734.1|  PREDICTED: cullin-4B isoform X2                  48.9    9e-04   
ref|XP_007076302.1|  PREDICTED: cullin-4B isoform X2                  48.9    9e-04   
ref|NP_001100421.1|  cullin-4B                                        48.9    9e-04   
ref|XP_004653844.1|  PREDICTED: cullin-4B                             48.9    9e-04   
gb|ELR59400.1|  Cullin-4B                                             48.9    9e-04   
ref|XP_008271380.1|  PREDICTED: cullin-4B isoform X1                  48.9    9e-04   
ref|XP_002720454.2|  PREDICTED: cullin-4B isoform X2                  48.9    9e-04   
ref|XP_008154341.1|  PREDICTED: cullin-4B isoform X1                  48.9    9e-04   
gb|KFM72708.1|  Cullin-4B                                             48.5    0.001   
gb|EFB16493.1|  hypothetical protein PANDA_011593                     48.5    0.001   
ref|XP_006144939.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.5    0.001   
ref|XP_008271383.1|  PREDICTED: cullin-4B isoform X4                  48.5    0.001   
ref|XP_010592962.1|  PREDICTED: cullin-4B isoform X1                  48.5    0.001   
ref|XP_003414815.1|  PREDICTED: cullin-4B isoform X2                  48.5    0.001   
ref|XP_005319406.1|  PREDICTED: cullin-4B isoform X1                  48.5    0.001   
ref|XP_004899937.1|  PREDICTED: LOW QUALITY PROTEIN: cullin-4B        48.5    0.001   
ref|XP_006048866.1|  PREDICTED: cullin-4B isoform X3                  48.5    0.001   
ref|XP_010819677.1|  PREDICTED: cullin-4B isoform X3                  48.5    0.001   



>ref|XP_011096567.1| PREDICTED: cullin-4-like [Sesamum indicum]
Length=846

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 129/192 (67%), Gaps = 30/192 (16%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGD--------------GAPPLHRPPPMKKAKSQAVACSLDTNK  181
            S PN  ++P +S SA  G               G       P MKKAKSQAVACSLD NK
Sbjct  2    SQPNTSTTPATSASAVPGKRSSSPRSSTTPTATGVGAASVVPAMKKAKSQAVACSLDGNK  61

Query  182  NGQH----HVHFY------PDVDEDPSSASMEDLDSPGASATRAA------TANLSRKKA  313
            NGQ     HVHF       P +++DPS  +ME   S  A   R +      TANLSRKKA
Sbjct  62   NGQQQITPHVHFAEPPVHSPMMEDDPSDVAMEASPSSTAFGRRVSASGGGVTANLSRKKA  121

Query  314  TLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  493
            T PQP KKLVIKLVKAKPTLP+NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC
Sbjct  122  TPPQPTKKLVIKLVKAKPTLPSNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  181

Query  494  LHKMGGSLYQRI  529
            LHKMGGSLYQRI
Sbjct  182  LHKMGGSLYQRI  193



>ref|XP_006361548.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=824

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 132/174 (76%), Gaps = 10/174 (6%)
 Frame = +2

Query  29   MSQPTSNPNKR-----SSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH  193
            MSQPT+NP KR      S  SS + T G           MKKAKSQA+ CS+D NKNGQH
Sbjct  1    MSQPTTNPKKRFIPTNPSSSSSSTPTTGGTGGRTPAYSSMKKAKSQALPCSID-NKNGQH  59

Query  194  HVHFYPDVDEDPS--SASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  367
             VHF  D+D DPS  S+ MED +   +S     TANLSRKKAT PQPAKKLVIKL+KAKP
Sbjct  60   -VHFSSDID-DPSGNSSMMEDSNIDASSVAGGVTANLSRKKATPPQPAKKLVIKLLKAKP  117

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  118  TLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRI  171



>ref|NP_001234356.1| cullin 4 [Solanum lycopersicum]
 gb|ABX09988.1| cullin 4 [Solanum lycopersicum]
Length=785

 Score =   175 bits (444),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 106/135 (79%), Positives = 115/135 (85%), Gaps = 5/135 (4%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSAS--MEDLDSPGASATRAATANLSR  304
            MKKAKSQA+ CS+D+ KNGQH VHF  D+D DPS  S  MED +   +S     TANLSR
Sbjct  1    MKKAKSQALPCSIDS-KNGQH-VHFSSDID-DPSGNSPMMEDCNIDSSSVAGGVTANLSR  57

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKAT PQPAKKLVIKL+KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVN
Sbjct  58   KKATPPQPAKKLVIKLLKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVN  117

Query  485  DLCLHKMGGSLYQRI  529
            DLCLHKMGG+LYQRI
Sbjct  118  DLCLHKMGGNLYQRI  132



>gb|KJB66936.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=788

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 127/170 (75%), Gaps = 10/170 (6%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  208
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  209  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  379
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  380  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRI  163



>gb|KJB66935.1| hypothetical protein B456_010G166800 [Gossypium raimondii]
Length=816

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 127/170 (75%), Gaps = 10/170 (6%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  208
            MS P   P KRS   ++ +A++   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRS--ITNVTASSSSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  54

Query  209  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  379
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  55   QDDNNVLFDPSSMPLHD-DSKSADARTPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  113

Query  380  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            NFE  TWATLKSAI AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  114  NFEVETWATLKSAITAIFLKRPDSCDLEKLYQAVNDLCLHKMGGSLYQRI  163



>ref|XP_011085242.1| PREDICTED: cullin-4 [Sesamum indicum]
Length=844

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 116/150 (77%), Gaps = 18/150 (12%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQH----HVHFY------PDVDEDPSSASMEDLDSPG-----  265
            MKKAKSQAVACSLD NKNGQ     HVHF       P +++DP+  ++E   SP      
Sbjct  43   MKKAKSQAVACSLDGNKNGQQQIAPHVHFAEPPAHSPMIEDDPNDVALET-SSPSNAFGR  101

Query  266  --ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  439
              A++    TANLSRKKAT PQP KKLVIKLVKAKPTLP NFEENTWATLKSAI+AIFLK
Sbjct  102  GLAASAGGVTANLSRKKATPPQPTKKLVIKLVKAKPTLPNNFEENTWATLKSAISAIFLK  161

Query  440  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  162  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  191



>ref|XP_007025065.1| Cullin-4B isoform 2, partial [Theobroma cacao]
 gb|EOY27687.1| Cullin-4B isoform 2, partial [Theobroma cacao]
Length=653

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = +2

Query  116  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  289
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  290  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  469
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  470  YQAVNDLCLHKMGGSLYQRI  529
            YQAVN+LCLHKMGGSLYQRI
Sbjct  147  YQAVNNLCLHKMGGSLYQRI  166



>ref|XP_007025064.1| Cullin-4B isoform 1 [Theobroma cacao]
 gb|EOY27686.1| Cullin-4B isoform 1 [Theobroma cacao]
Length=819

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 113/140 (81%), Gaps = 3/140 (2%)
 Frame = +2

Query  116  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASMEDLDSPGASATRAAT  289
            H  P MKKAKSQAVACSLD NKNG HH H   D D   DPSS +++D DS    A   A 
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHHHHNQDDNDVVFDPSSMALDD-DSKPDDARAPAA  86

Query  290  ANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKL  469
            ANLSRKKAT PQPAKKLVIKLVKAKPTLPTNFEE TWA LKSAINAIFLKQPD CDLEKL
Sbjct  87   ANLSRKKATPPQPAKKLVIKLVKAKPTLPTNFEEETWAKLKSAINAIFLKQPDSCDLEKL  146

Query  470  YQAVNDLCLHKMGGSLYQRI  529
            YQAVN+LCLHKMGGSLYQRI
Sbjct  147  YQAVNNLCLHKMGGSLYQRI  166



>ref|XP_009759464.1| PREDICTED: cullin-4 [Nicotiana sylvestris]
Length=821

 Score =   168 bits (426),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 122/182 (67%), Positives = 129/182 (71%), Gaps = 29/182 (16%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  178
            MSQPT+NP KRSS +          S+ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSFFISTNPSSSTPSTGSGDVGSGGPAYSL---MKKAKSQAV-------  50

Query  179  KNGQHHVHFYPDVDEDPS--SASMED--LDSPG-ASATRAATANLSRKKATLPQpakklv  343
             NGQH VHF  D  EDPS  SA MED  +D+P  AS     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSGNSAMMEDSNMDAPSRASVGGGVTANLSRKKATPPQPAKKLV  106

Query  344  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  523
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PCDLE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCDLEALYQAVNDLCLHKMGGSLYQ  166

Query  524  RI  529
            RI
Sbjct  167  RI  168



>ref|XP_009599227.1| PREDICTED: cullin-4 [Nicotiana tomentosiformis]
Length=821

 Score =   166 bits (419),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 119/182 (65%), Positives = 128/182 (70%), Gaps = 29/182 (16%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPY----------SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTN  178
            MSQPT+NP KRSS +          ++ S   G G P       MKKAKSQAV       
Sbjct  1    MSQPTTNPKKRSSIFISTNTSSSTPTTGSGNVGSGTPAYSL---MKKAKSQAV-------  50

Query  179  KNGQHHVHFYPDVDEDPSSAS--MED--LDSPG-ASATRAATANLSRKKATLPQpakklv  343
             NGQH VHF  D  EDPSS S  MED  +D+P   S     TANLSRKKAT PQPAKKLV
Sbjct  51   -NGQH-VHF--DNLEDPSSNSSMMEDSNMDAPSRVSVGGGVTANLSRKKATPPQPAKKLV  106

Query  344  iklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQ  523
            IKLVKAKPTLPTNFEENTWATLKSAI+AIFLKQ +PC+LE LYQAVNDLCLHKMGGSLYQ
Sbjct  107  IKLVKAKPTLPTNFEENTWATLKSAISAIFLKQRNPCELEALYQAVNDLCLHKMGGSLYQ  166

Query  524  RI  529
            RI
Sbjct  167  RI  168



>gb|KJB69828.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=786

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
 Frame = +2

Query  116  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  286
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  287  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  466
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  467  LYQAVNDLCLHKMGGSLYQRI  529
            LYQAVNDLCLH+MGGSLYQRI
Sbjct  148  LYQAVNDLCLHRMGGSLYQRI  168



>gb|KJB69827.1| hypothetical protein B456_011G044900 [Gossypium raimondii]
Length=821

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 109/141 (77%), Gaps = 3/141 (2%)
 Frame = +2

Query  116  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  286
            H  P MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS    A   A
Sbjct  28   HFQPSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMSLDDDSKSDDARAPA  87

Query  287  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  466
             ANLSRKKAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  88   AANLSRKKATPPQPAKKLVIKFVKAKPTVPTNFEEETWAKLKSAINAIFLKQPDSCDLEK  147

Query  467  LYQAVNDLCLHKMGGSLYQRI  529
            LYQAVNDLCLH+MGGSLYQRI
Sbjct  148  LYQAVNDLCLHRMGGSLYQRI  168



>gb|KHG10035.1| Cullin-4 -like protein [Gossypium arboreum]
Length=823

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 106/141 (75%), Gaps = 3/141 (2%)
 Frame = +2

Query  116  HRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP---DVDEDPSSASMEDLDSPGASATRAA  286
            H    MKKAKSQAVACSLD NKNG H+ H      DV  DPSS    D DS        A
Sbjct  23   HFQQSMKKAKSQAVACSLDPNKNGLHNHHNNQGDNDVVFDPSSPMALDDDSKSDDGRAPA  82

Query  287  TANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEK  466
             ANLSRKKAT PQPAKKLVIK VKAKPT+P NFEE TWA LKSAINAIFLKQPD CDLEK
Sbjct  83   AANLSRKKATPPQPAKKLVIKFVKAKPTVPMNFEEETWAKLKSAINAIFLKQPDSCDLEK  142

Query  467  LYQAVNDLCLHKMGGSLYQRI  529
            LYQAVNDLCLH+MGGSLYQRI
Sbjct  143  LYQAVNDLCLHRMGGSLYQRI  163



>gb|KHG21020.1| Cullin-4 -like protein [Gossypium arboreum]
Length=786

 Score =   161 bits (407),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 101/134 (75%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            M KAKSQAVA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSQAVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  308  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  487
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  488  LCLHKMGGSLYQRI  529
            LCLHK+GGSLYQRI
Sbjct  120  LCLHKLGGSLYQRI  133



>ref|XP_009360892.1| PREDICTED: cullin-4 [Pyrus x bretschneideri]
Length=831

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 117/174 (67%), Gaps = 12/174 (7%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY-----  208
            S+PNKRSS  +    ++     P    PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPNKRSSAINHSGTSSSSSLNPSSAGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  209  ----PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp-  367
                PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +     
Sbjct  65   PSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVKAKP  124

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  125  TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRI  178



>gb|KJB68319.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=759

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 99/134 (74%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  308  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  487
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  488  LCLHKMGGSLYQRI  529
            LCLHK+GGSLYQRI
Sbjct  120  LCLHKLGGSLYQRI  133



>gb|EYU43260.1| hypothetical protein MIMGU_mgv1a001310mg [Erythranthe guttata]
Length=843

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 131/193 (68%), Gaps = 29/193 (15%)
 Frame = +2

Query  29   MSQPT----SNPNKRSS---PYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNG  187
            MSQ T    +NPNKRSS   P ++    A   A P+   P +KKAKSQ V+CSLD N NG
Sbjct  1    MSQRTNSSSTNPNKRSSSTNPNANTPIAAAAAASPIF--PALKKAKSQGVSCSLDGNMNG  58

Query  188  QH------HVHFY------PDVDEDPSSASMEDLDSP-------GASATRAATANLSRKK  310
            Q       HVHF       P +++DP+ A + D  SP       GA++    T+NLSRKK
Sbjct  59   QQQQQPTPHVHFAETPALSPMIEDDPNDAVL-DASSPSSAFGRVGATSCGGITSNLSRKK  117

Query  311  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  490
            AT PQP KKLVIKL +AKPTLP+NFEE TW  LKSAI+ IFLKQP+PCDLEKLYQAVN+L
Sbjct  118  ATPPQPTKKLVIKLFRAKPTLPSNFEETTWEILKSAISTIFLKQPNPCDLEKLYQAVNNL  177

Query  491  CLHKMGGSLYQRI  529
            CLHK+GG+LYQRI
Sbjct  178  CLHKLGGNLYQRI  190



>gb|KJB68318.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=786

 Score =   157 bits (398),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 99/134 (74%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  308  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  487
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  488  LCLHKMGGSLYQRI  529
            LCLHK+GGSLYQRI
Sbjct  120  LCLHKLGGSLYQRI  133



>ref|XP_006467460.1| PREDICTED: cullin-4-like isoform X2 [Citrus sinensis]
Length=783

 Score =   157 bits (396),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 100/134 (75%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = +2

Query  131  MKKAKSQAVACSLDT-NKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            MKKAKSQAVACS+DT NKNG HH +   D   DPSS S++D   P     +AA ANLSRK
Sbjct  1    MKKAKSQAVACSVDTANKNGLHHDN---DAVFDPSSISLDDDLKPDEPRQQAA-ANLSRK  56

Query  308  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  487
            KA  PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK AI AIFLKQP  CDLEKLYQAVND
Sbjct  57   KAQPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKLAIKAIFLKQPTSCDLEKLYQAVND  116

Query  488  LCLHKMGGSLYQRI  529
            LCLHKMGG+LYQRI
Sbjct  117  LCLHKMGGNLYQRI  130



>ref|XP_007214632.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
 gb|EMJ15831.1| hypothetical protein PRUPE_ppa001433mg [Prunus persica]
Length=830

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 126/174 (72%), Gaps = 13/174 (7%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  211
            S+P KRSS  ++ ++++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTSSSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  212  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  367
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDPDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRI
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRI  177



>ref|XP_008225565.1| PREDICTED: cullin-4 [Prunus mume]
Length=821

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 125/174 (72%), Gaps = 13/174 (7%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  211
            S+P KRSS  ++ + ++   +      PPMKKAKSQAVACSLD +KNG HH H +     
Sbjct  5    SHPTKRSSAINNNTISSTSSSLNPSSGPPMKKAKSQAVACSLDPSKNGLHHHHHHHPHTH  64

Query  212  -------DVDEDPSSASM-EDLDSPGASATRAATANLSRKKATLPQpakklviklvkakp  367
                   DV  DPS+ ++ EDL S   S +RA  ANLSRKKA  PQP KKLVIKL+KAKP
Sbjct  65   PSQDSDNDVVFDPSTMALDEDLKSDDPS-SRAVAANLSRKKAQPPQPTKKLVIKLLKAKP  123

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEE TWA LKSAI AIFLK+PD CD EKLYQAVNDLCLHKMGGSLYQRI
Sbjct  124  TLPTNFEEETWAKLKSAICAIFLKKPDSCDSEKLYQAVNDLCLHKMGGSLYQRI  177



>ref|XP_011013417.1| PREDICTED: cullin-4-like [Populus euphratica]
Length=811

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 110/139 (79%), Gaps = 9/139 (6%)
 Frame = +2

Query  125  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  292
            PPMKKAK QA  ACS LD NKNG+HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGRHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLY  139

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY RI
Sbjct  140  QAVNDLCLHKMGGNLYLRI  158



>gb|AAL27655.2| putative cullin protein [Olea europaea]
Length=816

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 117/162 (72%), Gaps = 23/162 (14%)
 Frame = +2

Query  92   AGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH---HVHFYPD-----VDEDPSSASME  247
            A DGA      P MKKAKSQA+A SLD NKNGQ    HVHF P      +DED +     
Sbjct  7    ADDGASI---SPRMKKAKSQALAYSLD-NKNGQQSVPHVHFDPSANSSMIDEDSNDVV--  60

Query  248  DLDSPGASAT--------RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
             LD+  +S +           TANL+RKKAT PQPAKKLVIKLVKAKP LPT+FEENTWA
Sbjct  61   -LDASASSNSFGRVVGGGGGVTANLARKKATPPQPAKKLVIKLVKAKPMLPTDFEENTWA  119

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLKSAI AIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY+RI
Sbjct  120  TLKSAIIAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYRRI  161



>gb|KJB68315.1| hypothetical protein B456_010G238300 [Gossypium raimondii]
Length=703

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 105/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYP-DVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            M KAKS +VA S+D NKNG HH H    DV  DPSS S+ D DS        ATANLSRK
Sbjct  1    MTKAKSHSVAGSIDPNKNGLHHHHQDGNDVVFDPSSMSLGD-DSKSGVPRSPATANLSRK  59

Query  308  KATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVND  487
            KAT PQPAKKLVIK VKAKPT+PTNFEE TWA LKSAINAIFLKQPD CDLEKLYQ VN+
Sbjct  60   KATPPQPAKKLVIKFVKAKPTMPTNFEEETWAKLKSAINAIFLKQPDSCDLEKLYQDVNN  119

Query  488  LCLHKMGGSLYQRI  529
            LCLHK+GGSLYQRI
Sbjct  120  LCLHKLGGSLYQRI  133



>ref|XP_006467459.1| PREDICTED: cullin-4-like isoform X1 [Citrus sinensis]
 gb|KDO78189.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=804

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>ref|XP_006449702.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62942.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=804

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>gb|KDO78190.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=792

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>ref|XP_006449703.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
 gb|ESR62943.1| hypothetical protein CICLE_v10014310mg [Citrus clementina]
Length=805

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>gb|KDO78192.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=739

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>gb|KDO78191.1| hypothetical protein CISIN_1g003648mg [Citrus sinensis]
Length=805

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDT-NKNGQHHVHFYPDVD  220
            S PNKR         TA +     + P  MKKAKSQAVACS+DT NKNG HH +   D  
Sbjct  2    SLPNKR---------TASNNNSNNYSPSAMKKAKSQAVACSVDTANKNGLHHDN---DAV  49

Query  221  EDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTW  400
             DPSS S++D   P     +AA ANLSRKKA  PQPAKKLVIKL+KAKPTLPTNFEE+TW
Sbjct  50   FDPSSISLDDDLKPDEPRQQAA-ANLSRKKAQPPQPAKKLVIKLLKAKPTLPTNFEEDTW  108

Query  401  ATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            A LK AI AIFLKQP  CDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  109  AKLKLAIKAIFLKQPTSCDLEKLYQAVNDLCLHKMGGNLYQRI  151



>ref|XP_006377605.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55402.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=741

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 108/139 (78%), Gaps = 9/139 (6%)
 Frame = +2

Query  125  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  292
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHS---DDVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY RI
Sbjct  140  QAVNDLCLHKMGGNLYLRI  158



>ref|XP_006377604.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
 gb|ERP55401.1| hypothetical protein POPTR_0011s08280g [Populus trichocarpa]
Length=811

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 108/139 (78%), Gaps = 9/139 (6%)
 Frame = +2

Query  125  PPMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRA--ATA  292
            PPMKKAK QA  ACS LD NKNG HH     DV  DPSS S++D   P     R   A A
Sbjct  25   PPMKKAKCQAASACSPLDYNKNGLHHSD---DVVFDPSSMSLDD--DPKLVDYRPPPAAA  79

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLY
Sbjct  80   NLSRKKATLPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLY  139

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY RI
Sbjct  140  QAVNDLCLHKMGGNLYLRI  158



>ref|XP_008349190.1| PREDICTED: cullin-4-like [Malus domestica]
Length=579

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 118/177 (67%), Gaps = 15/177 (8%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRP---PPMKKAKSQAVACSLDTNKNGQHHVHFY--  208
            S+PNKRSS  +    ++   +  L+     PPMKKAKSQAVA SLD +KNG HH H +  
Sbjct  5    SHPNKRSSAINHSGTSSSSSSSSLNPSSAGPPMKKAKSQAVAGSLDXSKNGLHHHHHHHP  64

Query  209  -------PDVDE--DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka  361
                   PD D   DPSS S+++   P   + R   ANLSRKKA  PQP+ K ++  +  
Sbjct  65   HTHPSQDPDNDAVFDPSSMSLDEDLKPDDPSPRGIAANLSRKKAQPPQPSTKKLVIKLVK  124

Query  362  kp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
               TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  125  AKPTLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRI  181



>gb|KGN65538.1| hypothetical protein Csa_1G435830 [Cucumis sativus]
Length=278

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 105/139 (76%), Gaps = 13/139 (9%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  292
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY+RI
Sbjct  162  QAVNDLCLHKMGGNLYRRI  180



>ref|XP_011011309.1| PREDICTED: cullin-4-like isoform X2 [Populus euphratica]
Length=655

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  128  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHS---DDVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  482  NDLCLHKMGGSLYQRI  529
             DLCLHKMGG+LY RI
Sbjct  140  TDLCLHKMGGNLYLRI  155



>ref|XP_006352972.1| PREDICTED: cullin-4-like [Solanum tuberosum]
Length=797

 Score =   147 bits (371),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 95/133 (71%), Positives = 98/133 (74%), Gaps = 11/133 (8%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKK  310
            MKKAKSQA A   D NKNGQ   H     DE     SM      G       T+NLSRKK
Sbjct  23   MKKAKSQAAAT--DDNKNGQQQHHKVESTDE--PCVSMIQYSGGGV------TSNLSRKK  72

Query  311  ATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDL  490
            AT P P K+LVIKL KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAVNDL
Sbjct  73   AT-PPPKKQLVIKLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVNDL  131

Query  491  CLHKMGGSLYQRI  529
            CLHKMGGSLYQRI
Sbjct  132  CLHKMGGSLYQRI  144



>gb|KDP37982.1| hypothetical protein JCGZ_04625 [Jatropha curcas]
Length=821

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 112/143 (78%), Gaps = 9/143 (6%)
 Frame = +2

Query  125  PPMKKAKSQAV-ACS-LD--TNKNGQHHVHFYP----DVDEDPSSASMEDLDSPGASATR  280
            PPMKKAKSQAV ACS L+  +NKNG HH +       D+  DPSS +++D D      + 
Sbjct  27   PPMKKAKSQAVSACSPLEPTSNKNGLHHFNSATAPENDIVFDPSSMTLDD-DPKLDDRSP  85

Query  281  AATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDL  460
               ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA L+SAI AIFLKQPD CDL
Sbjct  86   PPAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPDSCDL  145

Query  461  EKLYQAVNDLCLHKMGGSLYQRI  529
            EKLYQAVNDLCLHKMGG+LYQRI
Sbjct  146  EKLYQAVNDLCLHKMGGNLYQRI  168



>ref|XP_011011308.1| PREDICTED: cullin-4-like isoform X1 [Populus euphratica]
Length=808

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  128  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  23   PMKKAKSQAASACSPLDHNKNGLYHS---DDVVFDPSSMSLDDDLKLVDYRTPPAAANLS  79

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP PCDLEKLYQAV
Sbjct  80   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPAPCDLEKLYQAV  139

Query  482  NDLCLHKMGGSLYQRI  529
             DLCLHKMGG+LY RI
Sbjct  140  TDLCLHKMGGNLYLRI  155



>gb|EPS64061.1| cullin 4, partial [Genlisea aurea]
Length=763

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 109/147 (74%), Gaps = 13/147 (9%)
 Frame = +2

Query  122  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPD---VDEDPSSASMEDLDSPGASA------  274
            PP MKKAKSQAVACS+D  +    H    P    + ED + ++ME   SP A++      
Sbjct  29   PPTMKKAKSQAVACSIDAPQQQIPHFAETPAHSPMIEDDADSAMEA--SPPANSFGRVVS  86

Query  275  --TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPD  448
                  TANLSRKKAT PQPAKK VIKL KAKPTLP+NFEENTWATLKSAI+AIFLK+PD
Sbjct  87   GSGGGVTANLSRKKATPPQPAKKFVIKLNKAKPTLPSNFEENTWATLKSAISAIFLKRPD  146

Query  449  PCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            PCD EKLYQAV+DLCLHKMGGSLYQRI
Sbjct  147  PCDSEKLYQAVSDLCLHKMGGSLYQRI  173



>ref|XP_002305340.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
 gb|EEE85851.2| hypothetical protein POPTR_0004s14020g [Populus trichocarpa]
Length=813

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  128  PMKKAKSQAV-ACS-LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PMKKAKSQA  ACS LD NKNG +H     DV  DPSS S++D        T  A ANLS
Sbjct  28   PMKKAKSQAASACSPLDHNKNGLYHS---DDVVFDPSSMSLDDDLKLVDYRTPPAAANLS  84

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKAT PQPAKKLVIKLVKAKPTLPTNFEE+TWA L+SAI AIFLKQP  CDLEKLYQAV
Sbjct  85   RKKATPPQPAKKLVIKLVKAKPTLPTNFEEDTWAKLQSAIKAIFLKQPALCDLEKLYQAV  144

Query  482  NDLCLHKMGGSLYQRI  529
            NDLCLHKMGG+LY RI
Sbjct  145  NDLCLHKMGGNLYLRI  160



>ref|XP_008371761.1| PREDICTED: cullin-4 [Malus domestica]
Length=834

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 103/146 (71%), Gaps = 11/146 (8%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFY--------PDVDE--DPSSASMEDLDSPGASA  274
            PPMKKAKSQAVACSLD +KNG HH H +        PD D   DPSS S++D   P   +
Sbjct  36   PPMKKAKSQAVACSLDPSKNGLHHHHHHPHTHPTQDPDNDXVFDPSSMSLDDDLRPDDPS  95

Query  275  TRAATANLSRKKATLPQpakklviklvkakp-TLPTNFEENTWATLKSAINAIFLKQPDP  451
             R   ANLSRKKA  PQP+ K ++  +     TLPTNFEE TWA LKSAI AIFLK+PD 
Sbjct  96   PRGVAANLSRKKAQPPQPSTKKLVIKLVKAKPTLPTNFEEETWAKLKSAICAIFLKKPDS  155

Query  452  CDLEKLYQAVNDLCLHKMGGSLYQRI  529
            CDLEKLYQAV DLCLHKMGGSLYQRI
Sbjct  156  CDLEKLYQAVTDLCLHKMGGSLYQRI  181



>ref|XP_004149667.1| PREDICTED: cullin-4-like [Cucumis sativus]
Length=833

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 105/139 (76%), Gaps = 13/139 (9%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  292
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY+RI
Sbjct  162  QAVNDLCLHKMGGNLYRRI  180



>ref|XP_004162809.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cucumis sativus]
Length=833

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 105/139 (76%), Gaps = 13/139 (9%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  292
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      SP   A+R+   
Sbjct  49   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSPLIGASRSVAT  101

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  102  NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  161

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY+RI
Sbjct  162  QAVNDLCLHKMGGNLYRRI  180



>ref|XP_002270764.2| PREDICTED: cullin-4 [Vitis vinifera]
Length=828

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 118/179 (66%), Gaps = 22/179 (12%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP----  211
            S+P KRS   ++ S++ G  A P    PPMKKAKSQAVACSLD  KNG       P    
Sbjct  2    SHPTKRSLSNTTTSSSGG--ASP--HFPPMKKAKSQAVACSLDP-KNGLQPPPHPPPPSS  56

Query  212  ----DVDEDPSSASMEDLDSPGASATR--------AATANLSRKKATLPQpakklviklv  355
                D D DPS+ +++D   P  +             TANLSRKKAT PQPAKK ++  +
Sbjct  57   HHFPDDDFDPSAMALDDDLKPDDADAAACSRPSAGGVTANLSRKKATPPQPAKKQLVIKL  116

Query  356  kakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
                 TLPTNFEE+TWA LKSAI+AIFLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  117  LKAKPTLPTNFEEDTWAKLKSAISAIFLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRI  175



>ref|XP_002519675.1| cullin, putative [Ricinus communis]
 gb|EEF42648.1| cullin, putative [Ricinus communis]
Length=807

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 109/154 (71%), Gaps = 21/154 (14%)
 Frame = +2

Query  125  PPMKKAKSQAV-ACS-LDT--NKNGQHHVHFYP--------DVDEDPSSASMEDLDSPGA  268
            PPMKKAKSQAV ACS LDT  NKNG HH  F P        DV  DPSS    D D    
Sbjct  26   PPMKKAKSQAVSACSPLDTTTNKNGIHH--FNPSTTAAAENDVVFDPSSMMSLDDDPKLD  83

Query  269  SATRA-------ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  427
                        A ANLSRKKAT PQPAKKLVIKLVKAKPTLP NFEE+TWA L+SAI A
Sbjct  84   DDHHRSHHHHPPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPINFEEDTWAKLQSAIKA  143

Query  428  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            IFLKQPD CDLEKLYQAVNDLCLHKMGG+LYQ+I
Sbjct  144  IFLKQPDSCDLEKLYQAVNDLCLHKMGGNLYQQI  177



>ref|XP_008444359.1| PREDICTED: cullin-4 [Cucumis melo]
Length=829

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 104/139 (75%), Gaps = 13/139 (9%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLD------SPGASATRAATA  292
            MKK KSQ     LD NKNG HH   + D D DPSS  ++D D      S    A+R+   
Sbjct  45   MKKTKSQP----LDPNKNGLHH---HDDPDFDPSSMPLDDEDLKPPHHSSLIGASRSVAT  97

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKAT PQPAKKLVIKL+KAKPTLP NFEE+TWA LKSAI AIFLKQP+ CDLEKLY
Sbjct  98   NLSRKKATPPQPAKKLVIKLLKAKPTLPANFEEDTWAKLKSAICAIFLKQPNSCDLEKLY  157

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVNDLCLHKMGG+LY+RI
Sbjct  158  QAVNDLCLHKMGGNLYRRI  176



>emb|CAN75926.1| hypothetical protein VITISV_010491 [Vitis vinifera]
Length=806

 Score =   140 bits (354),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 99/153 (65%), Positives = 110/153 (72%), Gaps = 24/153 (16%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNG--------QHHVHFYPDVDEDPSSASMEDL-----------  253
            MKKAKSQAVACSLD  KNG            H +PD D DPS+ +++D            
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  254  DSPGASATRAATANLSRKKATLPQpakklvi-klvkakpTLPTNFEENTWATLKSAINAI  430
              P A      TANLSRKKAT PQPAKK ++ KL+KAKPTLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGGV---TANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  431  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRI  149



>emb|CBI30911.3| unnamed protein product [Vitis vinifera]
Length=802

 Score =   140 bits (353),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 99/153 (65%), Positives = 107/153 (70%), Gaps = 24/153 (16%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNG--------QHHVHFYPDVDEDPSS-----------ASMEDL  253
            MKKAKSQAVACSLD  KNG            H +PD D DPS+           A     
Sbjct  1    MKKAKSQAVACSLDP-KNGLQPPPHPPPPSSHHFPDDDFDPSAMALDDDLKPDDADAAAC  59

Query  254  DSPGASATRAATANLSRKKATLPQpakklvi-klvkakpTLPTNFEENTWATLKSAINAI  430
              P A      TANLSRKKAT PQPAKK ++ KL+KAKPTLPTNFEE+TWA LKSAI+AI
Sbjct  60   SRPSAGGV---TANLSRKKATPPQPAKKQLVIKLLKAKPTLPTNFEEDTWAKLKSAISAI  116

Query  431  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  117  FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRI  149



>ref|XP_010274939.1| PREDICTED: cullin-4-like [Nelumbo nucifera]
Length=837

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 110/156 (71%), Gaps = 28/156 (18%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTN----------KNGQHHVHFYPDVDEDPSSASMED------LDSP  262
            MKKAKSQAVACSL+ N           + QHH+      D+D SS  ++D      +D+ 
Sbjct  34   MKKAKSQAVACSLEKNGLQQQQQQQQNHAQHHL-----FDDDDSSMIVDDDIKVDAVDAT  88

Query  263  ------GASAT-RAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  421
                  G+S T     ANLSRKKAT PQPAKKLVIKLVKAKP LPTNFEE+TWATLKSAI
Sbjct  89   PIALGVGSSGTPHGVAANLSRKKATPPQPAKKLVIKLVKAKPKLPTNFEEDTWATLKSAI  148

Query  422  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            +AIFLKQPD CD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  149  SAIFLKQPDSCDSEKLYQAVCDLCLHKMGGNLYQRI  184



>ref|XP_010247871.1| PREDICTED: cullin-4-like isoform X2 [Nelumbo nucifera]
Length=725

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 116/180 (64%), Gaps = 25/180 (14%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDV--  217
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  218  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  349
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  350  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174



>ref|XP_010247870.1| PREDICTED: cullin-4-like isoform X1 [Nelumbo nucifera]
Length=827

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 116/180 (64%), Gaps = 25/180 (14%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDV--  217
            S+ NKR  P  S S T+G+   P      MKKAKSQAV CSL+  KNG            
Sbjct  2    SHHNKR--PNCSTSNTSGNSGGPF---SSMKKAKSQAVTCSLE--KNGLQQQQQQNHGQH  54

Query  218  ----DEDPSSASMEDL-----DSP------GASATRAATA-NLSRKKATLPQpakklvik  349
                DED +    +DL     D+P      G S T    A NLSRKKAT PQPAKKLVIK
Sbjct  55   HHFDDEDSAMVVDDDLKVDTVDAPLLALGVGCSGTTTGIAANLSRKKATPPQPAKKLVIK  114

Query  350  lvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LVK KP LPT+FEE+TW TLKSAI+AIFLKQPDPCD EKLYQAV DLCLHKMGG+LYQRI
Sbjct  115  LVKDKPKLPTSFEEDTWVTLKSAISAIFLKQPDPCDSEKLYQAVCDLCLHKMGGNLYQRI  174



>gb|KCW73811.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 108/148 (73%), Gaps = 15/148 (10%)
 Frame = +2

Query  131  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  265
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  266  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  445
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  446  DPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
              C LE  YQAVNDLCLHK+GG+LYQRI
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRI  148



>gb|KCW73810.1| hypothetical protein EUGRSUZ_E02414 [Eucalyptus grandis]
Length=801

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 108/148 (73%), Gaps = 15/148 (10%)
 Frame = +2

Query  131  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  265
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  1    MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  60

Query  266  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  445
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  61   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  120

Query  446  DPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
              C LE  YQAVNDLCLHK+GG+LYQRI
Sbjct  121  VSCSLEDYYQAVNDLCLHKLGGNLYQRI  148



>ref|XP_010056896.1| PREDICTED: cullin-4 [Eucalyptus grandis]
Length=838

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 108/148 (73%), Gaps = 15/148 (10%)
 Frame = +2

Query  131  MKKAKSQAVACSLDT---NKNGQH---------HVHFYP--DVDEDPSSASMED-LDSPG  265
            MKKAKSQAVA SLD+   +KNG H            F P  DV  DP++ S+ED + S  
Sbjct  38   MKKAKSQAVAGSLDSTTAHKNGLHPHPAKQQSQQPGFDPESDVVFDPATMSLEDGMKSDD  97

Query  266  ASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQP  445
              A  +  ANLSRKKAT PQPAKKLVIKL+KAKPTLPTNFEE+TWA LK+AINAIFLKQP
Sbjct  98   MVAGHSVAANLSRKKATPPQPAKKLVIKLLKAKPTLPTNFEEDTWAKLKAAINAIFLKQP  157

Query  446  DPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
              C LE  YQAVNDLCLHK+GG+LYQRI
Sbjct  158  VSCSLEDYYQAVNDLCLHKLGGNLYQRI  185



>ref|XP_009408525.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=847

 Score =   137 bits (346),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 88/150 (59%), Positives = 101/150 (67%), Gaps = 19/150 (13%)
 Frame = +2

Query  131  MKKAKS-QAVACSLDTNKNGQHHVHF-----------YPDVDEDPSSASMEDLDSPGASA  274
            MKKAK   A ACSL+  KNG HH HF            P  +ED      E+L  PGAS 
Sbjct  47   MKKAKPLPAAACSLEKEKNGLHH-HFDTAAAAAAVAARPGKEEDAMLVDQEEL-KPGASV  104

Query  275  TRAAT---ANLSRKKATLPQpakklviklv--kakpTLPTNFEENTWATLKSAINAIFLK  439
              A T   ANLSRKKAT PQP+ K  + +   K KP++P NFEE+TWATLKSAINAIFLK
Sbjct  105  PVAMTGVAANLSRKKATPPQPSAKKQLVIKFVKGKPSVPANFEEDTWATLKSAINAIFLK  164

Query  440  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            + DPCD EKLYQAV+DLCLHKMGG+LYQR+
Sbjct  165  RRDPCDSEKLYQAVDDLCLHKMGGNLYQRV  194



>ref|XP_008787803.1| PREDICTED: cullin-4-like isoform X1 [Phoenix dactylifera]
Length=871

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 117/185 (63%), Gaps = 19/185 (10%)
 Frame = +2

Query  32   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGQH--  193
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  194  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  334
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  335  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  514
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  515  LYQRI  529
            LYQRI
Sbjct  189  LYQRI  193



>ref|XP_008787804.1| PREDICTED: cullin-4-like isoform X2 [Phoenix dactylifera]
Length=846

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 117/185 (63%), Gaps = 19/185 (10%)
 Frame = +2

Query  32   SQPTSNPNKRSSPYSSCSATAGDGAP---PLHRPPPMKKAKSQA-VACSLDTNKNGQH--  193
            S  +S    R++ + S S+    G+P    +     MKK KSQ   A +++  KNG H  
Sbjct  9    SSVSSGGGNRTTTHGSTSSGGVIGSPLSPSIASSSAMKKFKSQPPAAAAVEREKNGLHLH  68

Query  194  HVHF---------YPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKATLPQ--pak  334
              HF          P  +EDP     EDL +  ++A  +    ANLSRKKAT PQ    K
Sbjct  69   STHFDPAAAAAAAQPAEEEDPMLVDQEDLKAGASTAITSTGVAANLSRKKATPPQPLAKK  128

Query  335  klviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGS  514
            +LVIKLVK KPTLPTNFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+
Sbjct  129  QLVIKLVKGKPTLPTNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGN  188

Query  515  LYQRI  529
            LYQRI
Sbjct  189  LYQRI  193



>ref|XP_010110959.1| hypothetical protein L484_021653 [Morus notabilis]
 gb|EXC29345.1| hypothetical protein L484_021653 [Morus notabilis]
Length=862

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 93/139 (67%), Gaps = 9/139 (6%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PPMKK KSQA+ACSLD NKNG HH +    DV  DPS A  ED   P  S    A ANLS
Sbjct  35   PPMKKTKSQAMACSLDPNKNGLHHNNQDNNDVVFDPSMALDED---PKPSD--GAAANLS  89

Query  302  RKKATLPQ---pakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            RKKAT P        +     K KP LP NFE+ TWA LKSAI AIFLK+ D CDLEKLY
Sbjct  90   RKKATPPHPPGKKFVIKFNKDKEKPKLPVNFEDETWAKLKSAICAIFLKRRDSCDLEKLY  149

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAVN+LCLHK+G +LYQRI
Sbjct  150  QAVNNLCLHKLGANLYQRI  168



>ref|XP_009398338.1| PREDICTED: cullin-4-like [Musa acuminata subsp. malaccensis]
Length=842

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 108/173 (62%), Gaps = 19/173 (11%)
 Frame = +2

Query  65   SPYSSCSATAGDGAPPLHRPPPMKKAKSQ-AVACSLDTNKNGQH------------HVHF  205
            +P S+  A+ G         P MKKAK Q A  CSL+  KNG H             V  
Sbjct  18   TPNSNSGASGGATHISPELSPAMKKAKPQLAATCSLEKEKNGLHPQPHHSNTTAAAAVAA  77

Query  206  YPDVDEDPSSASMEDLDSPGASA---TRAATANLSRKKATLPQ--pakklviklvkakpT  370
                ++D      E+L  PGASA        ANLSRKKAT PQ    K+LVIKLVK KP+
Sbjct  78   QSGEEDDAMLVDQEEL-KPGASAPVMVTGVAANLSRKKATPPQPSVKKQLVIKLVKGKPS  136

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI
Sbjct  137  LPKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRI  189



>gb|KHG11994.1| Cullin-4 -like protein [Gossypium arboreum]
Length=571

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 108/153 (71%), Gaps = 12/153 (8%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  208
            MS P   P KRS      +ATA   + P H  PPMKKAKSQAVACSLD N+NG HH H  
Sbjct  1    MSLP---PTKRSI----TNATASSSSSP-HFQPPMKKAKSQAVACSLDPNRNGLHHHHNN  52

Query  209  PD---VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPT  379
             D   V  DPSS  + D DS  A A   A ANLSRKKAT PQPAKKLVIKLVKAKPTLPT
Sbjct  53   QDDNNVLFDPSSMPLHD-DSKSADACAPAAANLSRKKATPPQPAKKLVIKLVKAKPTLPT  111

Query  380  NFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  478
            NFE  TWATLKSAI AIFLKQPD CDLEKLYQA
Sbjct  112  NFEVETWATLKSAIIAIFLKQPDSCDLEKLYQA  144



>ref|XP_010666663.1| PREDICTED: cullin-4 [Beta vulgaris subsp. vulgaris]
Length=825

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 109/181 (60%), Gaps = 23/181 (13%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFY  208
            MS P +N    SSP S+ +        P      MKK KSQ    SLDT        +  
Sbjct  1    MSPPNNNKRPASSPTSTHTNLTSSSFSP-----SMKKPKSQ----SLDTRNALHSAFNSS  51

Query  209  PDVDEDPSSASMEDLDSPGASA-------TRAA------TANLSRKKATLPQpakklvik  349
              VD+DP+S  +++ D   ++A       +R+A      TANLSRKKAT P P+ K ++ 
Sbjct  52   SAVDDDPASVIVDNDDDLKSNAVISSSANSRSAPISGGVTANLSRKKATPPNPSTKKLVI  111

Query  350  lvkakp-TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  526
             +     TLP NFEE TWATLKSAINAIFLKQPD CDLEKLYQAVNDLCLHKMGGSLYQR
Sbjct  112  KLVKAKPTLPPNFEEVTWATLKSAINAIFLKQPDSCDLEKLYQAVNDLCLHKMGGSLYQR  171

Query  527  I  529
            I
Sbjct  172  I  172



>gb|KHN06973.1| Cullin-4 [Glycine soja]
Length=788

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 109/162 (67%), Gaps = 28/162 (17%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRSS       TAG    P   PPPMKKAKS  +  S  +            D   
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLHSSSSS------------DAVL  39

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRI
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRI  135



>ref|XP_010941311.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Elaeis guineensis]
Length=846

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 101/150 (67%), Gaps = 17/150 (11%)
 Frame = +2

Query  131  MKKAKSQA-VACSLDTNKNGQH--HVHFYPDVDE----------DPSSASMEDLDSPGAS  271
            MKK KSQ   A +++  KNG H    HF P              DP     EDL +  ++
Sbjct  44   MKKFKSQPPAAAAVEREKNGLHPHSTHFDPAAAAEAAAQPAGEEDPMLVDQEDLKAGAST  103

Query  272  A--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  439
            A  +    ANLSRKKAT PQ    K+L+IKLVK KPTLPTNFEE+TWATLKSAI AIFLK
Sbjct  104  AITSTGVAANLSRKKATPPQPLAKKQLIIKLVKGKPTLPTNFEEDTWATLKSAITAIFLK  163

Query  440  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            QPDPCD EKLYQAV+DLCLHKMGG+LYQRI
Sbjct  164  QPDPCDSEKLYQAVSDLCLHKMGGNLYQRI  193



>ref|XP_004233125.1| PREDICTED: cullin-4 [Solanum lycopersicum]
Length=802

 Score =   132 bits (331),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 82/121 (68%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +2

Query  170  DTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklvi-  346
            D NKNGQ     +    +D    SM      G       T+NLSRKKAT PQP KK ++ 
Sbjct  35   DDNKNGQQQQQHHHHHHKDEPCVSMIQYSGGGV------TSNLSRKKATPPQPPKKQLVI  88

Query  347  klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQR  526
            KL KAKPTLPTNFEENTWATLKSAI+AIFLKQPDPCDLEKLYQAV DLCLHKMGGSLYQR
Sbjct  89   KLNKAKPTLPTNFEENTWATLKSAISAIFLKQPDPCDLEKLYQAVTDLCLHKMGGSLYQR  148

Query  527  I  529
            I
Sbjct  149  I  149



>ref|XP_010923713.1| PREDICTED: cullin-4-like isoform X2 [Elaeis guineensis]
Length=845

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 102/160 (64%), Gaps = 19/160 (12%)
 Frame = +2

Query  104  APPLHRPPPMKKAKSQ------AVACSLDTNKNGQHHVH---FYPDV-----DEDPSSAS  241
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  242  MEDLDSPGASA--TRAATANLSRKKATLPQpakklviklvkakp--TLPTNFEENTWATL  409
             EDL +  ++A  T    ANLSRKKAT PQP+ K  + +   K   TLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  410  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRI  192



>ref|XP_010923712.1| PREDICTED: cullin-4-like isoform X1 [Elaeis guineensis]
Length=870

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 107/160 (67%), Gaps = 19/160 (12%)
 Frame = +2

Query  104  APPLHRPPPMKKAKSQ------AVACSLDTNKNGQHHVH---FYPDV-----DEDPSSAS  241
            +P +     MKKAK Q      A A S++  KNG H VH   + P       +ED     
Sbjct  34   SPSVTTSSSMKKAKCQPAAAAAAAAVSVEREKNGLH-VHPTRYDPAAAQSAEEEDSMLLD  92

Query  242  MEDLDSPGASA--TRAATANLSRKKATLPQ--pakklviklvkakpTLPTNFEENTWATL  409
             EDL +  ++A  T    ANLSRKKAT PQ    K+LVIKLVK KPTLPTNFEE+TWATL
Sbjct  93   QEDLKAGASTAITTTGVAANLSRKKATPPQPSTKKQLVIKLVKGKPTLPTNFEEDTWATL  152

Query  410  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            KSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI
Sbjct  153  KSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRI  192



>gb|KHN47328.1| Cullin-4 [Glycine soja]
Length=777

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 102/162 (63%), Gaps = 38/162 (23%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRSS       TAG    P   PPPMKKAKS  +  S D +               
Sbjct  2    SLPTKRSS-------TAGSSLSP---PPPMKKAKSLLLRSSSDDH---------------  36

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
                    D   P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  37   --------DAVLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  83

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRI
Sbjct  84   KLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRI  125



>ref|XP_003546083.1| PREDICTED: cullin-4-like [Glycine max]
Length=788

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +2

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            DPSS  ++D D P A A     ANL+RKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA
Sbjct  40   DPSSMPLDD-DLPNARA-----ANLARKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWA  93

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRI
Sbjct  94   KLKSAIRAIFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRI  135



>ref|XP_008809585.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
 ref|XP_008809586.1| PREDICTED: cullin-4-like [Phoenix dactylifera]
Length=841

 Score =   123 bits (308),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 76/112 (68%), Positives = 84/112 (75%), Gaps = 6/112 (5%)
 Frame = +2

Query  209  PDVDEDPSSASMEDLDSPGASA---TRAATANLSRKKATLPQpakklvi--klvkakpTL  373
            P  +ED      +DL + GAS    T    ANLSRKKAT PQP+ K  +  KLVK KPTL
Sbjct  78   PAEEEDSMLVDQDDLKA-GASTDITTTGVAANLSRKKATPPQPSAKKQLVIKLVKGKPTL  136

Query  374  PTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            P NFEE+TWATLKSAI AIFLKQPDPCD EKLYQAV+DLCLHKMGG+LYQRI
Sbjct  137  PKNFEEDTWATLKSAITAIFLKQPDPCDSEKLYQAVSDLCLHKMGGNLYQRI  188



>ref|XP_007147910.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
 gb|ESW19904.1| hypothetical protein PHAVU_006G165300g [Phaseolus vulgaris]
Length=787

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 80/94 (85%), Gaps = 5/94 (5%)
 Frame = +2

Query  248  DLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINA  427
            D D P A A     ANLSRKKAT PQPAKKL+IKL KAKPTLPTNFEE+TWA LKSAI A
Sbjct  46   DDDLPNARA-----ANLSRKKATPPQPAKKLLIKLHKAKPTLPTNFEEDTWAKLKSAICA  100

Query  428  IFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            IFLKQP+ CDLEKLYQAVNDLCL+KMGG+LYQRI
Sbjct  101  IFLKQPNSCDLEKLYQAVNDLCLYKMGGNLYQRI  134



>ref|XP_003593913.1| Cullin [Medicago truncatula]
 gb|AES64164.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=768

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  DEDPSSASMED----LDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNF  385
            D+    +SM+D     D P   A     ANL+RKKAT PQPAKKL+I+L K  PT+P+NF
Sbjct  32   DDVVFDSSMDDDLKPTDLPRGGAASNMAANLARKKATPPQPAKKLLIRLHKGNPTVPSNF  91

Query  386  EENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            E+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDLC+HKMGG+LYQRI
Sbjct  92   EDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDLCIHKMGGNLYQRI  139



>ref|XP_003593911.1| Cullin [Medicago truncatula]
Length=794

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  DEDPSSASMED----LDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNF  385
            D+    +SM+D     D P   A     ANL+RKKAT PQPAKKL+I+L K  PT+P+NF
Sbjct  32   DDVVFDSSMDDDLKPTDLPRGGAASNMAANLARKKATPPQPAKKLLIRLHKGNPTVPSNF  91

Query  386  EENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            E+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDLC+HKMGG+LYQRI
Sbjct  92   EDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDLCIHKMGGNLYQRI  139



>ref|XP_003593912.1| Cullin [Medicago truncatula]
 gb|AES64163.1| ubiquitin-protein ligase, cullin 4 [Medicago truncatula]
Length=792

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +2

Query  218  DEDPSSASMED----LDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNF  385
            D+    +SM+D     D P   A     ANL+RKKAT PQPAKKL+I+L K  PT+P+NF
Sbjct  32   DDVVFDSSMDDDLKPTDLPRGGAASNMAANLARKKATPPQPAKKLLIRLHKGNPTVPSNF  91

Query  386  EENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            E+ TWA LKSAI AIFLKQPD CDLEKLYQAVNDLC+HKMGG+LYQRI
Sbjct  92   EDKTWAILKSAICAIFLKQPDSCDLEKLYQAVNDLCIHKMGGNLYQRI  139



>ref|XP_004981509.1| PREDICTED: cullin-4-like isoform X1 [Setaria italica]
Length=839

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 103/184 (56%), Gaps = 23/184 (13%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGQH--  193
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  194  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  343
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  344  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  517
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  518  YQRI  529
            Y+RI
Sbjct  175  YERI  178



>ref|XP_004981510.1| PREDICTED: cullin-4-like isoform X2 [Setaria italica]
Length=831

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 103/184 (56%), Gaps = 23/184 (13%)
 Frame = +2

Query  29   MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAK---SQAVACSLDTNKNGQH--  193
            MSQP +   +   P+SS +A+    +P    PP MKKAK   + A + +  T KNG H  
Sbjct  1    MSQPHAASKR---PFSSTTASPSLTSPA---PPLMKKAKHPAAAASSSAGTTEKNGIHLD  54

Query  194  ----------HVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklv  343
                            + D +   A  EDL +P A A+    ANL RKKATLPQP+    
Sbjct  55   AAVAAAGGGGSGRTNGEEDTEMVLADQEDLPAPSAQASAGVAANLFRKKATLPQPSTSAR  114

Query  344  i--klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSL  517
               ++   +P LP NFEE+TWA LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +L
Sbjct  115  KPLRIKIGQPKLPKNFEEDTWAILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANL  174

Query  518  YQRI  529
            Y+RI
Sbjct  175  YERI  178



>ref|XP_003524860.1| PREDICTED: cullin-4-like [Glycine max]
Length=775

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 91/135 (67%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAKS      +D+  +          V + P++AS    D P A A  AA  NLSR
Sbjct  8    PPMKKAKS------IDSKNDDA--------VLKSPAAAS----DDPNAPALVAA--NLSR  47

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI AIFLKQP  CDLE LYQAVN
Sbjct  48   KKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAIGAIFLKQPVSCDLENLYQAVN  107

Query  485  DLCLHKMGGSLYQRI  529
            DLCL+KMGG+LYQRI
Sbjct  108  DLCLYKMGGNLYQRI  122



>ref|XP_009101534.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=783

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 99/165 (60%), Gaps = 39/165 (24%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQH---HVHFYPD  214
            S P KRS+    CSA + D +      PPMKK+K            NG H    V F  D
Sbjct  2    SLPTKRST----CSAASTDSSLS---SPPMKKSK------------NGLHASDKVGFSMD  42

Query  215  VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEEN  394
             D  PSSA                 ANLSRKKATLP P KKLVIKL KAKP+LPTNFE+ 
Sbjct  43   EDPAPSSA-----------------ANLSRKKATLPHPTKKLVIKLNKAKPSLPTNFEDT  85

Query  395  TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY+RI
Sbjct  86   TWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLYERI  130



>ref|XP_006414121.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
 gb|ESQ55574.1| hypothetical protein EUTSA_v10024458mg [Eutrema salsugineum]
Length=789

 Score =   114 bits (286),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 79/135 (59%), Positives = 88/135 (65%), Gaps = 19/135 (14%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            NG H      + D D  + SMED  +P A       ANLSR
Sbjct  21   PPMKKAK------------NGLHQTPQSQEDDNDKEAFSMEDDPTPAA-------ANLSR  61

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL KAKPTLPTNFEENTWA L+SAI AIFL +P   D E LYQAV+
Sbjct  62   KKATLPQPTKKLVIKLNKAKPTLPTNFEENTWAKLQSAIQAIFLMKPVTFDFEGLYQAVD  121

Query  485  DLCLHKMGGSLYQRI  529
            +LCLHK+   LYQ+I
Sbjct  122  NLCLHKLEEKLYQQI  136



>gb|KHN12460.1| Cullin-4 [Glycine soja]
Length=760

 Score =   114 bits (285),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 67/102 (66%), Positives = 74/102 (73%), Gaps = 2/102 (2%)
 Frame = +2

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            D  +A+    D P A A  AA  NLSRKKAT P P KK +I+  K  PTLP NFEE TWA
Sbjct  8    DSKNAAASASDDPNAPALIAA--NLSRKKATPPHPPKKFLIRFHKGVPTLPPNFEEETWA  65

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LKSAI AIF+KQP  CDLE LYQAVNDLCL+KMGG+LYQRI
Sbjct  66   KLKSAIGAIFMKQPVSCDLENLYQAVNDLCLYKMGGNLYQRI  107



>emb|CDX77644.1| BnaC07g18980D [Brassica napus]
Length=767

 Score =   114 bits (285),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 85/117 (73%), Gaps = 7/117 (6%)
 Frame = +2

Query  179  KNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk  358
            KNG H     P+   D +  SME+  +P      +A ANLSRKKATLPQP KKLVIKL K
Sbjct  5    KNGLHAPSSQPNA-SDKAVFSMEEDPAP------SAAANLSRKKATLPQPTKKLVIKLNK  57

Query  359  akpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            AKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV DLCLHK+ G LY+RI
Sbjct  58   AKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVGDLCLHKLEGKLYERI  114



>ref|XP_006398310.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39763.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=539

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 102/162 (63%), Gaps = 23/162 (14%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSSYS--SPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RI
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERI  140



>ref|XP_008383554.1| PREDICTED: cullin-4-like, partial [Malus domestica]
Length=458

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEE TWA LKSAI+AIFLK+PD CDLEKLYQAVNDLCLHKMGGSLYQRI
Sbjct  7    TLPTNFEEETWAKLKSAISAIFLKKPDSCDLEKLYQAVNDLCLHKMGGSLYQRI  60



>ref|XP_006398309.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39762.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=578

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 102/162 (63%), Gaps = 23/162 (14%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSSYS--SPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RI
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERI  140



>ref|XP_004486019.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Cicer arietinum]
Length=787

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 97/162 (60%), Gaps = 28/162 (17%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRSS  +S S               MKK KS +           QHH     D   
Sbjct  2    SLPTKRSSGATSTS---------------MKKFKSHS---------QQQHH----DDAVL  33

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            DPSS SM   D   ++A     ANLSRKKAT PQP KKL+IK  KAKPTLPTNFEE TWA
Sbjct  34   DPSSLSMPLDDDLKSNARSVMAANLSRKKATPPQPLKKLLIKFHKAKPTLPTNFEEETWA  93

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LKSAI AIFLKQP+ C+ E LYQAV+ LC +KMGG+LY+RI
Sbjct  94   NLKSAICAIFLKQPNSCEKENLYQAVSSLCSYKMGGNLYERI  135



>ref|XP_006585082.1| PREDICTED: cullin-4-like isoform X2 [Glycine max]
Length=757

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 84/135 (62%), Gaps = 26/135 (19%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  485  DLCLHKMGGSLYQRI  529
            DLCL+KMGG+LYQRI
Sbjct  102  DLCLYKMGGNLYQRI  116



>ref|XP_003532695.2| PREDICTED: cullin-4-like isoform X1 [Glycine max]
Length=769

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 84/135 (62%), Gaps = 26/135 (19%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAKS                      +D   ++AS  D   P A A  AA  NLSR
Sbjct  8    PPMKKAKS----------------------IDSKNAAASASD--DPNAPALIAA--NLSR  41

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKAT P P KK +I+  K  PTLP NFEE TWA LKSAI AIF+KQP  CDLE LYQAVN
Sbjct  42   KKATPPHPPKKFLIRFHKGVPTLPPNFEEETWAKLKSAIGAIFMKQPVSCDLENLYQAVN  101

Query  485  DLCLHKMGGSLYQRI  529
            DLCL+KMGG+LYQRI
Sbjct  102  DLCLYKMGGNLYQRI  116



>ref|XP_006398308.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
 gb|ESQ39761.1| hypothetical protein EUTSA_v10000782mg [Eutrema salsugineum]
Length=793

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 102/162 (63%), Gaps = 23/162 (14%)
 Frame = +2

Query  44   SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE  223
            S P KRS+  SS S  + D +     PPPMKKAK            NG H     P+   
Sbjct  2    SLPTKRSTC-SSASPASTDSSYS--SPPPMKKAK------------NGLHTPSSQPNA-A  45

Query  224  DPSSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWA  403
            D     MED  +P A       ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFEE TW 
Sbjct  46   DKVGFPMEDDATPAA-------ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEEITWE  98

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             L+SAI AIFLK+P   DLE+LYQAV++LCLHK+ G LY+RI
Sbjct  99   KLQSAIRAIFLKKPVSFDLERLYQAVDNLCLHKLEGKLYERI  140



>ref|XP_006836434.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
 gb|ERM99287.1| hypothetical protein AMTR_s00092p00163840 [Amborella trichopoda]
Length=822

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  257  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  436
            S G S T  A ANLSRKKAT PQP KKLVI+  K KP LPTNFEE+TWA LKSAI+AI L
Sbjct  80   SAGCSGTGMA-ANLSRKKATPPQPTKKLVIRPFKDKPKLPTNFEEDTWAKLKSAISAILL  138

Query  437  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            KQP  C LE+LYQAVNDLCLHKMGG+LY+RI
Sbjct  139  KQPVSCSLEELYQAVNDLCLHKMGGNLYKRI  169



>emb|CDY33461.1| BnaA06g36120D [Brassica napus]
Length=761

 Score =   110 bits (276),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 72/123 (59%), Positives = 85/123 (69%), Gaps = 17/123 (14%)
 Frame = +2

Query  167  LDTNKNGQHHVHFYPD--VDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl  340
            +  +KNG H     P+  +DEDP+ +               A ANLSRKKATLP P KKL
Sbjct  1    MKKSKNGLHAPSSQPNASMDEDPAPS---------------AAANLSRKKATLPHPTKKL  45

Query  341  viklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            VIKL KAKP+LPTNFE+ TW  L+SAI AIFLKQP P DLE+LYQAV+DLCLHK+ G LY
Sbjct  46   VIKLNKAKPSLPTNFEDTTWENLQSAIRAIFLKQPFPFDLERLYQAVDDLCLHKLEGKLY  105

Query  521  QRI  529
            +RI
Sbjct  106  ERI  108



>emb|CDY35152.1| BnaA09g17890D [Brassica napus]
Length=786

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 29/136 (21%)
 Frame = +2

Query  122  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  482  NDLCLHKMGGSLYQRI  529
            +DLCLHK+ G LY+R+
Sbjct  118  DDLCLHKLEGKLYERM  133



>ref|NP_568658.1| cullin4 [Arabidopsis thaliana]
 sp|Q8LGH4.1|CUL4_ARATH RecName: Full=Cullin-4; Short=AtCUL4 [Arabidopsis thaliana]
 gb|AAM60859.1| cullin [Arabidopsis thaliana]
 gb|AED95353.1| cullin4 [Arabidopsis thaliana]
Length=792

 Score =   110 bits (275),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 75/135 (56%), Positives = 86/135 (64%), Gaps = 19/135 (14%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  485  DLCLHKMGGSLYQRI  529
            +LCLHK+ G LY +I
Sbjct  125  NLCLHKLDGKLYDQI  139



>ref|XP_006650698.1| PREDICTED: cullin-4-like [Oryza brachyantha]
Length=829

 Score =   109 bits (272),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 69/146 (47%), Positives = 84/146 (58%), Gaps = 13/146 (9%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQHHVHFYPDV------------DEDPSSASMEDLDSPGASA  274
            MKKAK    + S       ++ +H  P V            D +   A  E+L +P AS 
Sbjct  31   MKKAKFPGSSSSSAPGATEKNGLHVDPAVVARSGGRTNGEEDAEMVLADQEELPAPSASP  90

Query  275  TRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLKSAINAIFLKQPDP  451
                 ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK AI AIFLKQ   
Sbjct  91   PAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILKDAITAIFLKQKLS  150

Query  452  CDLEKLYQAVNDLCLHKMGGSLYQRI  529
            CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  151  CDVEKLYQAAGDLCLHKLGANLYERI  176



>gb|EMT18857.1| Cullin-4B [Aegilops tauschii]
Length=758

 Score =   108 bits (271),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka----kpTLPTNFEENTWA  403
            A  ++L +P ASA    TANL RKKATLPQP      +        +P LP NFEE+TWA
Sbjct  4    ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  63

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R+
Sbjct  64   ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERV  105



>ref|XP_002863417.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39676.1| hypothetical protein ARALYDRAFT_916814 [Arabidopsis lyrata subsp. 
lyrata]
Length=791

 Score =   108 bits (271),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 77/135 (57%), Positives = 87/135 (64%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNT-ADKVGFHMEEDPTPAA-------ANLSR  63

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFLKKPFSFDLESLYQAVD  123

Query  485  DLCLHKMGGSLYQRI  529
            +LCLHK+ G LY +I
Sbjct  124  NLCLHKLEGKLYDQI  138



>gb|AAM14063.1| putative cullin [Arabidopsis thaliana]
Length=792

 Score =   108 bits (270),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 74/135 (55%), Positives = 85/135 (63%), Gaps = 19/135 (14%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKK K            N  HH   +P+  +      ME+  +P A       ANLSR
Sbjct  24   PPMKKTK------------NDLHHSPQHPNTADKVVGFHMEEDPTPAA-------ANLSR  64

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE LYQAV+
Sbjct  65   KKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVD  124

Query  485  DLCLHKMGGSLYQRI  529
            +LCLHK+ G LY +I
Sbjct  125  NLCLHKLDGKLYDQI  139



>ref|XP_009114369.1| PREDICTED: cullin-4-like [Brassica rapa]
Length=786

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 88/136 (65%), Gaps = 29/136 (21%)
 Frame = +2

Query  122  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PPPMKK+K            NG H    +P  DEDP               T +A ANLS
Sbjct  27   PPPMKKSK------------NGLHSP--FPMEDEDP---------------TPSAAANLS  57

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKATLP P KKLVIKL KAKPTLPTNFE+ TWA L+SAI AIFLK+P   DLE+LYQAV
Sbjct  58   RKKATLPHPTKKLVIKLNKAKPTLPTNFEDTTWANLQSAIRAIFLKKPFSFDLERLYQAV  117

Query  482  NDLCLHKMGGSLYQRI  529
            + LCLHK+ G LY+R+
Sbjct  118  DALCLHKLEGKLYERM  133



>dbj|BAK02870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=832

 Score =   107 bits (268),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka----kpTLPTNFEENTWA  403
            A  ++L +P ASA    TANL RKKATLPQP      +        +P LP NFEE+TWA
Sbjct  78   ADQDELRAPNASAPGGGTANLFRKKATLPQPPATAATRKPLRIKIGQPKLPKNFEEDTWA  137

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R+
Sbjct  138  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERV  179



>ref|XP_010529158.1| PREDICTED: cullin-4 [Tarenaya hassleriana]
Length=788

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 89/136 (65%), Gaps = 21/136 (15%)
 Frame = +2

Query  122  PPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLS  301
            PPPMKKAK            NG HH    P   +D     M++       + RA  +NLS
Sbjct  23   PPPMKKAK------------NGLHHP---PQPHDDKEVFPMDE------DSARAPASNLS  61

Query  302  RKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAV  481
            RKKAT PQPAKKLVIKL KAKPTLPTNFEE TW  L+SAI AIF+K+P   DLE LYQAV
Sbjct  62   RKKATPPQPAKKLVIKLNKAKPTLPTNFEETTWEKLQSAIRAIFMKKPVSFDLEGLYQAV  121

Query  482  NDLCLHKMGGSLYQRI  529
            ++LCLHKM G LYQ+I
Sbjct  122  DNLCLHKMEGKLYQQI  137



>emb|CDY03235.1| BnaC09g19210D [Brassica napus]
Length=790

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 89/139 (64%), Gaps = 32/139 (23%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQH----HVHFYPDVDEDPSSASMEDLDSPGASATRAATA  292
            PPMKK+K            NG H     V F P  DEDP               T +A A
Sbjct  27   PPMKKSK------------NGLHTPSDKVPF-PMEDEDP---------------TPSAAA  58

Query  293  NLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            NLSRKKATLPQP KKLVIKL KAKPTLPTNFE+ TW  L+SAI AIFLK+P   DLE+LY
Sbjct  59   NLSRKKATLPQPTKKLVIKLNKAKPTLPTNFEDTTWDNLQSAIRAIFLKKPFSFDLERLY  118

Query  473  QAVNDLCLHKMGGSLYQRI  529
            QAV+DLCLHK+ G LY+R+
Sbjct  119  QAVDDLCLHKLEGKLYERM  137



>ref|XP_002466340.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
 gb|EER93338.1| hypothetical protein SORBIDRAFT_01g005920 [Sorghum bicolor]
Length=834

 Score =   106 bits (264),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka--kpTLPTNFEENTWATL  409
            A  ++L +P A A+    ANL RKKATLPQP+      L     +P LP NFEE+TWA L
Sbjct  82   ADQDELPAPSAPASAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEEDTWAIL  141

Query  410  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            K AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  142  KDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  181



>ref|XP_003558082.1| PREDICTED: cullin-4 [Brachypodium distachyon]
Length=830

 Score =   106 bits (264),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvka----kpTLPTNFEENTWA  403
            A  ++L +P AS     TANL RKKATLPQP+     +        +P LP NFEE+TWA
Sbjct  76   ADQDELRAPSASVPGGVTANLFRKKATLPQPSATSATRKPLRIKIGQPKLPKNFEEDTWA  135

Query  404  TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+R+
Sbjct  136  ILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERV  177



>emb|CDY43957.1| BnaA02g24350D [Brassica napus]
Length=776

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 89/135 (66%), Gaps = 22/135 (16%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            NG H     P  D+       ED D P  SA     ANLSR
Sbjct  11   PPMKKAK------------NGLHT----PSADKVGFPMEEEDED-PTPSA-----ANLSR  48

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP+KKLVIKL KAKP+LPTNFE+ TW  L+SAI AIFLK P P DLE+LYQAV+
Sbjct  49   KKATLPQPSKKLVIKLNKAKPSLPTNFEDTTWDNLQSAIRAIFLKHPFPFDLERLYQAVD  108

Query  485  DLCLHKMGGSLYQRI  529
            +LCLHK+ G LY+RI
Sbjct  109  NLCLHKLEGKLYKRI  123



>gb|KHN46079.1| Cullin-4 [Glycine soja]
Length=764

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 72/96 (75%), Gaps = 3/96 (3%)
 Frame = +2

Query  251  LDSPGASA---TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  421
            L SP A++      A   LSRKKAT P P KKL+IK  K  PTLP NFEE+TWA LKSAI
Sbjct  16   LKSPAAASDDPNAPALVILSRKKATPPHPPKKLLIKFHKGIPTLPPNFEEDTWAKLKSAI  75

Query  422  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AIFLKQP  CDLE LYQAVNDLCL+KMGG+LYQRI
Sbjct  76   GAIFLKQPVSCDLENLYQAVNDLCLYKMGGNLYQRI  111



>ref|XP_008644442.1| PREDICTED: cullin-4 [Zea mays]
 gb|AFW67428.1| hypothetical protein ZEAMMB73_322823 [Zea mays]
Length=831

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 67/147 (46%), Positives = 79/147 (54%), Gaps = 14/147 (10%)
 Frame = +2

Query  131  MKKAKSQAVACS------------LDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASA  274
            MKKAK  A A S            LDT            + D D    + + L +P   A
Sbjct  32   MKKAKHPAAASSSSVGTVEKNGIQLDTVAAAMGGGRTNGEEDADMVLVNQDKLPAPSVPA  91

Query  275  TRAATANLSRKKATLPQpakklviklvka--kpTLPTNFEENTWATLKSAINAIFLKQPD  448
            +    ANL RKKATLPQP+      L     +P LP NFEE+TW+ LK AI AIFLKQ  
Sbjct  92   SAGVAANLFRKKATLPQPSTSARKPLRIKIGQPKLPKNFEEDTWSILKDAITAIFLKQKL  151

Query  449  PCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             CD+EKLYQA  DLCLHK+G +LY RI
Sbjct  152  SCDVEKLYQAAGDLCLHKLGANLYDRI  178



>tpg|DAA51790.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=635

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 84/147 (57%), Gaps = 14/147 (10%)
 Frame = +2

Query  131  MKKAKS-QAVACSLDT-NKNGQH----------HVHFYPDVDEDPSSASMEDLDSPGASA  274
            MKKAK   A A S+ T  KNG H                + D +      ++L +P A A
Sbjct  33   MKKAKHPAATASSVGTVEKNGIHLDTAAAAATGGGRTNGEEDAEMVLVDQDELPAPSAPA  92

Query  275  TRAATANLSRKKATLPQpakklvi--klvkakpTLPTNFEENTWATLKSAINAIFLKQPD  448
            +    ANL RKKATLPQP+       ++   +P LP NFEE+TW  LK AI AIFLKQ  
Sbjct  93   SAGVAANLFRKKATLPQPSTSARKPLRIRIGQPKLPKNFEEDTWTILKDAITAIFLKQKL  152

Query  449  PCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  153  SCDVEKLYQAAGDLCLHKLGANLYERI  179



>gb|KFK31486.1| cullin [Arabis alpina]
Length=793

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 92/137 (67%), Gaps = 24/137 (18%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHF--YPDVDEDPSSASMEDLDSPGASATRAATANL  298
            PPMKK+K+      L T  + QH  +   +P ++EDP+ A+                ANL
Sbjct  26   PPMKKSKN-----GLHTPPSSQHQSNAAGFP-MEEDPTPAA----------------ANL  63

Query  299  SRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQA  478
            SRKKATLP P KKLVIKL KAKPTLPTNFEE TW  L+SAI AIFLK+P   DLE+LYQA
Sbjct  64   SRKKATLPHPTKKLVIKLNKAKPTLPTNFEETTWENLQSAIIAIFLKKPFSFDLERLYQA  123

Query  479  VNDLCLHKMGGSLYQRI  529
            V++LCLHK+ G LY+RI
Sbjct  124  VDNLCLHKLEGKLYERI  140



>ref|XP_009128848.1| PREDICTED: cullin-4 [Brassica rapa]
Length=785

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 84/123 (68%), Gaps = 22/123 (18%)
 Frame = +2

Query  179  KNGQH-----HVHF-YPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl  340
            KNG H      V F   + DEDP+         P A       ANLSRKKATLPQP+KKL
Sbjct  26   KNGLHPPSADKVGFPMEEEDEDPT---------PSA-------ANLSRKKATLPQPSKKL  69

Query  341  viklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            VIKL KAKP+LPTNFE+ TW  L+SAI AIFLKQP   DLE+LYQAV++LCLHK+ G LY
Sbjct  70   VIKLNKAKPSLPTNFEDTTWDNLQSAIRAIFLKQPFSFDLERLYQAVDNLCLHKLEGKLY  129

Query  521  QRI  529
            QRI
Sbjct  130  QRI  132



>ref|XP_010495750.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=743

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 85/135 (63%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  485  DLCLHKMGGSLYQRI  529
            DLC+HK+ G LYQ+I
Sbjct  124  DLCMHKLAGKLYQQI  138



>emb|CDX87735.1| BnaC02g32140D [Brassica napus]
Length=780

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 5/96 (5%)
 Frame = +2

Query  242  MEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAI  421
            ME+ + P  SA     ANLSRKKATLPQP+KKLVIKL KAKP+LPTNFE+ TW  L+SAI
Sbjct  37   MEEEEDPTPSA-----ANLSRKKATLPQPSKKLVIKLNKAKPSLPTNFEDTTWDNLQSAI  91

Query  422  NAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AIFLK P P DLE+LYQAV++LCLH++ G LY+RI
Sbjct  92   RAIFLKHPFPFDLERLYQAVDNLCLHRLEGKLYKRI  127



>ref|XP_010484784.1| PREDICTED: cullin-4-like [Camelina sativa]
Length=784

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 85/135 (63%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL KAKPTLP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPTLPKNFEETTWEQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  485  DLCLHKMGGSLYQRI  529
            DLC+HK+ G LYQ+I
Sbjct  124  DLCMHKLAGKLYQQI  138



>gb|KFK28509.1| cullin 4 [Arabis alpina]
Length=782

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 9/109 (8%)
 Frame = +2

Query  209  PDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLPQpakkl--viklvkakpTLPTN  382
            P   +D +  SME+   P A       ANLSRKKATLPQP KKL   +  VK KP+LPTN
Sbjct  28   PHSHDDDNDYSMEEDHIPAA-------ANLSRKKATLPQPTKKLVIKLNKVKGKPSLPTN  80

Query  383  FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            FEE+TWA L+++INAIFL +P P DLE+LYQAV++ CLHK+   LYQRI
Sbjct  81   FEESTWANLQASINAIFLMKPVPYDLERLYQAVDNFCLHKLEEKLYQRI  129



>gb|EEE60060.1| hypothetical protein OsJ_12866 [Oryza sativa Japonica Group]
Length=804

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  412
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  413  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  151



>gb|AAT75245.1| putative cullin protein [Oryza sativa Japonica Group]
Length=813

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  412
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  413  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  151



>gb|EEC76292.1| hypothetical protein OsI_13805 [Oryza sativa Indica Group]
Length=744

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  412
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  53   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  112

Query  413  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  113  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  151



>gb|ABF99238.1| Cullin-4B, putative, expressed [Oryza sativa Japonica Group]
Length=836

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = +2

Query  236  ASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvk-akpTLPTNFEENTWATLK  412
            A  E+L +P ASA     ANL RKKATLPQP+       +K  +P LPTNFEE+TWA LK
Sbjct  85   ADQEELAAPSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILK  144

Query  413  SAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
             AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  145  DAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  183



>gb|KHN29857.1| Cullin-4 [Glycine soja]
Length=276

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLPTNFEE+TWA LKSAI AIFLKQP+ CDLEKLYQAVNDLCL+KMG +L+Q+I
Sbjct  7    TLPTNFEEDTWAKLKSAICAIFLKQPNSCDLEKLYQAVNDLCLYKMGVNLHQQI  60



>emb|CAC85265.1| cullin 4 [Arabidopsis thaliana]
Length=742

 Score =   100 bits (249),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  284  ATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLE  463
            A ANLSRKKATLPQP KK VIKL KAKPTLPTNFEENTW  L+SAI AIFLK+    DLE
Sbjct  8    AAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLE  67

Query  464  KLYQAVNDLCLHKMGGSLYQRI  529
             LYQAV++LCLHK+ G LY +I
Sbjct  68   SLYQAVDNLCLHKLDGKLYDQI  89



>ref|XP_006281916.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
 gb|EOA14814.1| hypothetical protein CARUB_v10028121mg [Capsella rubella]
Length=791

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 84/135 (62%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL K KPTLP NFEE TW  L+SAI AIFLK+P    LE LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKVKPTLPKNFEETTWENLQSAIRAIFLKKPFSFHLESLYQAVD  123

Query  485  DLCLHKMGGSLYQRI  529
            + CLHK+ G LYQ+I
Sbjct  124  NFCLHKLDGKLYQQI  138



>ref|XP_010441611.1| PREDICTED: cullin-4 [Camelina sativa]
Length=791

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 85/135 (63%), Gaps = 20/135 (15%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSR  304
            PPMKKAK            N  HH   +P+   D     ME+  +P A       ANLSR
Sbjct  24   PPMKKAK------------NDLHHSPQHPNA-ADKVGFPMEEDPTPAA-------ANLSR  63

Query  305  KKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KKATLPQP KKLVIKL KAKP+LP NFEE TW  L+SAI AIFLK+P     E LYQAV+
Sbjct  64   KKATLPQPTKKLVIKLNKAKPSLPKNFEETTWQQLQSAIRAIFLKKPFSFHFESLYQAVD  123

Query  485  DLCLHKMGGSLYQRI  529
            DLC+HK+ G LYQ+I
Sbjct  124  DLCMHKLAGKLYQQI  138



>ref|XP_010518764.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4-like [Tarenaya hassleriana]
Length=788

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 77/138 (56%), Positives = 87/138 (63%), Gaps = 28/138 (20%)
 Frame = +2

Query  122  PPPMKKAKSQAVACSLDTNKNGQHH--VHFYPDVDEDPSSASMEDLDSPGASATRAATAN  295
            PPPMKKAK            NG HH     +P +DED              +   +A AN
Sbjct  27   PPPMKKAK------------NGLHHHDKEVFP-MDED-------------PAPAASAAAN  60

Query  296  LSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQ  475
            LSRKK+T PQPAKKLVIKL KAKP LPTNFEE TWA L+SAI AIF K+    DLE LYQ
Sbjct  61   LSRKKSTPPQPAKKLVIKLNKAKPILPTNFEETTWAKLQSAIRAIFKKEAVSFDLEGLYQ  120

Query  476  AVNDLCLHKMGGSLYQRI  529
            AV++LCLHKM G LYQ+I
Sbjct  121  AVDNLCLHKMEGKLYQQI  138



>ref|XP_011460204.1| PREDICTED: cullin-4 [Fragaria vesca subsp. vesca]
Length=797

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 72/135 (53%), Positives = 80/135 (59%), Gaps = 21/135 (16%)
 Frame = +2

Query  131  MKKAKSQAVACSLDTNKNGQ-HHVHFYPDVDEDPSSASMEDLDSPGASATRAATANLSRK  307
            MKKAKSQ    S   +KNG  HH H   D D+D                 RA   NLSRK
Sbjct  29   MKKAKSQ----SQPDSKNGLFHHHHNSSDNDDD---------------GRRAQPDNLSRK  69

Query  308  KATLPQpakklviklv-kakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN  484
            KA  PQP KK  +    KAKP +P N EE TW  LKSAI AIF K+P  C LE+LYQAV 
Sbjct  70   KAQPPQPGKKQFVIKPFKAKPAVPKNLEEETWEILKSAICAIFEKKPVSCVLEELYQAVY  129

Query  485  DLCLHKMGGSLYQRI  529
            +LC+HKMGGSLYQRI
Sbjct  130  NLCVHKMGGSLYQRI  144



>ref|XP_001764780.1| predicted protein [Physcomitrella patens]
 gb|EDQ70479.1| predicted protein [Physcomitrella patens]
Length=745

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 4/91 (4%)
 Frame = +2

Query  257  SPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFL  436
            SPG       TANLSRKKAT PQPA+KLVIK  K KP LP +FEE TWA L+ A+ AI L
Sbjct  6    SPGI----GTTANLSRKKATPPQPARKLVIKPFKEKPKLPKDFEEVTWAKLREAVTAIHL  61

Query  437  KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            KQP  C LE+LY+AV DLCLHKM G+LY+R+
Sbjct  62   KQPVNCSLEELYRAVEDLCLHKMAGNLYRRL  92



>ref|XP_002984123.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
 gb|EFJ14633.1| ubiquitin-protein ligase, cullin 4 [Selaginella moellendorffii]
Length=766

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  263  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  442
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  443  PDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            P  C LE+LYQ V DLCLHK+ G+LYQR+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRL  113



>ref|XP_002972211.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
 gb|EFJ26297.1| ubiquitin-protein ligase, Cullin 4 [Selaginella moellendorffii]
Length=766

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  263  GASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQ  442
            G S +   TANLSRKKAT PQP KKLVIK  K KP LP NFE+ TW  +++A++AI +KQ
Sbjct  25   GGSNSTGTTANLSRKKATPPQPTKKLVIKPFKDKPKLPANFEDATWDKIRAAVSAIHVKQ  84

Query  443  PDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            P  C LE+LYQ V DLCLHK+ G+LYQR+
Sbjct  85   PVSCSLEQLYQNVEDLCLHKLSGNLYQRL  113



>ref|XP_001776334.1| predicted protein [Physcomitrella patens]
 gb|EDQ58833.1| predicted protein [Physcomitrella patens]
Length=768

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 57/92 (62%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = +2

Query  254  DSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIF  433
            ++PG       TANLSRKKAT P PAKKLVIK  K KP LP NFEE TW  +K A+ AI 
Sbjct  28   NNPGV----GTTANLSRKKATPPPPAKKLVIKPFKDKPKLPANFEEVTWVKIKEAVTAIH  83

Query  434  LKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LKQP  C LE+LY+AV DLC+HKM G+LY+R+
Sbjct  84   LKQPVNCSLEELYRAVEDLCVHKMAGNLYKRL  115



>tpg|DAA51791.1| TPA: hypothetical protein ZEAMMB73_453479, partial [Zea mays]
Length=517

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFEE+TW  LK AI AIFLKQ   CD+EKLYQA  DLCLHK+G +LY+RI
Sbjct  9    LPKNFEEDTWTILKDAITAIFLKQKLSCDVEKLYQAAGDLCLHKLGANLYERI  61



>gb|ACA52121.1| cullin 4 [Vitis vinifera]
Length=153

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  431  FLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            FLKQPDPCDLEKLYQAVNDLCLHKMGG+LYQRI
Sbjct  1    FLKQPDPCDLEKLYQAVNDLCLHKMGGNLYQRI  33



>gb|KIZ03018.1| cullin 4 [Monoraphidium neglectum]
Length=404

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFE++TWA L+ A++A+  K+   C LE+LY+AV D+C HKM  SLY+R+
Sbjct  30   LPANFEQDTWAKLEDAVDAVHCKRTVACSLEELYRAVEDMCSHKMQDSLYRRL  82



>ref|XP_002947918.1| hypothetical protein VOLCADRAFT_57881 [Volvox carteri f. nagariensis]
 gb|EFJ50906.1| hypothetical protein VOLCADRAFT_57881 [Volvox carteri f. nagariensis]
Length=755

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFEE TW+ L+  I A+  K+P  C LE+LY AV D+C+HKM   LY R+
Sbjct  4    LPANFEEATWSKLRDCIMAVHCKRPVSCSLEELYTAVQDMCMHKMADKLYSRL  56



>ref|XP_001703219.1| cullin [Chlamydomonas reinhardtii]
 gb|EDO96515.1| cullin [Chlamydomonas reinhardtii]
Length=782

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFEE+TW+ L+  I A+  K+P    LE+LY AV D+C+HKM   LY R+
Sbjct  41   LPANFEESTWSKLRDCIIAVHCKRPVSNSLEELYTAVQDMCMHKMADKLYTRL  93



>ref|XP_005825979.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
 gb|EKX38999.1| hypothetical protein GUITHDRAFT_160035 [Guillardia theta CCMP2712]
Length=789

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP  FEE+TW  LK +++A+  +QP     E+LY+AV DLC+HK+G +LY R+
Sbjct  89   LPETFEEDTWKKLKMSVHAVHREQPVEQSFEELYKAVEDLCIHKLGPNLYSRL  141



>emb|CBJ49182.1| conserved unknown protein [Ectocarpus siliculosus]
Length=750

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP  FE++TW  L+ A+ AI  KQP     E+LY+AV DLC+HKMG +LY R+
Sbjct  38   LPEQFEDSTWEMLQRAVVAIQTKQPIDTSREELYRAVEDLCVHKMGANLYDRL  90



>gb|ESA04652.1| hypothetical protein GLOINDRAFT_85233, partial [Rhizophagus irregularis 
DAOM 181602]
Length=769

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+EE TW+ L++A+ AIF  Q     LE+LY+A  +LCLHKM  SLY+R+
Sbjct  54   LPDNYEEVTWSKLQAAVQAIFNYQRIGTSLEELYKACENLCLHKMAPSLYKRL  106



>ref|XP_005644988.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20444.1| Cullin-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=733

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +2

Query  296  LSRKKATLPQpakklvi-klvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLY  472
            +SR KA  PQ A + ++ K +K++P LP +FE  TW  L+ A+ A+  K+P  C LE+LY
Sbjct  1    MSRTKANGPQAAPRKLVIKPLKSRPQLPADFEARTWGKLREAVLAVHAKRPVSCSLEELY  60

Query  473  QAVNDLCLHKMGGSLY  520
              V D+CLHKM   LY
Sbjct  61   GLVEDMCLHKMADRLY  76



>ref|XP_002504743.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66001.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP +FEE++W  L +A++A+  K+P     E LY+ V D+CLHK+G  LY R+
Sbjct  45   LPADFEEDSWRMLSNAVDAVHQKRPVSESFETLYRRVEDVCLHKLGAGLYARL  97



>ref|XP_003729103.1| PREDICTED: cullin-4A-like [Strongylocentrotus purpuratus]
Length=776

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+++ TW  LK A+ AI   +P    LE+LYQAV ++C HKM  SLY ++
Sbjct  102  LPANYQQQTWDRLKEAVQAIHKSRPIKYSLEELYQAVENMCSHKMSASLYDQL  154



>gb|ERL94806.1| hypothetical protein D910_12080 [Dendroctonus ponderosae]
Length=752

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP ++ E TW  LKSA+ AI   +P+   LE+LYQAV ++C HKM   LYQ++
Sbjct  47   LPDDYREQTWKKLKSAVLAIQQSKPNEYSLEELYQAVENMCNHKMAFLLYQKL  99



>gb|ENN80292.1| hypothetical protein YQE_03285, partial [Dendroctonus ponderosae]
Length=752

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP ++ E TW  LKSA+ AI   +P+   LE+LYQAV ++C HKM   LYQ++
Sbjct  47   LPDDYREQTWKKLKSAVLAIQQSKPNEYSLEELYQAVENMCNHKMAFLLYQKL  99



>gb|EWM25493.1| ubiquitin-protein cullin 4 [Nannochloropsis gaditana]
Length=828

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFE+ TW  L+ A+ A+  K       E+LY+AV +LC+HKMG  LY R+
Sbjct  53   LPENFEDATWEVLRQAVVAVQSKTAVAISYEELYRAVENLCVHKMGARLYDRL  105



>gb|ACE75802.1| cullin-4A (predicted) [Sorex araneus]
Length=732

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ ++TW  L  A+ AI    P  C+LE+LYQAV +LC HK+  +LY+++
Sbjct  53   LPDNYTQDTWRQLHEAVRAIQSSTPVTCNLEELYQAVENLCSHKVSPALYKQL  105



>ref|XP_001656862.1| AAEL003466-PB [Aedes aegypti]
 ref|XP_001656863.1| AAEL003466-PA [Aedes aegypti]
 gb|EAT45256.1| AAEL003466-PB [Aedes aegypti]
 gb|EAT45257.1| AAEL003466-PA [Aedes aegypti]
Length=759

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            TLP N++E+TW  L++A+ AI    P    LE+LYQAV ++C HKM   LY
Sbjct  51   TLPENYQEHTWQKLRAAVVAIQTSTPIEYSLEELYQAVENMCSHKMDSQLY  101



>ref|XP_006823839.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like [Saccoglossus 
kowalevskii]
Length=808

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 49/150 (33%), Positives = 66/150 (44%), Gaps = 15/150 (10%)
 Frame = +2

Query  125  PPMKKAKSQAVACSLDTN------KNGQHHVH-----FYPDVDEDPSSASMEDLDSPGAS  271
            P     KS  +   L+TN          HH+      F  D   + S  +      P  S
Sbjct  2    PLTSTEKSPFIKTELETNLKKRRPDENNHHLQNSSKKFRDDSPNESSPMADSTQRRPNFS  61

Query  272  ATRAATANLSRKKATL----PQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLK  439
            A        + + + L    P   KKLVIK  + KP LP N++E TW  LK A+ AI   
Sbjct  62   ALNPTNNGFTNRTSPLANTKPGSTKKLVIKNFRVKPELPENYQERTWGKLKEAVQAIHKH  121

Query  440  QPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
                  LE+LYQAV ++C HKM  SLY ++
Sbjct  122  TSIKYSLEELYQAVENMCSHKMSASLYDKL  151



>ref|XP_001870810.1| cullin [Culex quinquefasciatus]
 gb|EDS34192.1| cullin [Culex quinquefasciatus]
Length=759

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            TLP N++E TW  L+ A+ AI L +     LE+LYQAV ++C HKM   LY
Sbjct  51   TLPENYQETTWQKLREAVIAIQLSKRIEYSLEELYQAVENMCSHKMDSQLY  101



>ref|XP_006677802.1| hypothetical protein BATDEDRAFT_19177 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81454.1| hypothetical protein BATDEDRAFT_19177 [Batrachochytrium dendrobatidis 
JAM81]
Length=795

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NFE +TW  L+ A+ AI  +QP    LE+LY+A  +LC H    +LYQ++
Sbjct  78   LPENFEADTWEKLRLAVQAIHARQPVQDSLEELYKACENLCHHNRQSNLYQKL  130



>ref|XP_001360920.1| GA21273 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002017820.1| GL17383 [Drosophila persimilis]
 gb|EAL25495.1| GA21273 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW35659.1| GL17383 [Drosophila persimilis]
Length=816

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ E+T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  107  TLPDNYSEDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYTKL  160



>ref|XP_001961024.1| GF11213 [Drosophila ananassae]
 gb|EDV37846.1| GF11213 [Drosophila ananassae]
Length=821

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ E+T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  112  TLPDNYSEDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  165



>ref|XP_009534475.1| hypothetical protein PHYSODRAFT_361833 [Phytophthora sojae]
 gb|EGZ09614.1| hypothetical protein PHYSODRAFT_361833 [Phytophthora sojae]
Length=766

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP  FEE+TWA L++A+ A+  KQ      E+LY++V D+C  KM   LY ++
Sbjct  49   LPEAFEEDTWAKLQAAVQAVHAKQTSALSREELYRSVEDMCTWKMAARLYTKL  101



>ref|XP_005176013.1| PREDICTED: cullin-4A [Musca domestica]
Length=847

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +2

Query  254  DSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIF  433
            D   ++ T A    L     T P   KK+VIK  K KPTLP N+ E T   L+ A+ AI 
Sbjct  102  DHRSSTTTSAYFNKLGAHNTTKPGDVKKIVIKNFKVKPTLPENYSEKTCQKLEEAVVAIQ  161

Query  434  LKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  162  LSRPIKYSLEELYQAVENMCSHKMDAQLYTKL  193



>ref|XP_003800032.1| PREDICTED: cullin-4A [Otolemur garnettii]
Length=759

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ ++TW  L+ A+ A+       C+LE+LYQAV +LC HK+  +LY+++
Sbjct  54   LPDNYTQDTWQKLREAVRAVQSSTSVRCNLEELYQAVENLCSHKVSPTLYKQL  106



>ref|XP_001987405.1| GH19988 [Drosophila grimshawi]
 gb|EDW02272.1| GH19988 [Drosophila grimshawi]
Length=826

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ E+T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  117  TLPDNYSEDTYVKLEEAVLAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  170



>ref|XP_004537530.1| PREDICTED: cullin-4B-like [Ceratitis capitata]
Length=837

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +2

Query  254  DSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIF  433
            D   A+ T A    +    A+ P   KK+VIK  K KPTLP N+ E+T   L+ A+ AI 
Sbjct  92   DHRSATTTSAYFNKMGANNASKPGDVKKIVIKNFKMKPTLPDNYSEHTCEKLQEAVVAIQ  151

Query  434  LKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            L +P    LE+LYQAV ++C H+M   LY ++
Sbjct  152  LSKPIRYSLEELYQAVENMCSHRMDAQLYGKL  183



>ref|XP_002005082.1| GI20275 [Drosophila mojavensis]
 gb|EDW09017.1| GI20275 [Drosophila mojavensis]
Length=822

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ E+T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  113  TLPDNYSEDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYIKL  166



>gb|EHJ64739.1| putative cullin 4B [Danaus plexippus]
Length=1119

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/94 (31%), Positives = 43/94 (46%), Gaps = 19/94 (20%)
 Frame = +2

Query  239  SMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSA  418
            +   ++ PGA+  +    N   K                   P LP N++E TW+ L+ A
Sbjct  24   TTSSMNKPGATTKKLVIKNFKSK-------------------PNLPENYQETTWSKLREA  64

Query  419  INAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            + AI   +     LE+LYQAV ++C HKM   LY
Sbjct  65   VIAIQTSKAIAYSLEELYQAVENMCSHKMASQLY  98



>ref|XP_002050396.1| GJ20228 [Drosophila virilis]
 gb|EDW61589.1| GJ20228 [Drosophila virilis]
Length=821

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ E+T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  112  TLPDNYSEDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYVKL  165



>ref|XP_008909273.1| hypothetical protein PPTG_14065 [Phytophthora parasitica INRA-310]
 ref|XP_008909274.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI40840.1| hypothetical protein F443_13853 [Phytophthora parasitica P1569]
 gb|ETI40841.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL87623.1| hypothetical protein L917_13202 [Phytophthora parasitica]
 gb|ETL87624.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN05298.1| hypothetical protein PPTG_14065 [Phytophthora parasitica INRA-310]
 gb|ETN05299.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
Length=761

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP +FEE+TW  L++A++A+  KQ      E+LY++V D+C  KM   LY ++
Sbjct  49   LPESFEEDTWTKLEAAVHAVHAKQMSTLSREELYRSVEDMCTWKMAARLYTKL  101



>gb|ETP38764.1| hypothetical protein F442_13690 [Phytophthora parasitica P10297]
 gb|ETP38765.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=761

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP +FEE+TW  L++A++A+  KQ      E+LY++V D+C  KM   LY ++
Sbjct  49   LPESFEEDTWTKLEAAVHAVHAKQMSTLSREELYRSVEDMCTWKMAARLYTKL  101



>gb|ETK80929.1| hypothetical protein L915_13497 [Phytophthora parasitica]
 gb|ETK80930.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL34354.1| hypothetical protein L916_13393 [Phytophthora parasitica]
 gb|ETL34355.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP10610.1| hypothetical protein F441_13783 [Phytophthora parasitica CJ01A1]
 gb|ETP10611.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=761

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP +FEE+TW  L++A++A+  KQ      E+LY++V D+C  KM   LY ++
Sbjct  49   LPESFEEDTWTKLEAAVHAVHAKQMSTLSREELYRSVEDMCTWKMAARLYTKL  101



>ref|XP_004923897.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B-like [Bombyx mori]
Length=787

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 22/97 (23%)
 Frame = +2

Query  230  SSASMEDLDSPGASATRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATL  409
            SS SM   + PG +A +    N   K                   P LP N++E TW+ L
Sbjct  60   SSTSM---NKPGVTAKKLIIKNFKSK-------------------PNLPDNYQETTWSKL  97

Query  410  KSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            + A+ AI   +     LE+LYQAV ++C HKM   LY
Sbjct  98   REAVVAIQTSKSIAYSLEELYQAVENMCSHKMASQLY  134



>gb|ETM40851.1| hypothetical protein L914_13297 [Phytophthora parasitica]
 gb|ETM40852.1| hypothetical protein, variant [Phytophthora parasitica]
Length=761

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP +FEE+TW  L++A++A+  KQ      E+LY++V D+C  KM   LY ++
Sbjct  49   LPESFEEDTWTKLEAAVHAVHAKQMSTLSREELYRSVEDMCTWKMAARLYTKL  101



>gb|ACG69447.2| cullin 4A isoform 1 (predicted) [Otolemur garnettii]
Length=701

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ ++TW  L+ A+ A+       C+LE+LYQAV +LC HK+  +LY+++
Sbjct  54   LPDNYTQDTWQKLREAVRAVQSSTSVRCNLEELYQAVENLCSHKVSPTLYKQL  106



>ref|XP_001814199.1| PREDICTED: cullin-4A [Tribolium castaneum]
Length=789

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            LP ++ E TW  LKSA+ AI   +P+   LE+LYQAV ++C HKM   LY
Sbjct  83   LPDDYHETTWEKLKSAVIAIQQSKPNEYLLEELYQAVGNMCSHKMSHILY  132



>gb|ELT94808.1| hypothetical protein CAPTEDRAFT_227595 [Capitella teleta]
Length=767

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+++ TW  LK A+ AI         LE+LYQAV ++C H+M   LY  +
Sbjct  47   LPDNYQQETWGKLKGAVEAIHQSHAIQSSLEELYQAVQNMCSHQMASELYDEL  99



>gb|ETN61630.1| cullin [Anopheles darlingi]
Length=759

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
            TLP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM   LY
Sbjct  51   TLPENYQEKTWEKLRDAVLAIHSSKRIEYSLEELYQAVENMCSHKMDSQLY  101



>gb|EKC31501.1| Cullin-4A [Crassostrea gigas]
Length=489

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NF++ TW  LK ++ AI         LE+LYQAV ++C HKM   LY ++
Sbjct  97   LPENFQQQTWEKLKESVEAIQRSTSIRWSLEELYQAVENMCSHKMSAQLYDQL  149



>ref|XP_001638137.1| predicted protein [Nematostella vectensis]
 gb|EDO46074.1| predicted protein [Nematostella vectensis]
Length=256

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  LK A+ AI  K      LE+LY+AV ++C HKM  +LY ++
Sbjct  14   LPDNYKEATWLKLKEAVCAIHHKTSIQYSLEELYKAVENMCSHKMAATLYSQL  66



>ref|XP_001970515.1| GG10678 [Drosophila erecta]
 gb|EDV59574.1| GG10678 [Drosophila erecta]
Length=821

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ ++T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  112  TLPDNYSKDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  165



>ref|NP_610352.2| cullin 4, isoform A [Drosophila melanogaster]
 ref|NP_001163084.1| cullin 4, isoform B [Drosophila melanogaster]
 gb|AAF59135.2| cullin 4, isoform A [Drosophila melanogaster]
 gb|AAX33522.1| LP02965p [Drosophila melanogaster]
 gb|ACJ13182.1| FI05474p [Drosophila melanogaster]
 gb|ACZ94363.1| cullin 4, isoform B [Drosophila melanogaster]
Length=821

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ ++T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  112  TLPDNYSKDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  165



>ref|XP_003690323.1| PREDICTED: cullin-4B-like [Apis florea]
Length=814

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY ++
Sbjct  106  LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYTKL  158



>ref|XP_003397436.1| PREDICTED: cullin-4B-like [Bombus terrestris]
 ref|XP_003485810.1| PREDICTED: cullin-4B-like [Bombus impatiens]
Length=814

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY ++
Sbjct  106  LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYTKL  158



>ref|XP_392800.3| PREDICTED: cullin-4B-like [Apis mellifera]
 ref|XP_006607832.1| PREDICTED: cullin-4B-like [Apis dorsata]
Length=814

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY ++
Sbjct  106  LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYTKL  158



>gb|EGI59840.1| Cullin-4B [Acromyrmex echinatior]
Length=771

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY+ +
Sbjct  63   LPENYQEETWEKLQEAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYKNL  115



>ref|XP_002089579.1| GE23323 [Drosophila yakuba]
 gb|EDW89291.1| GE23323 [Drosophila yakuba]
Length=821

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ ++T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  112  TLPDNYSKDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  165



>ref|XP_011063503.1| PREDICTED: cullin-4A [Acromyrmex echinatior]
Length=858

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY+ +
Sbjct  150  LPENYQEETWEKLQEAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYKNL  202



>ref|XP_003707650.1| PREDICTED: cullin-4B-like [Megachile rotundata]
Length=814

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY ++
Sbjct  106  LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYTKL  158



>ref|XP_008171287.1| PREDICTED: cullin-4B isoform X2 [Chrysemys picta bellii]
Length=780

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  43   TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  102

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  103  NLEELYQAVENLCSYKISANLYKQL  127



>ref|XP_011440066.1| PREDICTED: cullin-4A-like [Crassostrea gigas]
Length=527

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NF++ TW  LK ++ AI         LE+LYQAV ++C HKM   LY ++
Sbjct  97   LPENFQQQTWEKLKESVEAIQRSTSIRWSLEELYQAVENMCSHKMSAQLYDQL  149



>emb|CDQ76383.1| unnamed protein product [Oncorhynchus mykiss]
Length=123

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+   TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++
Sbjct  48   LPENYTHETWQKLKEAVEAIQNSISIKYNLEELYQAVENLCSHKISAKLYKQL  100



>ref|XP_002032862.1| GM20725 [Drosophila sechellia]
 gb|EDW46875.1| GM20725 [Drosophila sechellia]
Length=698

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            TLP N+ ++T+  L+ A+ AI L +P    LE+LYQAV ++C HKM   LY ++
Sbjct  110  TLPDNYSKDTYVKLEEAVIAIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKL  163



>gb|EFZ12693.1| hypothetical protein SINV_14510 [Solenopsis invicta]
Length=633

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  7    LPDNYQEQTWEKLQEAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYSNL  59



>ref|XP_010139394.1| PREDICTED: cullin-4B [Buceros rhinoceros silvestris]
Length=885

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  KAKP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKAKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>gb|KFO92809.1| Cullin-4B [Buceros rhinoceros silvestris]
Length=885

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  KAKP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKAKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>ref|XP_003445252.1| PREDICTED: cullin-4B [Oreochromis niloticus]
Length=868

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++
Sbjct  163  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQL  215



>gb|KFV68186.1| Cullin-4B [Picoides pubescens]
Length=887

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKEKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_004545810.1| PREDICTED: cullin-4B-like [Maylandia zebra]
 ref|XP_005722969.1| PREDICTED: cullin-4B-like [Pundamilia nyererei]
Length=865

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQL  212



>ref|XP_009899852.1| PREDICTED: cullin-4B [Picoides pubescens]
Length=887

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKEKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005913219.1| PREDICTED: cullin-4B-like [Haplochromis burtoni]
Length=865

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+   LY+++
Sbjct  160  LPENYTQETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCFHKISAKLYKQL  212



>ref|XP_011168244.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4A [Solenopsis invicta]
Length=872

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  164  LPDNYQEQTWEKLQEAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYSNL  216



>ref|XP_011351411.1| PREDICTED: cullin-4A [Cerapachys biroi]
 gb|EZA60987.1| Cullin-4B [Cerapachys biroi]
Length=857

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  149  LPENYQEQTWEKLQEAVVAIQTSKSIGYSLEELYQAVENMCNHKMASTLYTNL  201



>ref|XP_011258663.1| PREDICTED: cullin-4A, partial [Camponotus floridanus]
Length=798

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  90   LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYSNL  142



>gb|EFA11597.1| DNA methyltransferase 1, partial [Tribolium castaneum]
Length=1882

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +2

Query  371   LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLY  520
             LP ++ E TW  LKSA+ AI   +P+   LE+LYQAV ++C HKM   LY
Sbjct  1258  LPDDYHETTWEKLKSAVIAIQQSKPNEYLLEELYQAVGNMCSHKMSHILY  1307



>ref|XP_010287736.1| PREDICTED: cullin-4B [Phaethon lepturus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009073198.1| PREDICTED: cullin-4B [Acanthisitta chloris]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFQ77299.1| Cullin-4B [Phaethon lepturus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005432498.1| PREDICTED: cullin-4B [Falco cherrug]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_003208504.1| PREDICTED: cullin-4B [Meleagris gallopavo]
Length=884

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  147  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  206

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  207  NLEELYQAVENLCSYKISANLYKQL  231



>ref|XP_005022179.1| PREDICTED: cullin-4B [Anas platyrhynchos]
Length=886

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  209  NLEELYQAVENLCSYKISANLYKQL  233



>ref|XP_009968477.1| PREDICTED: cullin-4B [Tyto alba]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_010020149.1| PREDICTED: cullin-4B [Nestor notabilis]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009915406.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus albicilla]
 ref|XP_010567268.1| PREDICTED: cullin-4B isoform X1 [Haliaeetus leucocephalus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009871272.1| PREDICTED: cullin-4B [Apaloderma vittatum]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009578947.1| PREDICTED: cullin-4B [Fulmarus glacialis]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009487693.1| PREDICTED: cullin-4B [Pelecanus crispus]
 ref|XP_009470592.1| PREDICTED: cullin-4B [Nipponia nippon]
 ref|XP_009634699.1| PREDICTED: cullin-4B [Egretta garzetta]
 ref|XP_009816067.1| PREDICTED: cullin-4B [Gavia stellata]
 ref|XP_009705121.1| PREDICTED: cullin-4B [Cariama cristata]
 ref|XP_010125781.1| PREDICTED: cullin-4B [Chlamydotis macqueenii]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009273579.1| PREDICTED: cullin-4B [Aptenodytes forsteri]
 ref|XP_009329115.1| PREDICTED: cullin-4B [Pygoscelis adeliae]
 ref|XP_010309825.1| PREDICTED: cullin-4B [Balearica regulorum gibbericeps]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFQ89647.1| Cullin-4B [Phoenicopterus ruber ruber]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFQ64788.1| Cullin-4B [Pelecanus crispus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFQ56289.1| Cullin-4B [Nestor notabilis]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFP38487.1| Cullin-4B [Chlamydotis macqueenii]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFO06527.1| Cullin-4B [Balearica regulorum gibbericeps]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005045907.1| PREDICTED: cullin-4B [Ficedula albicollis]
Length=888

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>ref|XP_011311356.1| PREDICTED: cullin-4A [Fopius arisanus]
Length=833

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  125  LPENYQEQTWEKLREAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYANL  177



>ref|XP_010150094.1| PREDICTED: cullin-4B [Eurypyga helias]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>ref|XP_009564621.1| PREDICTED: cullin-4B [Cuculus canorus]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>gb|KFZ62825.1| Cullin-4B [Podiceps cristatus]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFV93759.1| Cullin-4B [Fulmarus glacialis]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFQ02433.1| Cullin-4B [Haliaeetus albicilla]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFP90614.1| Cullin-4B [Apaloderma vittatum]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFP57528.1| Cullin-4B [Cathartes aura]
 gb|KFP68296.1| Cullin-4B [Cariama cristata]
 gb|KFR05232.1| Cullin-4B [Nipponia nippon]
 gb|KFV45215.1| Cullin-4B [Gavia stellata]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFM04851.1| Cullin-4B [Aptenodytes forsteri]
 gb|KFW61707.1| Cullin-4B [Pygoscelis adeliae]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_010162624.1| PREDICTED: cullin-4B [Caprimulgus carolinensis]
Length=886

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  209  NLEELYQAVENLCSYKISANLYKQL  233



>gb|KFZ46418.1| Cullin-4B [Caprimulgus carolinensis]
Length=886

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  149  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  208

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  209  NLEELYQAVENLCSYKISANLYKQL  233



>gb|KFV04835.1| Cullin-4B [Tauraco erythrolophus]
Length=886

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>ref|XP_009887578.1| PREDICTED: cullin-4B [Charadrius vociferus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFW86599.1| Cullin-4B [Manacus vitellinus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005504485.1| PREDICTED: cullin-4B [Columba livia]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005484500.1| PREDICTED: cullin-4B [Zonotrichia albicollis]
 ref|XP_005419871.1| PREDICTED: cullin-4B [Geospiza fortis]
 ref|XP_005526275.1| PREDICTED: cullin-4B [Pseudopodoces humilis]
 ref|XP_008928928.1| PREDICTED: cullin-4B [Manacus vitellinus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_005148357.1| PREDICTED: cullin-4B [Melopsittacus undulatus]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009981623.1| PREDICTED: cullin-4B [Tauraco erythrolophus]
Length=888

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>ref|XP_009943501.1| PREDICTED: cullin-4B [Opisthocomus hoazin]
Length=888

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>gb|KFV55551.1| Cullin-4B [Tyto alba]
Length=888

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_002196531.1| PREDICTED: cullin-4B [Taeniopygia guttata]
Length=888

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>gb|KFU89258.1| Cullin-4B [Chaetura pelagica]
Length=890

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>gb|KGL96725.1| Cullin-4B [Charadrius vociferus]
Length=898

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_011146247.1| PREDICTED: cullin-4A [Harpegnathos saltator]
 gb|EFN80008.1| Cullin-4B [Harpegnathos saltator]
Length=844

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  136  LPENYQEQTWEKLQEAVVAIQTSKSIRYSLEELYQAVENMCNHKMASTLYTNL  188



>gb|KFR04226.1| Cullin-4B [Opisthocomus hoazin]
Length=886

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>gb|KFP13940.1| Cullin-4B [Egretta garzetta]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_002433105.1| Cullin-4A, putative [Pediculus humanus corporis]
 gb|EEB20367.1| Cullin-4A, putative [Pediculus humanus corporis]
Length=733

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  LK A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  51   LPENYQEKTWEKLKEAVIAIQSSKFIQYSLEELYQAVENMCNHKMASTLYDNL  103



>gb|KFW05399.1| Cullin-4B [Eurypyga helias]
Length=885

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>ref|XP_009088610.1| PREDICTED: cullin-4B [Serinus canaria]
Length=887

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_009995422.1| PREDICTED: cullin-4B [Chaetura pelagica]
Length=896

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>ref|XP_005241130.1| PREDICTED: LOW QUALITY PROTEIN: cullin-4B [Falco peregrinus]
Length=887

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_010206238.1| PREDICTED: cullin-4B [Colius striatus]
Length=888

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  151  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  210

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  211  NLEELYQAVENLCSYKISANLYKQL  235



>ref|XP_005438905.1| PREDICTED: cullin-4A [Falco cherrug]
Length=822

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/132 (29%), Positives = 68/132 (52%), Gaps = 5/132 (4%)
 Frame = +2

Query  140  AKSQAVACSLDTNKNGQHHVHFYPDVDEDPSSASMEDLDSPGASA--TRAATANLSRKKA  313
            ++ +A A SL  + +G++     P +   P++    +  SPGA A   R+A A    +  
Sbjct  41   SRWRAAAASLRLHNHGENGAEPKPTL---PAAGHRAEGKSPGAQAPGERSAPAAGGPEAE  97

Query  314  TLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLC  493
               + A   ++     +P LP N+ ++TW  L  A+ AI        +LE+LYQAV +LC
Sbjct  98   NRHRGAFNYLLSSFTERPKLPDNYTQDTWQKLHEAVGAIQSSVSIKYNLEELYQAVENLC  157

Query  494  LHKMGGSLYQRI  529
             +K+  +LY+++
Sbjct  158  SYKVSATLYKQL  169



>ref|XP_007060188.1| PREDICTED: cullin-4B [Chelonia mydas]
Length=883

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  146  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  205

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  206  NLEELYQAVENLCSYKISANLYKQL  230



>gb|EMC88699.1| Cullin-4B [Columba livia]
Length=893

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>gb|KFP80278.1| Cullin-4B [Acanthisitta chloris]
Length=905

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



>ref|XP_002170287.2| PREDICTED: cullin-4B-like [Hydra vulgaris]
Length=913

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +2

Query  368  TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LP N+++ T+  LK A++AI L+      LE+LY+AV +LC H M   LY+R+
Sbjct  66   SLPDNYKDVTFEKLKDAVSAIHLEHSISYSLEELYKAVENLCSHNMSSQLYERL  119



>gb|EFN66773.1| Cullin-4B [Camponotus floridanus]
Length=719

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP N++E TW  L+ A+ AI   +     LE+LYQAV ++C HKM  +LY  +
Sbjct  55   LPENYQEQTWEKLQEAVIAIQTSKSIRYSLEELYQAVENMCNHKMASTLYSNL  107



>ref|XP_011420105.1| PREDICTED: cullin-4A-like [Crassostrea gigas]
Length=807

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  371  LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI  529
            LP NF++ TW  LK ++ AI         LE+LYQAV ++C HKM   LY ++
Sbjct  97   LPENFQQQTWEKLKESVEAIQRSTSIRWSLEELYQAVENMCSHKMSAQLYDQL  149



>gb|KFO64284.1| Cullin-4B [Corvus brachyrhynchos]
Length=883

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  148  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  207

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  208  NLEELYQAVENLCSYKISANLYKQL  232



>gb|KFP00724.1| Cullin-4B [Calypte anna]
Length=885

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  275  TRAATANLSRKKATLPQpakklviklvkakpTLPTNFEENTWATLKSAINAIFLKQPDPC  454
            T+AA++ +S    + P  AKKLVIK  K KP LP N+ + TW  LK A+ AI        
Sbjct  150  TKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKY  209

Query  455  DLEKLYQAVNDLCLHKMGGSLYQRI  529
            +LE+LYQAV +LC +K+  +LY+++
Sbjct  210  NLEELYQAVENLCSYKISANLYKQL  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400