BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033K04

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   291   5e-94   Tarenaya hassleriana [spider flower]
gb|KJB83376.1|  hypothetical protein B456_013G244600                    285   8e-94   Gossypium raimondii
emb|CBI16534.3|  unnamed protein product                                290   8e-94   Vitis vinifera
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    291   1e-93   Tarenaya hassleriana [spider flower]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             291   1e-93   Capsella rubella
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              291   1e-93   Brassica rapa
emb|CDX88875.1|  BnaA03g07740D                                          291   1e-93   
emb|CDY35861.1|  BnaC09g37930D                                          281   1e-93   Brassica napus [oilseed rape]
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              291   1e-93   Brassica rapa
emb|CDY44941.1|  BnaA02g04460D                                          291   1e-93   Brassica napus [oilseed rape]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              291   1e-93   Camelina sativa [gold-of-pleasure]
emb|CDY42294.1|  BnaC02g09000D                                          291   1e-93   Brassica napus [oilseed rape]
ref|NP_197478.1|  tubulin alpha-3                                       290   2e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              290   2e-93   Brassica rapa
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              290   2e-93   Brassica rapa
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              290   2e-93   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      290   2e-93   Medicago truncatula
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             290   2e-93   Capsella rubella
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   290   2e-93   Brassica rapa
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    290   2e-93   Tarenaya hassleriana [spider flower]
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   290   3e-93   Elaeis guineensis
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                290   3e-93   Erythranthe guttata [common monkey flower]
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    289   3e-93   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    286   4e-93   Gossypium raimondii
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   289   6e-93   Vitis vinifera
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          289   6e-93   Amborella trichopoda
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              289   8e-93   Phoenix dactylifera
gb|KHN47983.1|  Tubulin alpha-3 chain                                   287   1e-92   Glycine soja [wild soybean]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         288   1e-92   Jatropha curcas
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   288   1e-92   Sesamum indicum [beniseed]
gb|AGG37284.1|  alpha-tubulin 2                                         288   1e-92   Salix arbutifolia
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     288   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_002532068.1|  tubulin alpha chain, putative                      288   2e-92   Ricinus communis
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    287   3e-92   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              287   3e-92   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              287   3e-92   Cucumis sativus [cucumbers]
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        287   3e-92   
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        286   3e-92   Prunus mume [ume]
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   287   3e-92   Nelumbo nucifera [Indian lotus]
ref|NP_001237301.1|  tubulin A                                          287   3e-92   
dbj|BAM28754.1|  tubulin                                                285   3e-92   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              287   4e-92   Elaeis guineensis
ref|XP_010112637.1|  Tubulin alpha-3 chain                              287   4e-92   Morus notabilis
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    287   4e-92   
gb|AGD80034.1|  alpha-tubulin 1                                         286   5e-92   Hevea brasiliensis [jebe]
gb|AAT68202.1|  alpha 1 tubulin                                         276   6e-92   Cynodon dactylon
ref|NP_001275086.1|  uncharacterized LOC102577521                       286   6e-92   Solanum tuberosum [potatoes]
gb|AAO63773.2|  alpha-tubulin 2                                         286   8e-92   Populus tremuloides
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              286   8e-92   Cucumis sativus [cucumbers]
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             286   8e-92   Phaseolus vulgaris [French bean]
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              286   1e-91   Oryza brachyantha
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                286   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   286   1e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        286   1e-91   Cucumis melo [Oriental melon]
gb|AGV54500.1|  tubulin A                                               286   1e-91   Phaseolus vulgaris [French bean]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              285   1e-91   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    285   1e-91   Gossypium raimondii
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             285   2e-91   Gossypium arboreum [tree cotton]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    285   2e-91   Gossypium raimondii
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             285   2e-91   Gossypium arboreum [tree cotton]
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    284   2e-91   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               285   2e-91   Glycine max [soybeans]
gb|AIC33057.1|  tubulin alpha-1 chain                                   285   2e-91   Panax ginseng [Asiatic ginseng]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              285   2e-91   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAD26886.1|  alpha-tubulin                                          285   2e-91   Miscanthus sinensis
gb|EPS70933.1|  tubulin alpha-6 chain                                   279   3e-91   Genlisea aurea
gb|AHZ58482.1|  alpha-tubulin                                           278   3e-91   Syntrichia caninervis
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   285   3e-91   Populus euphratica
gb|KHN06388.1|  Tubulin alpha-3 chain                                   284   3e-91   Glycine soja [wild soybean]
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              285   3e-91   Nelumbo nucifera [Indian lotus]
ref|NP_001105588.1|  tubulin alpha-6 chain                              285   3e-91   Zea mays [maize]
emb|CAD24766.1|  alpha-tubulin                                          285   4e-91   Miscanthus sinensis
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   285   4e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   284   4e-91   Pyrus x bretschneideri [bai li]
ref|NP_001060075.1|  Os07g0574800                                       284   4e-91   
gb|EYU39262.1|  hypothetical protein MIMGU_mgv1a0159351mg               273   4e-91   Erythranthe guttata [common monkey flower]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             284   4e-91   Prunus persica
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   284   4e-91   Phoenix dactylifera
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         284   4e-91   Jatropha curcas
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              284   5e-91   Prunus mume [ume]
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        284   5e-91   Prunus mume [ume]
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              284   5e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   284   6e-91   Eucalyptus grandis [rose gum]
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    284   6e-91   Eleusine indica [crabgrass]
gb|AGY80453.1|  tubulin                                                 284   6e-91   Dendrocalamus latiflorus [sweet bamboo]
emb|CAD24765.1|  alpha-tubulin                                          283   9e-91   Miscanthus sinensis
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     283   1e-90   Eucalyptus grandis [rose gum]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              285   1e-90   
gb|ACN40824.1|  unknown                                                 283   1e-90   Picea sitchensis
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             283   1e-90   Prunus persica
gb|ABE66388.1|  alpha-tubulin                                           275   1e-90   Striga asiatica [witchweed]
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   283   1e-90   Brachypodium distachyon [annual false brome]
ref|XP_007014666.1|  Tubulin alpha-5                                    283   1e-90   Theobroma cacao [chocolate]
emb|CDP17586.1|  unnamed protein product                                283   2e-90   Coffea canephora [robusta coffee]
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  279   2e-90   Citrus sinensis [apfelsine]
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             282   2e-90   Citrus clementina [clementine]
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        281   3e-90   Fragaria vesca subsp. vesca
emb|CAD26891.1|  alpha-tubulin                                          282   3e-90   Miscanthus floridulus
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              282   4e-90   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD92943.1|  alpha tubulin-1B                                        282   4e-90   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92942.1|  alpha tubulin-1D                                        282   4e-90   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              281   5e-90   Setaria italica
ref|NP_001105324.1|  tubulin alpha-5 chain                              281   5e-90   Zea mays [maize]
gb|ACU18775.1|  unknown                                                 273   6e-90   Glycine max [soybeans]
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            271   6e-90   
gb|ACN40426.1|  unknown                                                 277   7e-90   Picea sitchensis
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               273   7e-90   Erythranthe guttata [common monkey flower]
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              281   8e-90   Populus euphratica
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   281   9e-90   Malus domestica [apple tree]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             281   9e-90   Citrus clementina [clementine]
gb|AGG37286.1|  alpha-tubulin 4                                         281   1e-89   Salix arbutifolia
emb|CBI29424.3|  unnamed protein product                                275   1e-89   Vitis vinifera
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               281   1e-89   Populus trichocarpa [western balsam poplar]
gb|AGG37290.1|  alpha-tubulin 8                                         281   1e-89   Salix arbutifolia
gb|ABV55994.1|  alpha-tubulin 6                                         281   1e-89   Populus tremuloides
dbj|BAJ06363.1|  alpha-tubulin                                          281   1e-89   Alopecurus aequalis
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              280   1e-89   Eucalyptus grandis [rose gum]
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              280   1e-89   Populus euphratica
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     276   2e-89   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   280   2e-89   Nicotiana tomentosiformis
emb|CAD26887.1|  alpha-tubulin                                          280   2e-89   Miscanthus sinensis
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        280   2e-89   Fragaria vesca subsp. vesca
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             280   2e-89   Hordeum vulgare [barley]
emb|CAB77671.1|  alpha-tubulin                                          280   2e-89   Miscanthus sinensis f. glaber
gb|ABO47735.1|  alpha-tubulin                                           280   2e-89   Gossypium hirsutum [American cotton]
gb|ABO47741.1|  alpha-tubulin                                           280   2e-89   Gossypium hirsutum [American cotton]
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                282   2e-89   Erythranthe guttata [common monkey flower]
emb|CAD26893.1|  alpha-tubulin                                          280   3e-89   Miscanthus floridulus
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              280   3e-89   Pyrus x bretschneideri [bai li]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               280   3e-89   Populus trichocarpa [western balsam poplar]
ref|XP_002525416.1|  tubulin alpha chain, putative                      279   3e-89   Ricinus communis
ref|XP_002675196.1|  alpha-tubulin                                      279   4e-89   Naegleria gruberi strain NEG-M
gb|AAN33000.1|  alpha-tubulin 4                                         275   4e-89   Gossypium hirsutum [American cotton]
ref|XP_001777081.1|  predicted protein                                  279   5e-89   
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          278   5e-89   
ref|XP_001782790.1|  predicted protein                                  279   5e-89   
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              279   5e-89   Glycine max [soybeans]
emb|CAD26892.1|  alpha-tubulin                                          279   6e-89   Miscanthus floridulus
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   278   7e-89   Populus euphratica
emb|CAB77672.1|  alpha-tubulin                                          278   7e-89   Miscanthus transmorrisonensis
gb|AAX21196.1|  putative alpha-tubulin                                  270   7e-89   Solanum betaceum [tamarillo]
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              278   7e-89   Sesamum indicum [beniseed]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   278   7e-89   Malus domestica [apple tree]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    278   7e-89   Brassica rapa
ref|XP_003624633.1|  Alpha-tubulin                                      278   7e-89   Medicago truncatula
emb|CAD26889.1|  alpha-tubulin                                          278   8e-89   Miscanthus transmorrisonensis
ref|XP_001427644.1|  hypothetical protein                               270   8e-89   Paramecium tetraurelia strain d4-2
emb|CAD26890.1|  alpha-tubulin                                          278   8e-89   Miscanthus sinensis subsp. condensatus
gb|ABO47738.1|  alpha-tubulin                                           278   9e-89   Gossypium hirsutum [American cotton]
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   276   9e-89   Citrus sinensis [apfelsine]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     278   1e-88   Populus trichocarpa [western balsam poplar]
emb|CBI22190.3|  unnamed protein product                                276   1e-88   Vitis vinifera
gb|KHG26159.1|  Tubulin alpha-6 chain                                   278   1e-88   Gossypium arboreum [tree cotton]
gb|ACU24494.1|  unknown                                                 269   1e-88   Glycine max [soybeans]
gb|KJB44614.1|  hypothetical protein B456_007G261000                    278   1e-88   Gossypium raimondii
ref|XP_004985171.1|  PREDICTED: tubulin alpha-2 chain-like              278   1e-88   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     277   1e-88   
emb|CBI19330.3|  unnamed protein product                                276   1e-88   Vitis vinifera
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         278   2e-88   Jatropha curcas
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    277   2e-88   
gb|AFW89176.1|  hypothetical protein ZEAMMB73_322393                    278   2e-88   
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     277   2e-88   
emb|CBI25125.3|  unnamed protein product                                275   2e-88   Vitis vinifera
gb|KHG20487.1|  Tubulin alpha chain                                     278   2e-88   Gossypium arboreum [tree cotton]
gb|ABO47737.1|  alpha-tubulin                                           278   2e-88   Gossypium hirsutum [American cotton]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    278   2e-88   Gossypium raimondii
emb|CDY25017.1|  BnaC02g39910D                                          276   2e-88   Brassica napus [oilseed rape]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                277   2e-88   Avena sativa [cultivated oat]
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        278   2e-88   Brassica rapa
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             277   3e-88   Populus trichocarpa [western balsam poplar]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                276   3e-88   Erythranthe guttata [common monkey flower]
tpg|DAA51110.1|  TPA: alpha-tubulin                                     270   3e-88   
emb|CDP14299.1|  unnamed protein product                                277   3e-88   Coffea canephora [robusta coffee]
gb|KHN46768.1|  Tubulin alpha-3 chain                                   277   3e-88   Glycine soja [wild soybean]
gb|ABK92552.1|  unknown                                                 277   3e-88   Populus trichocarpa [western balsam poplar]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        277   3e-88   Tarenaya hassleriana [spider flower]
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    277   3e-88   
gb|KIY93466.1|  Tubulin alpha-1 chain                                   268   3e-88   Monoraphidium neglectum
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           277   3e-88   Naegleria pringsheimi
ref|WP_039310890.1|  hypothetical protein                               277   3e-88   
ref|XP_002522104.1|  tubulin alpha chain, putative                      277   3e-88   Ricinus communis
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             277   3e-88   Citrus clementina [clementine]
ref|XP_002510010.1|  tubulin alpha chain, putative                      277   3e-88   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              277   3e-88   Theobroma cacao [chocolate]
gb|AGG37287.1|  alpha-tubulin 5                                         277   3e-88   Salix arbutifolia
gb|ABX57816.1|  alpha tubulin                                           277   3e-88   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         277   3e-88   Pseudotsuga menziesii var. menziesii
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    277   3e-88   Arabis alpina [alpine rockcress]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   277   4e-88   Populus euphratica
dbj|BAJ06365.1|  alpha-tubulin                                          276   4e-88   Alopecurus aequalis
gb|AGG37285.1|  alpha-tubulin 3                                         277   4e-88   Salix arbutifolia
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                277   4e-88   Fragaria vesca subsp. vesca
emb|CDY66630.1|  BnaCnng51680D                                          276   4e-88   Brassica napus [oilseed rape]
emb|CDY29334.1|  BnaA05g16010D                                          276   4e-88   Brassica napus [oilseed rape]
gb|ABB16994.1|  unknown                                                 277   4e-88   Solanum tuberosum [potatoes]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         276   4e-88   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           276   4e-88   Betula pendula [white birch]
dbj|BAC24800.1|  alpha tubulin                                          276   4e-88   Physcomitrella patens
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     276   4e-88   Eucalyptus grandis [rose gum]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             276   4e-88   Eutrema salsugineum [saltwater cress]
ref|NP_171974.1|  tubulin alpha-4 chain                                 276   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             276   5e-88   Capsella rubella
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             276   5e-88   Prunus persica
gb|AHJ80818.1|  Tua1                                                    271   5e-88   Eragrostis tef [tef]
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        275   5e-88   
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             276   5e-88   Phaseolus vulgaris [French bean]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          276   5e-88   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                276   5e-88   Pyrus x bretschneideri [bai li]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    276   5e-88   Tarenaya hassleriana [spider flower]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                276   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    276   5e-88   
ref|XP_007042689.1|  Tubulin alpha-2 chain                              276   5e-88   Theobroma cacao [chocolate]
gb|AGG37288.1|  alpha-tubulin 6                                         276   5e-88   Salix arbutifolia
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   276   5e-88   Fragaria vesca subsp. vesca
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        276   5e-88   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                276   5e-88   Eucalyptus grandis [rose gum]
ref|NP_849388.1|  tubulin alpha-6 chain                                 276   5e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                276   5e-88   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                276   5e-88   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     276   5e-88   Carthamus tinctorius
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                276   6e-88   Elaeis guineensis
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     276   6e-88   Helicosporidium sp. ATCC 50920
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          276   6e-88   Arabidopsis thaliana [mouse-ear cress]
gb|ABR67425.1|  alpha-tubulin 4                                         276   6e-88   Populus tremuloides
gb|AEG74028.1|  alpha-tubulin                                           276   6e-88   Apopellia endiviifolia (species B)
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             276   6e-88   Selaginella moellendorffii
gb|KJB58757.1|  hypothetical protein B456_009G224800                    275   6e-88   Gossypium raimondii
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    276   6e-88   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             276   6e-88   Citrus clementina [clementine]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    276   6e-88   Brassica rapa
ref|XP_005851144.1|  alpha-tubulin                                      276   7e-88   Chlorella variabilis
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     276   7e-88   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     276   7e-88   Pyrus x bretschneideri [bai li]
gb|AGG37283.1|  alpha-tubulin 1                                         276   7e-88   Salix arbutifolia
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   276   7e-88   
gb|ABO47736.1|  alpha-tubulin                                           276   7e-88   Gossypium hirsutum [American cotton]
ref|XP_010093625.1|  Tubulin alpha chain                                276   7e-88   Morus notabilis
ref|XP_002886753.1|  alpha-1 tubulin                                    276   8e-88   Arabidopsis lyrata subsp. lyrata
gb|KHG18997.1|  Tubulin alpha chain                                     276   8e-88   Gossypium arboreum [tree cotton]
gb|ABD92939.1|  alpha tubulin-5D                                        276   8e-88   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92940.1|  alpha tubulin-5A                                        276   8e-88   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ86161.1|  predicted protein                                      276   8e-88   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAP59012.1|  alpha tubulin                                          276   8e-88   Taxus cuspidata [ichii]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     275   9e-88   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     276   9e-88   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                276   9e-88   Cucumis sativus [cucumbers]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              276   9e-88   Camelina sativa [gold-of-pleasure]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                276   9e-88   Populus euphratica
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             276   9e-88   Capsella rubella
dbj|BAJ98211.1|  predicted protein                                      276   9e-88   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGE09583.1|  TUA1-like protein                                       275   1e-87   Eucalyptus cladocalyx
ref|XP_002465633.1|  hypothetical protein SORBIDRAFT_01g042650          276   1e-87   Sorghum bicolor [broomcorn]
emb|CDP02221.1|  unnamed protein product                                276   1e-87   Coffea canephora [robusta coffee]
gb|ABQ59634.1|  alpha-tubulin 5                                         276   1e-87   Populus tremuloides
emb|CAD26888.1|  alpha-tubulin                                          276   1e-87   Miscanthus transmorrisonensis
gb|ABO47740.1|  alpha-tubulin                                           275   1e-87   Gossypium hirsutum [American cotton]
gb|EKF30131.1|  epsilon tubulin, putative                               267   1e-87   Trypanosoma cruzi marinkellei
gb|AAO73546.1|  alpha-tubulin                                           275   1e-87   Ceratopteris richardii
emb|CAD24768.1|  alpha-tubulin                                          275   1e-87   Miscanthus floridulus
emb|CCC46467.1|  putative alpha tubulin, fragment                       269   1e-87   Trypanosoma vivax Y486
gb|ACN40181.1|  unknown                                                 275   1e-87   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     275   1e-87   Vitis vinifera
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             275   1e-87   
emb|CBH08957.1|  alpha tubulin, (fragment)                              266   2e-87   Trypanosoma brucei gambiense DAL972
ref|XP_005651460.1|  tubulin alpha chain                                275   2e-87   Coccomyxa subellipsoidea C-169
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             275   2e-87   Selaginella moellendorffii
gb|AIX10966.1|  tubulin                                                 275   2e-87   Ornithogalum longebracteatum [sea-onion]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   275   2e-87   Vitis vinifera
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              275   2e-87   Fragaria vesca subsp. vesca
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              275   2e-87   
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          275   2e-87   
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          275   2e-87   
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 275   2e-87   Populus trichocarpa [western balsam poplar]
ref|NP_001289660.1|  tubulin alpha chain-like                           275   2e-87   Eucalyptus grandis [rose gum]
ref|XP_005643073.1|  tubulin alpha chain                                275   2e-87   Coccomyxa subellipsoidea C-169
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        275   2e-87   Glycine max [soybeans]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        275   2e-87   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     275   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             275   2e-87   Prunus persica
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             275   2e-87   
gb|ABO47739.1|  alpha-tubulin                                           275   2e-87   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   275   2e-87   
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     275   2e-87   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    275   2e-87   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     275   2e-87   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   275   2e-87   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          275   2e-87   
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    275   2e-87   
gb|ABK92520.1|  unknown                                                 275   2e-87   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        275   2e-87   
gb|AAO23139.1|  alpha tubulin                                           275   2e-87   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    275   2e-87   
ref|XP_002508010.1|  alpha tubulin 2                                    275   2e-87   
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                275   2e-87   
ref|XP_010104543.1|  Tubulin alpha chain                                275   2e-87   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             275   3e-87   
gb|ABQ59633.1|  alpha-tubulin 3                                         275   3e-87   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              275   3e-87   
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                275   3e-87   
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    275   3e-87   
gb|EKF98903.1|  epsilon tubulin, putative                               268   3e-87   
ref|XP_001764722.1|  predicted protein                                  275   3e-87   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        275   3e-87   
gb|ADW66593.1|  alpha tubulin                                           271   3e-87   
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    275   3e-87   
ref|NP_193232.1|  tubulin alpha-6 chain                                 275   3e-87   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     275   3e-87   
ref|XP_001315391.1|  alpha-tubulin 1                                    268   3e-87   
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              275   3e-87   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     275   3e-87   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                275   3e-87   
gb|ABB02631.1|  unknown                                                 274   3e-87   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              274   3e-87   
emb|CAD13176.1|  alpha-tubulin                                          274   3e-87   
sp|O22348.1|TBA2_ELEIN  RecName: Full=Tubulin alpha-2 chain; AltN...    274   3e-87   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     274   3e-87   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     274   3e-87   
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          274   3e-87   
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              274   3e-87   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              274   3e-87   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             274   3e-87   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    274   3e-87   
ref|XP_673091.1|  hypothetical protein                                  268   3e-87   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              274   3e-87   
ref|NP_001291325.1|  tubulin alpha chain-like                           274   3e-87   
ref|XP_739480.1|  hypothetical protein                                  265   3e-87   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              274   3e-87   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              274   3e-87   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              274   3e-87   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   274   3e-87   
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                274   4e-87   
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     274   4e-87   
prf||1503274A  alpha1 tubulin                                           274   4e-87
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     274   4e-87   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             274   4e-87   
ref|NP_176654.1|  tubulin alpha-1 chain                                 274   4e-87   
ref|XP_002783368.1|  alpha tubulin, putative                            265   4e-87   
ref|XP_674476.1|  hypothetical protein                                  266   4e-87   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                274   4e-87   
ref|XP_003558477.1|  PREDICTED: tubulin alpha-2 chain                   274   4e-87   
ref|XP_010096739.1|  Tubulin alpha chain                                274   4e-87   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   274   5e-87   
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     274   5e-87   
gb|AFV46219.1|  hypothetical protein                                    273   5e-87   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              274   5e-87   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         274   5e-87   
gb|ACU19580.1|  unknown                                                 274   5e-87   
gb|AIA82437.1|  alpha-tubulin-like protein 06                           271   5e-87   
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     274   5e-87   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   274   5e-87   
gb|ABE01246.1|  alpha tubulin                                           274   5e-87   
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             274   5e-87   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                274   6e-87   
emb|CAB66336.1|  alpha-tubulin                                          274   6e-87   
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    273   6e-87   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             273   6e-87   
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              273   6e-87   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     273   6e-87   
gb|KHN01709.1|  Tubulin alpha chain                                     273   7e-87   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    273   7e-87   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           273   7e-87   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                273   7e-87   
ref|XP_002766433.1|  tubulin alpha chain, putative                      264   7e-87   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                273   7e-87   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    273   7e-87   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     273   7e-87   
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                273   7e-87   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                273   8e-87   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                273   8e-87   
gb|ESL08706.1|  alpha tubulin                                           269   8e-87   
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    273   8e-87   
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        273   8e-87   
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                273   8e-87   
ref|XP_002517492.1|  tubulin alpha chain, putative                      273   9e-87   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              273   9e-87   
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    273   9e-87   
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          273   9e-87   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        273   9e-87   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             273   1e-86   
emb|CCC46464.1|  putative alpha tubulin                                 269   1e-86   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             273   1e-86   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              273   1e-86   
gb|AGM32279.1|  alpha tubulin                                           268   1e-86   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                273   1e-86   
ref|XP_003603670.1|  Tubulin alpha-7 chain                              273   1e-86   
gb|AFW67748.1|  alpha tubulin4                                          270   1e-86   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    272   1e-86   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             273   1e-86   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               273   1e-86   
sp|P50258.1|TBAD_PHYPO  RecName: Full=Tubulin alpha-1A chain            273   1e-86   
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   273   2e-86   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              272   2e-86   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      265   2e-86   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      265   2e-86   
ref|XP_003058621.1|  alpha tubulin                                      272   2e-86   
emb|CAA67848.1|  alpha-tubulin                                          272   2e-86   
gb|KEH43997.1|  tubulin beta-1 chain                                    272   2e-86   
emb|CAD24767.1|  alpha-tubulin                                          272   2e-86   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                272   2e-86   
ref|XP_001460309.1|  hypothetical protein                               271   2e-86   
ref|XP_001454509.1|  hypothetical protein                               272   2e-86   
emb|CAI38956.1|  alpha_tubulin,putative                                 272   2e-86   
gb|EKG00415.1|  epsilon tubulin, putative                               270   2e-86   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             272   3e-86   
ref|NP_001067613.1|  Os11g0247300                                       272   3e-86   
gb|EPY40566.1|  tubulin alpha                                           269   3e-86   
emb|CCD12221.1|  unnamed protein product                                269   3e-86   
gb|ACH68563.1|  alpha-tubulin                                           272   3e-86   
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          272   3e-86   
ref|XP_010496499.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    271   3e-86   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                272   3e-86   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      271   3e-86   
gb|AAK83154.1|AF327846_1  alpha-tubulin 1                               263   3e-86   
gb|ABV55999.1|  alpha-tubulin 7                                         271   4e-86   
gb|AGG37289.1|  alpha-tubulin 7                                         271   4e-86   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     271   4e-86   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             271   4e-86   
dbj|BAJ97454.1|  predicted protein                                      269   4e-86   
emb|CDP00974.1|  unnamed protein product                                271   4e-86   
dbj|BAB19779.1|  alpha tubulin                                          271   4e-86   
emb|CDP12358.1|  unnamed protein product                                271   4e-86   
emb|CDO97305.1|  unnamed protein product                                271   4e-86   
gb|ACI15922.1|  alpha-tubulin                                           271   4e-86   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      266   5e-86   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             271   5e-86   
gb|AAW30622.1|  unknown                                                 262   5e-86   
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     263   5e-86   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             271   5e-86   
gb|ABD92930.1|  alpha tubulin-2A                                        271   5e-86   
gb|ACK76232.1|  alpha-tubulin                                           271   5e-86   
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    270   5e-86   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                271   5e-86   
gb|AAB08791.1|  alpha tubulin                                           271   5e-86   
dbj|BAJ06362.1|  alpha-tubulin                                          271   5e-86   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   271   5e-86   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              271   5e-86   
gb|ABP65320.1|  alpha tubulin                                           271   6e-86   
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      271   6e-86   
gb|AIX10773.1|  alpha tubulin                                           271   6e-86   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    271   6e-86   
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              271   6e-86   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             264   6e-86   
gb|AAW30623.1|  unknown                                                 263   6e-86   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 271   6e-86   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             271   7e-86   
gb|EPY25298.1|  tubulin alpha                                           268   7e-86   
gb|ACY05960.1|  alpha-tubulin                                           269   7e-86   
ref|XP_001455356.1|  hypothetical protein                               271   7e-86   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             271   7e-86   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             271   8e-86   
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                271   8e-86   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             271   8e-86   
gb|ABO47742.1|  alpha-tubulin                                           271   8e-86   
gb|KIZ03400.1|  Tubulin alpha chain                                     271   8e-86   
gb|EPY32753.1|  tubulin alpha                                           265   8e-86   
gb|AHJ80817.1|  Tua1                                                    271   8e-86   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   271   8e-86   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              271   8e-86   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      267   8e-86   
gb|AHJ80822.1|  Tua1                                                    271   9e-86   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                271   9e-86   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              271   9e-86   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   271   9e-86   
ref|NP_001167663.1|  tubulin alpha-3 chain                              271   9e-86   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    271   9e-86   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          271   9e-86   
gb|AHJ80815.1|  Tua1                                                    271   9e-86   
gb|EMT20847.1|  Tubulin alpha-2 chain                                   270   9e-86   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             270   1e-85   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   270   1e-85   
emb|CAA06619.1|  alpha-tubulin 1                                        270   1e-85   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              270   1e-85   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  263   1e-85   
gb|AAZ23863.1|  alpha-tubulin                                           270   1e-85   
gb|AHJ80816.1|  Tua1                                                    270   1e-85   
ref|XP_006649647.1|  PREDICTED: tubulin alpha-2 chain-like              270   1e-85   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  270   1e-85   
ref|XP_673559.1|  hypothetical protein                                  262   1e-85   
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              270   1e-85   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              270   1e-85   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      270   1e-85   
gb|EJY81124.1|  Alpha tubulin,putative                                  270   1e-85   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                270   1e-85   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              270   1e-85   
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  263   1e-85   
ref|XP_001691876.1|  alpha tubulin 1                                    270   1e-85   
dbj|BAE01779.1|  unnamed protein product                                263   1e-85   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             270   1e-85   
emb|CDW82295.1|  alpha tubulin                                          270   1e-85   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             270   1e-85   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       265   1e-85   
ref|XP_001419217.1|  predicted protein                                  270   1e-85   
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  264   1e-85   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           270   1e-85   
gb|AEW46684.1|  beta-tubulin                                            270   2e-85   
ref|XP_002951007.1|  alpha tubulin                                      270   2e-85   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  270   2e-85   
gb|ACI16016.1|  alpha-tubulin                                           270   2e-85   
gb|ACI16014.1|  alpha-tubulin                                           270   2e-85   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   270   2e-85   



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   291 bits (746),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 135/139 (97%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KJB83376.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=271

 Score =   285 bits (730),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CBI16534.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   290 bits (743),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV HDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010535935.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Tarenaya hassleriana]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009126388.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CDY35861.1| BnaC09g37930D [Brassica napus]
Length=173

 Score =   281 bits (719),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/134 (97%), Positives = 133/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQG  488
            RVRKLADNCTGLQG
Sbjct  121  RVRKLADNCTGLQG  134



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGVMPSDNSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_006584595.1| PREDICTED: uncharacterized protein LOC100806907 isoform X1 [Glycine 
max]
Length=423

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KJB83377.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=346

 Score =   286 bits (732),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV HDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVGHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+S+GVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNSIGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   289 bits (739),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVG+AHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGIAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDE+R G YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEIRAGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/139 (96%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGV HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004170946.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Cucumis 
sativus]
Length=447

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISLHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008449886.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Cucumis melo]
Length=435

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008240534.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Prunus mume]
Length=424

 Score =   286 bits (732),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS+ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>dbj|BAM28754.1| tubulin [Brassica rapa subsp. chinensis]
Length=377

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVG SCWELYCLEHGIQPDGMMPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGFSCWELYCLEHGIQPDGMMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DL LD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLGLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VGV+HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGVSHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS+ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   286 bits (733),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AAT68202.1| alpha 1 tubulin [Cynodon dactylon]
Length=141

 Score =   276 bits (705),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VGVAHDAFNTFF+ETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTTVGVAHDAFNTFFTETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHY VGKE+ DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYNVGKEVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGL GFLVF+
Sbjct  121  RVRKLADNCTGLHGFLVFN  139



>ref|NP_001275086.1| uncharacterized LOC102577521 [Solanum tuberosum]
 gb|ABC01891.1| tubulin alpha-5 chain-like protein [Solanum tuberosum]
Length=449

 Score =   286 bits (733),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S G AHDAFNTFFSETGAGK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 138/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG+MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIRPDGVMPSDASVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++ GV HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++VGV HDAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDNTVGVGHDAFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSEGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AGV54500.1| tubulin A [Phaseolus vulgaris]
Length=449

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVAQDAFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTVGACHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVA+DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVANDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006488931.1| PREDICTED: tubulin alpha-1 chain-like isoform X2 [Citrus sinensis]
Length=428

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+++GVAHDAFNTFFSET AG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKL+DNCTGLQGFLVF+
Sbjct  121  RVRKLSDNCTGLQGFLVFN  139



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCW LYCLEHGIQPDGMMPSDSS GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWGLYCLEHGIQPDGMMPSDSSFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDNTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDE+RTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEIRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDSSVG+A DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGMACDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|EPS70933.1| tubulin alpha-6 chain, partial [Genlisea aurea]
Length=269

 Score =   279 bits (713),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG+MPSD+SVG AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGLMPSDTSVGAAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGKEI D CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGGYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   278 bits (712),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD+S G   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVG AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGVMPSDASVGGAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS+ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSTFGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLIS KEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRCGTYRQLFHPEQLISDKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH IQPDGMMPSD+SVGVAHDAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIQPDGMMPSDTSVGVAHDAFNTFFSETGTGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLE TVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLESTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVASDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG AHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|EYU39262.1| hypothetical protein MIMGU_mgv1a0159351mg, partial [Erythranthe 
guttata]
Length=134

 Score =   273 bits (699),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD++ GV HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTTFGVGHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQG  488
            RVRKLADNCTGLQG
Sbjct  121  RVRKLADNCTGLQG  134



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSIGTEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG AHDAFNTFFSETG+G 
Sbjct  1    MREIISVHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAAHDAFNTFFSETGSGN  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   284 bits (726),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSDSSVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDSSVGVATDAFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGM+PSD++VGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI D CLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDQCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   283 bits (725),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKE+AANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKENAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGM+PSD++VGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMLPSDATVGVAADAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  15   PQFLLFSERKTNKDSTLK-ERERERMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGM  191
            PQ +L      NK S L  +   E+MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG 
Sbjct  26   PQLILRWLTLANKKSPLAGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQ  85

Query  192  MPSDSSVGVAHDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG  371
            MPSD++VG   DAFNTFFSETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG
Sbjct  86   MPSDTTVGGGDDAFNTFFSETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG  145

Query  372  KEDAANNFARGHYTVGKEIXDLCLDRVRKLADNCTGLQGFLVFS  503
            KEDAANNFARGHYT+GKEI DLCLDR+RKLADNCTGLQGFLVF+
Sbjct  146  KEDAANNFARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFN  189



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVGV  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGVGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAV VDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVIVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDASVGVGRDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   275 bits (702),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSDS+VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDSTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH I PDGMMPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHEIHPDGMMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI  DGMMPSD++VG+AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHADGMMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+F+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|KDO55010.1| hypothetical protein CISIN_1g0157541mg, partial [Citrus sinensis]
Length=353

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVG  HDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEP+VIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDGMMPSD+++GVAHDAFNTFFSET AG+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIHPDGMMPSDNTIGVAHDAFNTFFSETSAGR  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKL+DNCTGLQGFLVF+
Sbjct  121  RVRKLSDNCTGLQGFLVFN  139



>ref|XP_011461685.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   281 bits (719),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+++GV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 137/139 (99%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAF+TFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGIMPSDTSVGVACDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+ DG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEADGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+ DG MPSDSSVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   273 bits (697),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   271 bits (693),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MP D++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   277 bits (708),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   273 bits (697),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   281 bits (718),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   281 bits (718),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG  HDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGGGHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   281 bits (718),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVG  HDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGACHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEP+VIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAVFVDLEPSVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+SVG AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSVGAAHDAFNTFFSETSSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEI DLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGAEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTVGREIVNLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+S+GV HD+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSIGVEHDSFNTFFSETRAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVFS
Sbjct  121  RVRKLADNCTGLQGFLVFS  139



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEH I PDGMMPSD+S GV HDAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHDIHPDGMMPSDNSPGVGHDAFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+++GV  DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDNTIGVGRDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI  DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGINQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAB77671.1| alpha-tubulin [Miscanthus sinensis f. glaber]
Length=450

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVADDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGF+VF+
Sbjct  121  RVRKLADNCTGLQGFMVFN  139



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGF+VF+
Sbjct  121  RVRKLADNCTGLQGFMVFN  139



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +3

Query  30   FSERKTNKDSTLKER-ERERMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDS  206
            F + K+N +     R E + MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+
Sbjct  72   FPQIKSNSEKRRINRFELKVMREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDT  131

Query  207  SVGVAHDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAA  386
            SVG+A+D+FNTFFSET AGKHVPRA+F+DLEPTV+DEVRTG+YRQLFHPEQLISGKEDAA
Sbjct  132  SVGIANDSFNTFFSETSAGKHVPRAIFLDLEPTVVDEVRTGSYRQLFHPEQLISGKEDAA  191

Query  387  NNFARGHYTVGKEIXDLCLDRVRKLADNCTGLQGFLVFS  503
            NNFARGHYTVGK+I DLCLDRVRKLADNCTGLQGFLVF+
Sbjct  192  NNFARGHYTVGKDIVDLCLDRVRKLADNCTGLQGFLVFN  230



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGN+CWELYCLEHGIQPDGMMPSD+SVG A D+FNTFFSETG+G 
Sbjct  1    MREIISLHIGQAGIQVGNACWELYCLEHGIQPDGMMPSDTSVGAATDSFNTFFSETGSGN  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGK+I DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKDIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVR+GTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDG+M SD+S+G  HD+FNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMSSDTSIGSEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_002675196.1| alpha-tubulin [Naegleria gruberi]
 ref|XP_002677003.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 ref|XP_002680089.1| alpha-tubulin [Naegleria gruberi]
 sp|P11237.1|TBA1_NAEGR RecName: Full=Tubulin alpha-1/2/3 chain [Naegleria gruberi]
 emb|CAA31074.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31075.1| unnamed protein product [Naegleria gruberi]
 emb|CAA31076.1| unnamed protein product [Naegleria gruberi]
 gb|EFC42452.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44259.1| alpha-tubulin TUBA2 [Naegleria gruberi]
 gb|EFC47345.1| alpha-tubulin [Naegleria gruberi]
Length=453

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAG+QVGN+CWELYCLEHGIQPDG+MPSD ++GV  DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGVQVGNACWELYCLEHGIQPDGLMPSDKTIGVEDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVFS
Sbjct  121  RIRKLADNCTGLQGFLVFS  139



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   275 bits (702),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   279 bits (713),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   278 bits (711),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   279 bits (713),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   279 bits (713),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVGVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVGVAHDAF+TFFSETG+GK
Sbjct  1    MREFISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGVAHDAFSTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGK DAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKADAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD+SVGV HD+FNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDTSVGVEHDSFNTFFSETGLGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CAB77672.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFL F+
Sbjct  121  RVRKLADNCTGLQGFLAFN  139



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   270 bits (691),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI+PDG MP D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+SVG  +D+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSVGTENDSFNTFFSETRAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG++I DLCLD
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDTTVGSGRDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   278 bits (711),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD++ GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTTPGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGF VF+
Sbjct  121  RIRKLADNCTGLQGFFVFN  139



>emb|CAD26889.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=438

 Score =   278 bits (711),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQ GN+CWELYCLEHGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQGGNACWELYCLEHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGLYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_001427644.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60246.1| unnamed protein product [Paramecium tetraurelia]
Length=189

 Score =   270 bits (689),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIH+GQ GIQVGN+CWEL+CLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   278 bits (712),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCL HGI+PDG MPSD+SVG AHDAFNTFFSETG+G+
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLGHGIEPDGTMPSDTSVGAAHDAFNTFFSETGSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   278 bits (712),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEH I PDG MPSD+S+GVAHDAFNTFFSETG+GK
Sbjct  1    MREIISVHIGQAGIQVGNSCWELYCLEHEIHPDGTMPSDTSMGVAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGF+VF+
Sbjct  121  RVRKLADNCTGLQGFMVFN  139



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQL+SGKEDAANNFARGHYTVGKEI DLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDGMMP D+SVG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVR+G +RQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI +LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQG LVF+
Sbjct  121  RIRKLADNCTGLQGSLVFN  139



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDGMMP D+SVG  HDAFNTFFSETG+GK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGMMPGDTSVGACHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVR+G +RQLFHPEQLISGKEDAANNFARGHYTVG+EI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGAFRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_004985171.1| PREDICTED: tubulin alpha-2 chain-like [Setaria italica]
Length=448

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVARDAFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEV+TGTYRQLFHPEQLIS KEDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGTYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AFW89176.1| hypothetical protein ZEAMMB73_322393 [Zea mays]
Length=448

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVG+A DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGIARDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEV+TG YRQLFHPEQLIS KEDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVIDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   275 bits (704),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD + G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVFS
Sbjct  121  RIRKLADNCTGLQGFLVFS  139



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVFS
Sbjct  121  RIRKLADNCTGLQGFLVFS  139



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVFS
Sbjct  121  RIRKLADNCTGLQGFLVFS  139



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MPSD++VGVAHDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQQDGTMPSDTTVGVAHDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCL 
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLG  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVR+LADNCTGLQGFLVF+
Sbjct  121  RVRQLADNCTGLQGFLVFN  139



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGNSCWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   270 bits (690),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MP D ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGI PDGMMPSD SVG+A+D+FNTFFSET AGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIHPDGMMPSDKSVGIANDSFNTFFSETSAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA++VDLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG++I DLCLD
Sbjct  61   HVPRAIYVDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGRDIIDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFL+F+
Sbjct  121  RVRKLADNCTGLQGFLIFN  139



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD+SVG+AHDAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTSVGIAHDAFNTFFSETGFGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPR +F+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DL LD
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>sp|Q25563.1|TBA13_NAEGR RecName: Full=Tubulin alpha-13 chain [Naegleria gruberi]
 emb|CAA56939.1| alpha-tubulin [Naegleria gruberi]
Length=453

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAG+QVGN+CWELYCLEHGIQPDG+MPS  ++GV  DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGVQVGNACWELYCLEHGIQPDGLMPSSKTIGVEDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLI+GKEDAANN+ARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVFS
Sbjct  121  RIRKLADNCTGLQGFLVFS  139



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  84   RMREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAG  263
            +MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAG
Sbjct  4    KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAG  63

Query  264  KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCL  443
            KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCL
Sbjct  64   KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  123

Query  444  DRVRKLADNCTGLQGFLVF  500
            DR+RKLADNCTGLQGFLVF
Sbjct  124  DRIRKLADNCTGLQGFLVF  142



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>dbj|BAJ06365.1| alpha-tubulin [Alopecurus aequalis]
Length=449

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGIMPSDTSVGVAKDAFNTFFSETGTGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS KEDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFL+F+
Sbjct  121  RIRKLADNCTGLQGFLIFN  139



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+IS+HIGQAGIQVGNSCWELYCLEHGIQPDGMMPSD+S G AHDAFNTFFSETGAGK
Sbjct  19   MREIISVHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDTSPGAAHDAFNTFFSETGAGK  78

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
             VPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  79   RVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  138

Query  447  RVRKLADNCTGLQGFLVFS  503
             VRKLA NCTGLQGFLVF+
Sbjct  139  PVRKLAINCTGLQGFLVFN  157



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD SVG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQ DG MP D ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD++VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGI PDG MPSD++VG+AHDAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGINPDGTMPSDTTVGIAHDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRALFVDLEPSVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHG+QPDG MP D+SVG+ HD+FNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGMQPDGTMPGDTSVGMEHDSFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEP+VIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI +LCLD
Sbjct  61   HVPRAIFVDLEPSVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGNSCWELYC+EHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|KDD76276.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=450

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD S G + DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDRSYGASDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI D+CLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEH IQPDGMMPSD+S G AHDAFNTFFSET +GK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHDIQPDGMMPSDTSPGAAHDAFNTFFSETSSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLF+PEQL+SGKEDAANNFARGHYTVGKEI DLC+D
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFYPEQLMSGKEDAANNFARGHYTVGKEIVDLCVD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG M SD+SV V  DAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMSSDTSVVVGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVF  500
            R+RKLADNCTGLQGFLVF
Sbjct  121  RIRKLADNCTGLQGFLVF  138



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD+SVG   D+FNTFFSETG+G 
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDTSVGSETDSFNTFFSETGSGS  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            RVRKLADNCTGLQGFLVF+
Sbjct  121  RVRKLADNCTGLQGFLVFN  139



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   276 bits (706),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSDS+VGV HDAFNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSTVGVCHDAFNTFFSETSSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI D CL+
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLE  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RLRKLADNCTGLQGFLVFN  139



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABD92939.1| alpha tubulin-5D [Triticum aestivum]
 gb|ABD92941.1| alpha tubulin-5B [Triticum aestivum]
Length=449

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>gb|ABD92940.1| alpha tubulin-5A [Triticum aestivum]
Length=449

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>dbj|BAJ86161.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88353.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG+MPSD+SVGVA DAFNTFFSETG+GK
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLMPSDTSVGVAKDAFNTFFSETGSGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLIS  EDAANNFARGHYTVG+E+ DLCLD
Sbjct  61   HVPRALFVDLEPTVIDEVRTGAYRQLFHPEQLISHNEDAANNFARGHYTVGREVVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI D+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGI PDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE IS+HIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MPSD +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE ISIHIGQAGIQVGN+CWELYCLEHGIQPDG MP+D +VG   DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MRE+ISIHIGQAGIQVGNSCWELYCLEHGIQPDG MPSDS+VG  HDAFNTFFSET +G+
Sbjct  1    MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTMPSDSNVGACHDAFNTFFSETSSGQ  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVG+EI D CLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RLRKLADNCTGLQGFLVFN  139



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +3

Query  87   MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMPSDSSVGVAHDAFNTFFSETGAGK  266
            MREVISIH+GQAGIQ+GN+CWELYCLEHGIQPDG MPSD ++G   DAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  267  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIXDLCLD  446
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEI DLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  447  RVRKLADNCTGLQGFLVFS  503
            R+RKLADNCTGLQGFLVF+
Sbjct  121  RIRKLADNCTGLQGFLVFN  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905