BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033E15

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    179   1e-50   Sesamum indicum [beniseed]
emb|CDP20190.1|  unnamed protein product                                175   4e-49   Coffea canephora [robusta coffee]
gb|EYU25735.1|  hypothetical protein MIMGU_mgv1a007058mg                175   5e-49   Erythranthe guttata [common monkey flower]
ref|XP_011094065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    174   9e-49   Sesamum indicum [beniseed]
ref|XP_010263306.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    174   2e-48   Nelumbo nucifera [Indian lotus]
ref|XP_004299778.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    171   2e-47   Fragaria vesca subsp. vesca
ref|XP_004153767.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    166   4e-47   
ref|XP_007222601.1|  hypothetical protein PRUPE_ppa006288mg             170   4e-47   Prunus persica
ref|XP_009770718.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    169   6e-47   Nicotiana sylvestris
ref|XP_009770720.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    169   6e-47   Nicotiana sylvestris
emb|CAN70416.1|  hypothetical protein VITISV_021860                     165   2e-46   Vitis vinifera
ref|XP_008223819.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    168   2e-46   Prunus mume [ume]
ref|XP_009616437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    168   2e-46   Nicotiana tomentosiformis
ref|XP_009616439.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    167   3e-46   
ref|XP_009616433.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    168   3e-46   
ref|XP_009616438.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    167   3e-46   Nicotiana tomentosiformis
ref|XP_009616436.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    167   5e-46   
ref|XP_009342823.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    167   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_009341734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    164   9e-46   Pyrus x bretschneideri [bai li]
ref|XP_004163014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    166   1e-45   
ref|XP_002265606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    166   2e-45   Vitis vinifera
ref|XP_009626648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    166   2e-45   Nicotiana tomentosiformis
ref|XP_009341732.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    165   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_010106955.1|  Ethanolamine-phosphate cytidylyltransferase        165   2e-45   Morus notabilis
ref|XP_008351357.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    165   3e-45   
ref|XP_006360666.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    165   4e-45   Solanum tuberosum [potatoes]
ref|XP_006361583.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    165   4e-45   Solanum tuberosum [potatoes]
ref|XP_004242864.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    165   4e-45   Solanum lycopersicum
ref|XP_011017741.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    164   5e-45   Populus euphratica
ref|XP_010688423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    164   6e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002325231.2|  hypothetical protein POPTR_0018s13260g             163   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008453525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    162   4e-44   Cucumis melo [Oriental melon]
ref|XP_009783881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    161   1e-43   Nicotiana sylvestris
gb|KCW80819.1|  hypothetical protein EUGRSUZ_C02186                     159   1e-43   Eucalyptus grandis [rose gum]
ref|XP_002308992.1|  hypothetical protein POPTR_0006s07030g             160   2e-43   
ref|XP_010048543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    160   2e-43   Eucalyptus grandis [rose gum]
ref|XP_007014459.1|  Phosphorylethanolamine cytidylyltransferase ...    159   4e-43   
ref|XP_004240130.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    159   4e-43   Solanum lycopersicum
gb|KDO54358.1|  hypothetical protein CISIN_1g0144871mg                  154   1e-42   Citrus sinensis [apfelsine]
gb|KHG01776.1|  Ethanolamine-phosphate cytidylyltransferase             157   4e-42   Gossypium arboreum [tree cotton]
gb|KJB23397.1|  hypothetical protein B456_004G096200                    157   4e-42   Gossypium raimondii
gb|KJB23398.1|  hypothetical protein B456_004G096200                    157   4e-42   Gossypium raimondii
gb|KDO54356.1|  hypothetical protein CISIN_1g0144871mg                  155   5e-42   Citrus sinensis [apfelsine]
ref|XP_004503546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    156   6e-42   Cicer arietinum [garbanzo]
gb|KDO54355.1|  hypothetical protein CISIN_1g0144871mg                  156   7e-42   Citrus sinensis [apfelsine]
ref|XP_006428518.1|  hypothetical protein CICLE_v10011809mg             156   8e-42   Citrus clementina [clementine]
gb|KDO54357.1|  hypothetical protein CISIN_1g0144871mg                  154   1e-41   Citrus sinensis [apfelsine]
ref|XP_011020099.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    154   3e-41   Populus euphratica
ref|XP_003630621.1|  Ethanolamine-phosphate cytidylyltransferase        151   3e-41   
ref|XP_003525313.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    154   4e-41   Glycine max [soybeans]
ref|XP_003530503.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    152   1e-40   Glycine max [soybeans]
ref|XP_003630619.1|  Ethanolamine-phosphate cytidylyltransferase        152   2e-40   Medicago truncatula
ref|XP_003630620.1|  Ethanolamine-phosphate cytidylyltransferase        152   2e-40   
gb|AET05096.2|  ethanolamine-phosphate cytidylyltransferase             151   3e-40   Medicago truncatula
gb|ACJ85759.1|  unknown                                                 152   3e-40   Medicago truncatula
ref|XP_007160226.1|  hypothetical protein PHAVU_002G303400g             149   3e-39   Phaseolus vulgaris [French bean]
ref|XP_010913786.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    147   6e-39   
ref|XP_008781724.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    148   7e-39   Phoenix dactylifera
ref|XP_010928770.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    147   1e-38   
gb|KDP45833.1|  hypothetical protein JCGZ_17440                         147   2e-38   Jatropha curcas
ref|XP_010913784.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    147   2e-38   Elaeis guineensis
ref|XP_010928769.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    147   3e-38   Elaeis guineensis
gb|KHG07400.1|  Ethanolamine-phosphate cytidylyltransferase             139   8e-37   Gossypium arboreum [tree cotton]
ref|XP_010669056.1|  PREDICTED: uncharacterized protein LOC104886293    133   5e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB83345.1|  hypothetical protein B456_013G242400                    139   1e-35   Gossypium raimondii
dbj|BAD03428.1|  putative phosphoethanolamine cytidylyltransferase      128   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMT24851.1|  Ethanolamine-phosphate cytidylyltransferase             127   2e-31   
ref|NP_001064493.1|  Os10g0387000                                       127   2e-31   
gb|EAZ15919.1|  hypothetical protein OsJ_31340                          127   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    127   3e-31   Oryza brachyantha
dbj|BAJ95410.1|  predicted protein                                      126   5e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85025.1|  unnamed protein product                                126   7e-31   Triticum aestivum [Canadian hard winter wheat]
gb|EMS51700.1|  Ethanolamine-phosphate cytidylyltransferase             125   9e-31   Triticum urartu
gb|AAK13093.1|AC078839_9  Putative phospholipid cytidylyltransferase    126   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   7e-30   
ref|XP_003564627.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   8e-30   
ref|XP_003573570.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   8e-30   Brachypodium distachyon [annual false brome]
ref|XP_004972545.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   1e-29   
ref|XP_004972543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   1e-29   
ref|XP_004972544.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   1e-29   
ref|XP_004972542.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    123   1e-29   
gb|AFW57038.1|  hypothetical protein ZEAMMB73_658422                    121   5e-29   
gb|EPS64234.1|  hypothetical protein M569_10547                         117   1e-27   Genlisea aurea
emb|CCW28789.1|  putative cytidylyltransferase                          107   2e-24   Arachis duranensis
ref|XP_002990148.1|  hypothetical protein SELMODRAFT_131236             104   4e-23   
ref|XP_002992541.1|  hypothetical protein SELMODRAFT_162424             104   4e-23   Selaginella moellendorffii
gb|ABX10446.1|  ethanolamine-phosphate cytidylyltransferase 2           100   1e-21   Gossypium hirsutum [American cotton]
ref|XP_004978492.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  95.9    5e-20   Setaria italica
ref|XP_002526236.1|  conserved hypothetical protein                   94.4    1e-19   
gb|EEC67567.1|  hypothetical protein OsI_34911                        94.4    2e-19   Oryza sativa Indica Group [Indian rice]
dbj|BAJ86064.1|  predicted protein                                    94.0    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA91254.1|  phosphoethanolamine cytidylyltransferase, putativ...  92.8    3e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAO43227.1|  phosphoethanolamine cytidylyltransferase              93.6    3e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842638.1|  hypothetical protein AMTR_s00077p00187820        93.6    3e-19   
ref|XP_006664291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  93.6    3e-19   Oryza brachyantha
ref|XP_004160346.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.4    4e-19   
gb|ABX10445.1|  ethanolamine-phosphate cytidylyltransferase 1         92.8    4e-19   Gossypium hirsutum [American cotton]
ref|XP_010931423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  93.2    5e-19   Elaeis guineensis
dbj|BAK04174.1|  predicted protein                                    92.8    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI40665.3|  unnamed protein product                              92.0    6e-19   Vitis vinifera
ref|XP_004977412.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.8    6e-19   Setaria italica
ref|NP_001066024.1|  Os12g0121300                                     92.4    7e-19   
ref|XP_004137664.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.8    8e-19   Cucumis sativus [cucumbers]
gb|KHN40576.1|  Ethanolamine-phosphate cytidylyltransferase           89.7    9e-19   Glycine soja [wild soybean]
ref|XP_010529960.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.0    9e-19   Tarenaya hassleriana [spider flower]
gb|ABN08306.1|  Cytidylyltransferase                                  90.5    1e-18   Medicago truncatula
ref|XP_006293474.1|  hypothetical protein CARUB_v10023288mg           92.0    1e-18   Capsella rubella
ref|NP_181401.1|  ethanolamine-phosphate cytidylyltransferase         92.0    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879759.1|  hypothetical protein ARALYDRAFT_903103           92.0    1e-18   Arabidopsis lyrata subsp. lyrata
emb|CDY18374.1|  BnaA04g22130D                                        91.7    1e-18   Brassica napus [oilseed rape]
ref|XP_010509160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010517175.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008442303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.0    1e-18   Cucumis melo [Oriental melon]
emb|CDX91484.1|  BnaC04g06660D                                        91.7    1e-18   
ref|XP_009141755.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  91.7    1e-18   Brassica rapa
ref|XP_010529959.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  92.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_009133281.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  91.7    1e-18   Brassica rapa
ref|XP_007140015.1|  hypothetical protein PHAVU_008G077100g           91.7    1e-18   Phaseolus vulgaris [French bean]
gb|KFK36771.1|  hypothetical protein AALP_AA4G168400                  91.7    2e-18   Arabis alpina [alpine rockcress]
ref|XP_001759318.1|  predicted protein                                91.7    2e-18   
ref|XP_006411085.1|  hypothetical protein EUTSA_v10016709mg           91.7    2e-18   Eutrema salsugineum [saltwater cress]
emb|CDY07710.1|  BnaA03g18010D                                        91.7    2e-18   Brassica napus [oilseed rape]
ref|XP_003623696.1|  Ethanolamine-phosphate cytidylyltransferase      90.5    2e-18   
gb|AES79914.2|  ethanolamine-phosphate cytidylyltransferase           90.5    2e-18   Medicago truncatula
emb|CDY14442.1|  BnaC03g21530D                                        91.3    2e-18   Brassica napus [oilseed rape]
ref|XP_008364008.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...  90.1    2e-18   
ref|XP_008442302.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  91.7    3e-18   Cucumis melo [Oriental melon]
ref|XP_008370315.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.9    3e-18   
ref|XP_003623695.1|  Ethanolamine-phosphate cytidylyltransferase      90.9    3e-18   
gb|AFK43034.1|  unknown                                               90.9    3e-18   Medicago truncatula
gb|AES79913.2|  ethanolamine-phosphate cytidylyltransferase           90.9    3e-18   Medicago truncatula
ref|XP_010553187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.9    3e-18   Tarenaya hassleriana [spider flower]
ref|XP_008358193.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.9    3e-18   
ref|XP_009337844.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.9    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_009370855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.9    4e-18   Pyrus x bretschneideri [bai li]
ref|XP_007207330.1|  hypothetical protein PRUPE_ppa006076mg           90.5    4e-18   Prunus persica
ref|XP_004302493.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.5    4e-18   Fragaria vesca subsp. vesca
ref|XP_001780359.1|  predicted protein                                90.1    4e-18   
ref|XP_006850949.1|  hypothetical protein AMTR_s00025p00194560        88.6    4e-18   
ref|XP_006587893.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.1    4e-18   Glycine max [soybeans]
ref|XP_002519980.1|  Ethanolamine-phosphate cytidylyltransferase,...  90.5    5e-18   Ricinus communis
ref|XP_009801689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.1    5e-18   Nicotiana sylvestris
ref|XP_002323699.2|  hypothetical protein POPTR_0016s15020g           90.5    5e-18   Populus trichocarpa [western balsam poplar]
gb|KDO64220.1|  hypothetical protein CISIN_1g021802mg                 89.4    5e-18   Citrus sinensis [apfelsine]
ref|XP_009606107.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.1    5e-18   Nicotiana tomentosiformis
ref|XP_010505515.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.4    5e-18   
gb|KDP21814.1|  hypothetical protein JCGZ_00601                       90.1    5e-18   Jatropha curcas
gb|KDO64219.1|  hypothetical protein CISIN_1g021802mg                 89.0    6e-18   Citrus sinensis [apfelsine]
ref|XP_003533643.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.1    6e-18   Glycine max [soybeans]
ref|XP_009143367.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  90.1    6e-18   Brassica rapa
gb|EYU26697.1|  hypothetical protein MIMGU_mgv1a007403mg              90.1    6e-18   Erythranthe guttata [common monkey flower]
gb|KHN29458.1|  Ethanolamine-phosphate cytidylyltransferase           90.1    6e-18   Glycine soja [wild soybean]
emb|CDX74894.1|  BnaA05g06400D                                        90.1    6e-18   
emb|CDX84098.1|  BnaC08g07750D                                        89.0    7e-18   
ref|XP_004492610.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    7e-18   Cicer arietinum [garbanzo]
ref|XP_003552337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    7e-18   Glycine max [soybeans]
ref|XP_010922838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    8e-18   Elaeis guineensis
ref|XP_008804653.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    8e-18   Phoenix dactylifera
ref|XP_010036048.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    8e-18   
ref|XP_010036047.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.7    9e-18   Eucalyptus grandis [rose gum]
gb|EEC66861.1|  hypothetical protein OsI_33354                        88.6    1e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_003577861.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.4    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_006362326.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.4    1e-17   Solanum tuberosum [potatoes]
ref|XP_004249014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.0    1e-17   Solanum lycopersicum
gb|KJB27590.1|  hypothetical protein B456_005G001400                  89.0    1e-17   Gossypium raimondii
ref|XP_008244222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.4    1e-17   Prunus mume [ume]
ref|XP_006429675.1|  hypothetical protein CICLE_v10011843mg           89.0    1e-17   Citrus clementina [clementine]
ref|XP_011101976.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.0    1e-17   Sesamum indicum [beniseed]
ref|XP_011018911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  89.0    1e-17   Populus euphratica
ref|XP_006381291.1|  hypothetical protein POPTR_0006s11470g           89.0    2e-17   
ref|XP_002450173.1|  hypothetical protein SORBIDRAFT_05g001470        88.6    2e-17   Sorghum bicolor [broomcorn]
ref|XP_010684667.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.6    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009381352.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.6    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003579008.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.6    2e-17   Brachypodium distachyon [annual false brome]
ref|XP_008679350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.6    2e-17   Zea mays [maize]
ref|XP_009410481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.2    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278899.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.2    3e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008788034.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  88.2    3e-17   Phoenix dactylifera
ref|NP_001170703.1|  hypothetical protein                             88.2    3e-17   Zea mays [maize]
gb|EPS71148.1|  hypothetical protein M569_03610                       87.4    3e-17   Genlisea aurea
ref|XP_009384337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  87.8    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE51553.1|  hypothetical protein OsJ_32765                        87.0    4e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  87.0    8e-17   Vitis vinifera
emb|CAQ58636.1|  Ethanolamine-phosphate cytidylyltransferase          87.0    8e-17   Vitis vinifera
gb|EEC68755.1|  hypothetical protein OsI_37278                        86.7    1e-16   Oryza sativa Indica Group [Indian rice]
emb|CDP06353.1|  unnamed protein product                              85.1    2e-16   Coffea canephora [robusta coffee]
emb|CBI31131.3|  unnamed protein product                              84.3    3e-16   Vitis vinifera
ref|XP_011006224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  84.7    4e-16   Populus euphratica
ref|XP_011006223.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  84.3    8e-16   Populus euphratica
ref|XP_005538734.1|  phosphoethanolamine cytidylyltransferase         82.8    3e-15   Cyanidioschyzon merolae strain 10D
ref|XP_002950808.1|  hypothetical protein VOLCADRAFT_109104           82.4    3e-15   Volvox carteri f. nagariensis
ref|XP_001692963.1|  CDP-Ethanolamine synthase                        82.4    4e-15   Chlamydomonas reinhardtii
ref|XP_004991058.1|  phosphoethanolamine cytidylyltransferase         81.3    5e-15   Salpingoeca rosetta
ref|XP_005647873.1|  CTP-phosphoethanolamine cytidylyltransferase     81.6    9e-15   Coccomyxa subellipsoidea C-169
emb|CDS08409.1|  hypothetical protein LRAMOSA09772                    79.0    3e-14   Lichtheimia ramosa
ref|XP_003283291.1|  phosphoethanolamine-cytidyltransferase           78.6    4e-14   Dictyostelium purpureum
ref|XP_001744354.1|  hypothetical protein                             78.6    4e-14   Monosiga brevicollis MX1
emb|CDH58541.1|  ethanolamine-phosphate cytidylyltransferase-like     78.6    5e-14   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH52899.1|  ethanolamine-phosphate cytidylyltransferase-like     79.0    5e-14   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_646687.1|  hypothetical protein DDB_G0270298                   78.2    6e-14   Dictyostelium discoideum AX4
emb|CDH58540.1|  ethanolamine-phosphate cytidylyltransferase          78.2    7e-14   Lichtheimia corymbifera JMRC:FSU:9682
gb|AAW24841.1|  SJCHGC06128 protein                                   78.2    1e-13   Schistosoma japonicum
ref|XP_001988302.1|  GH11091                                          77.8    1e-13   Drosophila grimshawi
gb|KDD76579.1|  hypothetical protein H632_c175p1                      78.2    1e-13   Helicosporidium sp. ATCC 50920
ref|XP_003081234.1|  CTP:ethanolamine cytidylyltransferase (ISS)      77.0    2e-13   
dbj|GAM28819.1|  hypothetical protein SAMD00019534_119950             76.3    3e-13   Acytostelium subglobosum LB1
emb|CEF99073.1|  Rossmann-like alpha/beta/alpha sandwich fold         76.6    3e-13   Ostreococcus tauri
emb|CDS11051.1|  Putative Ethanolamine-phosphatecytidylyltransferase  76.3    3e-13   Lichtheimia ramosa
ref|XP_001419566.1|  predicted protein                                75.9    3e-13   Ostreococcus lucimarinus CCE9901
ref|XP_004353870.1|  phosphoethanolamine-cytidyltransferase           75.9    4e-13   Cavenderia fasciculata
ref|XP_003742761.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    4e-13   
ref|XP_002611477.1|  hypothetical protein BRAFLDRAFT_113520           76.3    4e-13   Branchiostoma floridae
ref|XP_003742758.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    4e-13   Galendromus occidentalis
ref|XP_009027596.1|  hypothetical protein HELRODRAFT_107813           76.3    4e-13   Helobdella robusta
ref|XP_003742759.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    5e-13   Galendromus occidentalis
ref|XP_006675067.1|  hypothetical protein BATDEDRAFT_9006             75.5    5e-13   Batrachochytrium dendrobatidis JAM81
ref|XP_829470.1|  ethanolamine-phosphate cytidylyltransferase         75.9    5e-13   Trypanosoma brucei brucei TREU927
ref|XP_001623420.1|  predicted protein                                75.9    5e-13   Nematostella vectensis
ref|XP_003742760.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    5e-13   
emb|CEG66906.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  74.7    5e-13   Rhizopus microsporus
ref|XP_004343166.1|  phosphoethanolamine-cytidyltransferase           75.9    6e-13   Capsaspora owczarzaki ATCC 30864
emb|CEP15035.1|  hypothetical protein                                 75.5    6e-13   Parasitella parasitica
ref|XP_007228977.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    6e-13   
ref|XP_002423231.1|  Ethanolamine-phosphate cytidylyltransferase,...  75.9    7e-13   Pediculus humanus corporis [human body lice]
gb|EXX58968.1|  ethanolamine-phosphate cytidylyltransferase           75.1    7e-13   Rhizophagus irregularis DAOM 197198w
ref|XP_002600903.1|  hypothetical protein BRAFLDRAFT_263711           75.1    7e-13   Branchiostoma floridae
ref|XP_001969670.1|  GG23821                                          75.5    7e-13   Drosophila erecta
ref|XP_011188404.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.9    7e-13   Zeugodacus cucurbitae [melon fruit fly]
emb|CEG84347.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  75.1    7e-13   Rhizopus microsporus
ref|NP_723791.2|  phosphoethanolamine cytidylyltransferase, isofo...  75.1    7e-13   Drosophila melanogaster
ref|XP_002042126.1|  GM10235                                          75.5    8e-13   Drosophila sechellia
ref|XP_011188405.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_002079297.1|  GD23872                                          75.5    8e-13   Drosophila simulans
ref|NP_609613.2|  phosphoethanolamine cytidylyltransferase, isofo...  75.1    8e-13   Drosophila melanogaster
emb|CEG66905.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  75.1    8e-13   Rhizopus microsporus
ref|XP_002088547.1|  pect                                             75.5    8e-13   Drosophila yakuba
gb|EKC33550.1|  Ethanolamine-phosphate cytidylyltransferase           74.7    8e-13   
gb|EPB91886.1|  ethanolamine-phosphate cytidylyltransferase           75.1    8e-13   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002065671.1|  GK14544                                          75.5    8e-13   Drosophila willistoni
ref|NP_723790.2|  phosphoethanolamine cytidylyltransferase, isofo...  75.1    8e-13   Drosophila melanogaster
ref|XP_011202025.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Bactrocera dorsalis [papaya fruit fly]
ref|NP_723789.2|  phosphoethanolamine cytidylyltransferase, isofo...  75.5    8e-13   Drosophila melanogaster
ref|XP_005181838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.1    8e-13   Musca domestica
ref|XP_011202026.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002002855.1|  GI17607                                          75.5    8e-13   Drosophila mojavensis
emb|CEP18288.1|  hypothetical protein                                 75.1    8e-13   Parasitella parasitica
ref|XP_004527208.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Ceratitis capitata [medfly]
ref|XP_004527209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    8e-13   Ceratitis capitata [medfly]
ref|XP_005181836.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  75.5    9e-13   Musca domestica
ref|XP_001962647.1|  GF15564                                          75.1    1e-12   Drosophila ananassae
ref|XP_004374405.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    1e-12   Trichechus manatus latirostris
ref|XP_004931530.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.7    1e-12   
ref|XP_966534.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...  74.7    1e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_011414849.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.7    1e-12   Crassostrea gigas
emb|CEI99016.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  74.3    1e-12   Rhizopus microsporus
ref|XP_001602017.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    1e-12   Nasonia vitripennis
emb|CEG75718.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  74.7    1e-12   Rhizopus microsporus
ref|XP_011414848.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.7    1e-12   Crassostrea gigas
gb|EIE76135.1|  hypothetical protein RO3G_00839                       74.3    1e-12   Rhizopus delemar RA 99-880
ref|XP_003697467.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    1e-12   Apis florea [dwarf honeybee]
ref|XP_003489672.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    1e-12   
gb|ENN72223.1|  hypothetical protein YQE_11086                        74.3    1e-12   Dendroctonus ponderosae
ref|XP_006560066.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Apis mellifera [bee]
ref|XP_006621262.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Apis dorsata [rock honeybee]
ref|XP_002129881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    2e-12   Ciona intestinalis [sea vase]
ref|XP_006560065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   
ref|XP_003701917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    2e-12   Megachile rotundata
ref|XP_003400920.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    2e-12   
ref|XP_624319.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...  74.3    2e-12   Apis mellifera [bee]
ref|XP_006621260.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    2e-12   Apis dorsata [rock honeybee]
ref|XP_006621261.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Apis dorsata [rock honeybee]
ref|XP_011062229.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Acromyrmex echinatior
ref|XP_011157857.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Solenopsis invicta [imported red fire ant]
emb|CCD12240.1|  unnamed protein product                              74.3    2e-12   Trypanosoma congolense IL3000
ref|XP_009861142.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  74.3    2e-12   
emb|CCC95928.1|  unnamed protein product                              74.3    2e-12   Trypanosoma congolense IL3000
ref|XP_011247509.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    2e-12   
ref|XP_011157856.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Solenopsis invicta [imported red fire ant]
ref|XP_011062227.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   Acromyrmex echinatior
ref|XP_011262174.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   
ref|XP_011157855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   
emb|CEJ00776.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  73.2    2e-12   
emb|CEJ03656.1|  Putative Ethanolamine-phosphate cytidylyltransfe...  72.8    2e-12   
ref|XP_011262173.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    2e-12   
ref|XP_009308303.1|  putative ethanolamine-phosphate cytidylyltra...  73.9    2e-12   
ref|XP_011335816.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    2e-12   
ref|XP_011335781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    2e-12   
ref|XP_008544243.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    2e-12   
ref|XP_001467774.1|  ethanolamine-phosphate cytidylyltransferase      73.9    3e-12   
ref|XP_002109515.1|  hypothetical protein TRIADDRAFT_53627            73.6    3e-12   
ref|XP_011335791.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
ref|XP_002021799.1|  GL26305                                          73.9    3e-12   
gb|EFN75296.1|  Ethanolamine-phosphate cytidylyltransferase           73.6    3e-12   
gb|EFZ19242.1|  hypothetical protein SINV_05990                       74.3    3e-12   
ref|XP_011153206.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
gb|EHJ66000.1|  putative ethanolamine-phosphate cytidylyltransferase  73.6    3e-12   
gb|KFB49144.1|  AGAP009263-PA-like protein                            74.7    3e-12   
ref|XP_006635464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    3e-12   
ref|XP_005905438.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
gb|EFX78214.1|  hypothetical protein DAPPUDRAFT_305267                73.6    3e-12   
ref|XP_010998501.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
ref|XP_007462373.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.9    3e-12   
ref|XP_006064293.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
ref|XP_004275630.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
gb|KFM68067.1|  Ethanolamine-phosphate cytidylyltransferase           73.6    3e-12   
ref|NP_001030261.1|  ethanolamine-phosphate cytidylyltransferase      73.6    3e-12   
ref|XP_007462374.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    3e-12   
ref|XP_008996160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    3e-12   
gb|EPX73929.1|  ethanolamine-phosphate cytidylyltransferase           73.2    3e-12   
dbj|GAN05681.1|  phosphoethanolamine-cytidyltransferase               73.2    3e-12   
ref|XP_006064292.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    4e-12   
ref|NP_001167040.1|  Ethanolamine-phosphate cytidylyltransferase      73.6    4e-12   
ref|XP_005221085.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.6    4e-12   
emb|CDQ89313.1|  unnamed protein product                              70.1    4e-12   
ref|XP_005069861.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  73.2    4e-12   
ref|XP_320056.4|  AGAP009264-PA                                       73.2    4e-12   
ref|XP_001851245.1|  ethanolamine-phosphate cytidylyltransferase      73.2    5e-12   
ref|XP_004310339.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...  73.2    5e-12   
ref|XP_001112535.2|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    5e-12   
ref|NP_001006037.1|  ethanolamine-phosphate cytidylyltransferase      73.2    5e-12   
ref|XP_005714716.1|  Ethanolamine-phosphate cytidylyltransferase,...  73.6    5e-12   
ref|XP_011503865.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    5e-12   
ref|XP_006791697.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    5e-12   
ref|XP_005283124.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    5e-12   
ref|XP_792241.3|  PREDICTED: ethanolamine-phosphate cytidylyltran...  71.2    6e-12   
ref|XP_009492881.1|  hypothetical protein H696_00723                  73.2    6e-12   
ref|XP_819288.1|  ethanolamine-phosphate cytidylyltransferase         72.8    6e-12   
ref|XP_006247997.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
gb|EKG04727.1|  ethanolamine-phosphate cytidylyltransferase, puta...  72.8    6e-12   
ref|XP_006987734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_005069860.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|NP_446020.1|  ethanolamine-phosphate cytidylyltransferase         72.8    6e-12   
ref|XP_002742026.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_005350938.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
emb|CAH91892.1|  hypothetical protein                                 72.8    6e-12   
gb|EKF33174.1|  ethanolamine-phosphate cytidylyltransferase, puta...  72.8    6e-12   
ref|XP_007957994.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_006722350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_005069859.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_004655111.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_004861028.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    6e-12   
ref|XP_008826609.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005350937.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005530695.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_006534134.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_006534133.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_006987733.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_008011480.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_009431795.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005332732.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
gb|AAH03473.1|  Phosphate cytidylyltransferase 2, ethanolamine        72.8    7e-12   
ref|XP_008996157.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
gb|AAH10075.1|  Phosphate cytidylyltransferase 2, ethanolamine        72.8    7e-12   
ref|NP_002852.1|  ethanolamine-phosphate cytidylyltransferase iso...  72.8    7e-12   
ref|XP_005001507.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
dbj|BAE38702.1|  unnamed protein product                              72.8    7e-12   
ref|XP_005585332.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_003464950.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_003913624.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_008826602.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005624049.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    7e-12   
ref|XP_006886376.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    7e-12   
ref|XP_005624048.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005407304.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_008011479.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_005407303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_004861027.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_006534132.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    7e-12   
ref|XP_002806926.3|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    8e-12   
ref|NP_077191.2|  ethanolamine-phosphate cytidylyltransferase         72.8    8e-12   
ref|XP_007538295.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    8e-12   
ref|XP_005585330.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.8    8e-12   
ref|XP_005283123.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    8e-12   
dbj|GAN03222.1|  phosphoethanolamine-cytidyltransferase               72.4    8e-12   
gb|EPY53017.1|  ethanolamine-phosphate cytidylyltransferase           72.4    8e-12   
ref|NP_001086220.1|  phosphate cytidylyltransferase 2, ethanolamine   72.4    8e-12   
ref|XP_005332731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    8e-12   
ref|NP_001171846.1|  ethanolamine-phosphate cytidylyltransferase ...  72.4    8e-12   
ref|XP_003059553.1|  predicted protein                                72.8    8e-12   
ref|XP_009431794.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_008058606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_006108013.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_006869689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_003786588.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_006108012.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_005989106.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    9e-12   
ref|XP_007482913.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_001685405.1|  putative ethanolamine-phosphate cytidylyltra...  72.4    1e-11   
ref|XP_004709282.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
ref|XP_003217368.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.4    1e-11   
gb|KDR12653.1|  Ethanolamine-phosphate cytidylyltransferase           72.0    1e-11   
ref|XP_007482911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
ref|XP_007482912.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
ref|XP_004404533.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
emb|CDJ85804.1|  Cytidylyltransferase domain containing protein       72.0    1e-11   
dbj|GAA97700.1|  hypothetical protein E5Q_04378                       71.2    1e-11   
emb|CBJ49051.1|  CTP-phosphoethanolamine cytidylyltransferase         72.8    1e-11   
ref|XP_010872587.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    1e-11   
ref|XP_002607683.1|  hypothetical protein BRAFLDRAFT_82871            71.6    1e-11   
ref|XP_011304878.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    1e-11   
ref|XP_001379677.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
ref|XP_007482910.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  72.0    1e-11   
ref|XP_007886883.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
emb|CAG06029.1|  unnamed protein product                              71.6    2e-11   
ref|XP_008327790.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_010769177.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_008301525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_010728353.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_003964731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_003972083.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
emb|CCC54014.1|  putative ethanolamine-phosphate cytidylyltransfe...  71.2    2e-11   
ref|XP_005801497.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_007556416.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_005801498.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_008414452.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.6    2e-11   
ref|XP_003450120.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    2e-11   
ref|XP_004559463.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    2e-11   
ref|XP_004071464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  71.2    2e-11   
gb|ETE70352.1|  Ethanolamine-phosphate cytidylyltransferase           70.9    2e-11   
ref|XP_009062080.1|  hypothetical protein LOTGIDRAFT_177471           70.9    2e-11   
ref|NP_490931.1|  Protein Y37E3.11, isoform a                         70.9    2e-11   
ref|NP_001122537.1|  Protein Y37E3.11, isoform b                      71.2    2e-11   
emb|CDO41116.1|  Y37E3.11, isoform i                                  71.2    2e-11   
ref|XP_002502198.1|  predicted protein                                70.9    2e-11   
ref|XP_004368196.1|  CTP:ethanolaminephosphate cytidylyltransferase   70.9    2e-11   
gb|EGT34150.1|  hypothetical protein CAEBREN_05370                    70.9    3e-11   
ref|XP_003111139.1|  hypothetical protein CRE_03751                   70.9    3e-11   
gb|EGT45482.1|  hypothetical protein CAEBREN_24398                    70.9    3e-11   
ref|XP_007510493.1|  predicted protein                                71.2    3e-11   
ref|XP_004639529.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    3e-11   
ref|XP_001951262.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    3e-11   
ref|XP_007427841.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.9    3e-11   
ref|XP_006847681.1|  hypothetical protein AMTR_s00149p00045110        66.2    3e-11   
ref|NP_594306.1|  ethanolamine-phosphate cytidylyltransferase (pr...  70.5    3e-11   
ref|XP_005925138.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_005735765.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_001651208.1|  AAEL005651-PA                                    70.5    4e-11   
ref|XP_006790764.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
emb|CAP38711.2|  Protein CBG22040                                     70.1    4e-11   
gb|ESL06891.1|  ethanolamine-phosphate cytidylyltransferase           70.5    4e-11   
ref|XP_010743291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_004539072.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
gb|ETN70673.1|  cytidyltransferase domain protein                     70.5    4e-11   
ref|XP_003455812.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_005925137.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_003337754.1|  hypothetical protein PGTG_19290                  70.1    4e-11   
gb|EYB96677.1|  hypothetical protein Y032_0148g2666                   70.1    4e-11   
ref|XP_002638833.1|  Hypothetical protein CBG22040                    70.1    4e-11   
ref|XP_008315525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    4e-11   
ref|XP_010872584.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.5    5e-11   
ref|XP_005101035.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  66.6    5e-11   
ref|XP_010872586.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  70.1    5e-11   
ref|XP_001567455.1|  ethanolamine-phosphate cytidylyltransferase      70.1    5e-11   
ref|XP_010701782.1|  ethanolamine-phosphate cytidylyltransferase,...  70.1    5e-11   
gb|KIV79985.1|  hypothetical protein PV11_07521                       70.5    5e-11   
ref|XP_003148024.1|  ethanolamine-phosphate cytidylyltransferase      69.3    6e-11   
ref|XP_003877932.1|  ethanolamine-phosphate cytidylyltransferase,...  70.1    6e-11   
emb|CEF71025.1|  Ethanolamine-phosphate cytidylyltransferase          70.1    6e-11   
gb|EFO16045.2|  ethanolamine-phosphate cytidylyltransferase           69.3    6e-11   
ref|XP_002155934.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  69.7    6e-11   
emb|CCW62756.1|  unnamed protein product                              69.7    6e-11   
pdb|3ELB|A  Chain A, Human Ctp: Phosphoethanolamine Cytidylyltran...  69.3    6e-11   
ref|XP_008408685.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  69.7    7e-11   
emb|CAG00211.1|  unnamed protein product                              70.1    7e-11   
ref|XP_005805135.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  69.7    7e-11   
ref|XP_007570241.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  69.7    8e-11   
gb|EWM28205.1|  ethanolamine-phosphate cytidylyltransferase           70.1    8e-11   
ref|XP_011398757.1|  Ethanolamine-phosphate cytidylyltransferase      70.1    8e-11   
gb|KIW12938.1|  hypothetical protein PV08_08125                       69.7    8e-11   
ref|XP_011372018.1|  PREDICTED: NAD-dependent protein deacetylase...  70.5    8e-11   
ref|XP_010870922.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  69.3    9e-11   
gb|KGK40025.1|  hypothetical protein JL09_g724                        69.3    9e-11   
ref|XP_011273662.1|  Ethanolamine-phosphate cytidylyltransferase      68.9    1e-10   
gb|EJW78073.1|  phosphoethanolamine cytidylyltransferase              68.9    1e-10   
emb|CCW70587.1|  unnamed protein product                              68.9    1e-10   
emb|CDP92032.1|  Protein Bm13987, isoform b                           69.3    1e-10   
ref|XP_008278508.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  68.9    1e-10   
ref|XP_008153350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...  68.9    1e-10   
ref|NP_001011300.1|  ethanolamine-phosphate cytidylyltransferase      68.9    1e-10   
ref|XP_972618.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...  68.6    1e-10   
ref|XP_001891878.1|  ethanolamine-phosphate cytidylyltransferase      68.9    1e-10   
gb|KIZ02908.1|  ethanolamine-phosphatecytidylyltransferase            68.9    2e-10   
gb|KHN82689.1|  Ethanolamine-phosphate cytidylyltransferase           68.6    2e-10   
ref|XP_009156441.1|  ethanolamine-phosphate cytidylyltransferase      68.6    2e-10   
gb|KIW38099.1|  hypothetical protein PV06_10066                       68.2    2e-10   
gb|EPY23528.1|  ethanolamine-phosphate cytidylyltransferase           68.2    2e-10   
emb|CDW90365.1|  ethanolamine-phosphate cytidylyltransferase          68.9    3e-10   
gb|KGB33289.1|  Ethanolamine-phosphate cytidylyltransferase           68.2    3e-10   
gb|ACO12188.1|  Ethanolamine-phosphate cytidylyltransferase           67.8    3e-10   
gb|EJY71172.1|  Phosphoethanolamine-cytidyltransferase                67.8    4e-10   
gb|KIW85724.1|  hypothetical protein Z517_01116                       67.4    4e-10   
gb|ERG83522.1|  ethanolamine-phosphate cytidylyltransferase           67.4    4e-10   
gb|EFA80421.1|  phosphoethanolamine-cytidyltransferase                67.0    5e-10   
emb|CCI41645.1|  unnamed protein product                              68.2    6e-10   
gb|EQB76943.1|  ethanolamine-phosphate cytidylyltransferase           67.8    6e-10   
ref|XP_008728824.1|  hypothetical protein G647_06280                  67.0    7e-10   
gb|KIW52359.1|  hypothetical protein PV05_08001                       67.0    7e-10   
gb|KIW67399.1|  hypothetical protein PV04_06658                       67.0    7e-10   
ref|XP_007758446.1|  ethanolamine-phosphate cytidylyltransferase      67.0    8e-10   
gb|KIW31996.1|  hypothetical protein PV07_03580                       67.0    8e-10   



>ref|XP_011094071.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094072.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            MEFES++WI+DG  +YPHLFGGIM+T ALL  ST+YFG+I VPT+PYL PDL VFHK K 
Sbjct  1    MEFESSNWIKDGVYFYPHLFGGIMITCALLSFSTSYFGKISVPTMPYLFPDLRVFHKNKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            A +RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   ANKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIISNKGPPV  112



>emb|CDP20190.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESN+W+ +G  YYPHLFGGIMLTAALLGLST+YFG I VPTLPYLLP   +FHKK R
Sbjct  1    MDYESNNWMWEGMYYYPHLFGGIMLTAALLGLSTSYFGGISVPTLPYLLPGFGIFHKKTR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+ VRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKPVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>gb|EYU25735.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25736.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25737.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
Length=421

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            MEFES+SWI+DGG +YPHLFGGIM+T ALL  ST+YFG I VP + YL PDL VFHKKK 
Sbjct  1    MEFESSSWIKDGGYFYPHLFGGIMITCALLSFSTSYFGIIGVPPMHYLFPDLRVFHKKKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            AK+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   AKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_011094065.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094066.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            MEFES+SWI+DG  +YPHLFGGIM+T ALL  ST+YFG I VPT+P+L PDL  FHKKK 
Sbjct  1    MEFESSSWIKDGVYFYPHLFGGIMITCALLSFSTSYFGMISVPTMPHLFPDLRGFHKKKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            AK+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   AKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIISNKGPPV  112



>ref|XP_010263306.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010263307.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
Length=432

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkk  378
            GSM+FESN+WI DG  YY HLFGGIMLTAA+LG+S++YFG+I VP+LPYL P + VFHKK
Sbjct  2    GSMDFESNNWIWDGVGYYSHLFGGIMLTAAVLGISSSYFGKIGVPSLPYLWPHMEVFHKK  61

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  K+ +RVYMDGCFD+MHYGHANALRQAKALGD L+VGVVSDEEII NKGPPV
Sbjct  62   KYRKKPIRVYMDGCFDLMHYGHANALRQAKALGDILVVGVVSDEEIIANKGPPV  115



>ref|XP_004299778.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011464712.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL PD  +FHKKK 
Sbjct  1    MEYETNNWIWDGVYNHPHVFGGLMLTAALLGLSTSYFGGISVPQLPYLWPDSGIFHKKKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   EKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_004153767.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like, 
partial [Cucumis sativus]
Length=251

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkk  378
            G M++ESNSWI DG  YYPHLFGG+MLTAALLG ST+YF  I VP+LP+   D  +F K+
Sbjct  2    GPMDYESNSWIWDGVYYYPHLFGGLMLTAALLGFSTSYFSGIGVPSLPFFWSDFGIFQKR  61

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  K+R+RVYMDGCFD+MH+GHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   KSEKKRIRVYMDGCFDLMHFGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  115



>ref|XP_007222601.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
 gb|EMJ23800.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
Length=419

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL PD  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWPDSGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   EKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_009770718.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770719.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+LS+  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLSILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009770720.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana sylvestris]
Length=418

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+LS+  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLSILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>emb|CAN70416.1| hypothetical protein VITISV_021860 [Vitis vinifera]
Length=283

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPT-LPYLLPDLSVFHkkk  381
            M+FE+NSWI +G  +YPHLFGGIMLTAA+LGLST++FG I VP+ L Y  PDL +FHK+K
Sbjct  1    MDFENNSWIWEGVYHYPHLFGGIMLTAAVLGLSTSFFGGISVPSSLAYFWPDLGIFHKRK  60

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   HGKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>ref|XP_008223819.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Prunus 
mume]
Length=419

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL PD  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWPDSGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAK LGDEL+VGVVSDEEII NKGPPV
Sbjct  61   EKKRIRVYMDGCFDLMHYGHANALRQAKGLGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_009616437.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Nicotiana tomentosiformis]
Length=426

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+L++  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLNILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009616439.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Nicotiana tomentosiformis]
Length=416

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+L++  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLNILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009616433.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616434.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616435.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=442

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+L++  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLNILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009616438.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Nicotiana tomentosiformis]
Length=424

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+L++  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLNILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009616436.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=434

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+YF  I VPTLP+LLP+L++  KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYFTGISVPTLPHLLPNLNILRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_009342823.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=419

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL  D  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWSDSGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             ++ +RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   DRKHIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_009341734.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Pyrus x bretschneideri]
Length=336

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL  +  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWSESGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   DKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN65519.1| hypothetical protein Csa_1G434170 [Cucumis sativus]
Length=423

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkk  378
            G M++ESNSWI DG  YYPHLFGG+MLTAALLG ST+YF  I VP+LP+   D  +F K+
Sbjct  2    GPMDYESNSWIWDGVYYYPHLFGGLMLTAALLGFSTSYFSGIGVPSLPFFWSDFGIFQKR  61

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  K+R+RVYMDGCFD+MH+GHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   KSEKKRIRVYMDGCFDLMHFGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  115



>ref|XP_002265606.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656673.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656675.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
Length=431

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPT-LPYLLPDLSVFHkkk  381
            M+FE+NSWI +G  +YPHLFGGIMLTAA+LGLST++FG I VP+ L Y  PDL +FHK+K
Sbjct  1    MDFENNSWIWEGVYHYPHLFGGIMLTAAVLGLSTSFFGGISVPSSLAYFWPDLGIFHKRK  60

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   HGKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>ref|XP_009626648.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626649.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626650.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
Length=429

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESN+W+ +G  YYP LFGGIMLTAALLGLST+YFG I VPTL Y   D S+FHKKK 
Sbjct  1    MDFESNNWVWEGMYYYPRLFGGIMLTAALLGLSTSYFGGISVPTLLYPFADRSIFHKKKH  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII  KGPPV
Sbjct  61   GKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIATKGPPV  112



>ref|XP_009341732.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341733.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
Length=418

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL  +  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWSESGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   DKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_010106955.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC12837.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=421

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESN+WI DG   +PHLFGG+MLTAALLGLST+YFG I VP LPYL  DL +F+KKKR
Sbjct  1    MDYESNNWIWDGVYNFPHLFGGLMLTAALLGLSTSYFGGIGVPLLPYLWSDLGIFYKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   DKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_008351357.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
 ref|XP_008351358.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=418

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+E+N+WI DG   +PH+FGG+MLTAALLGLST+YFG I VP LPYL  +  +FHKKK 
Sbjct  1    MEYETNNWIWDGMYNHPHVFGGLMLTAALLGLSTSYFGGITVPQLPYLWSESGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   DKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  112



>ref|XP_006360666.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=427

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +  CYYP LFGG+MLTAALLG+ST+Y   I  PTLP+ LP+LS+F KKKR
Sbjct  1    MDFESNSWIGERLCYYPRLFGGVMLTAALLGVSTSYLTGISAPTLPHFLPNLSIFRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANA+RQAK LGDELIVGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANAIRQAKELGDELIVGVVSDEEIVANKGPPV  112



>ref|XP_006361583.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361584.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=429

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESN+W+ +G  YYP LFGGIMLTAALLGLST+YFG I VPTL Y  P LS+F+KKK 
Sbjct  1    MDFESNNWVWEGMYYYPRLFGGIMLTAALLGLSTSYFGGISVPTLLYPFPYLSIFYKKKH  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII  KGPPV
Sbjct  61   EKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIATKGPPV  112



>ref|XP_004242864.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010323368.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=429

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESN+W+ +G  YYP LFGGIMLTAALLGLST+YFG I VPTL Y  P LS+F+KKK 
Sbjct  1    MDFESNNWVWEGMYYYPRLFGGIMLTAALLGLSTSYFGGISVPTLLYPFPYLSIFYKKKH  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII  KGPPV
Sbjct  61   EKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIATKGPPV  112



>ref|XP_011017741.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
 ref|XP_011017742.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+ES+S I DG  YYPHLFGG+MLTAALLGLST+YFG +   +LPY+  DL +FHKKK 
Sbjct  1    MEYESSSSIWDGVSYYPHLFGGLMLTAALLGLSTSYFGGLGFSSLPYMWSDLGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   QKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_010688423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=428

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+ES+SWI DG CYYPH+FGGIM+TAALLGLST+YFG I V  LPYL P   +  K+  
Sbjct  1    MEYESHSWIWDGVCYYPHVFGGIMITAALLGLSTSYFGGIGVHYLPYLGPGFGILKKQAH  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   EKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEILANKGPPV  112



>ref|XP_002325231.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
 gb|EEF03796.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
Length=423

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+ES+S I DG  YYPHLFGG+MLTAALLGLST+YFG +   +LPY+  DL +FHKKK 
Sbjct  1    MEYESSSSIWDGVYYYPHLFGGLMLTAALLGLSTSYFGGLGFSSLPYMWSDLGIFHKKKC  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   QKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_008453525.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453526.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453527.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
Length=423

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkk  378
            G M++ESNSW+ DG   YPHLFGG+MLTAALLG+ST+YF  I VP+LP+   D  +F K+
Sbjct  2    GPMDYESNSWMWDGVYNYPHLFGGLMLTAALLGISTSYFSGIGVPSLPFFWSDFGIFQKR  61

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  K+R+RVYMDGCFD+MH+GHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   KSEKKRIRVYMDGCFDLMHFGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  115



>ref|XP_009783881.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009783882.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
Length=429

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FE+N+W+ +G  YYP LFGGIMLTAALLGLST+YF  I VPTL Y   D S+FHKKK 
Sbjct  1    MDFENNNWVWEGMYYYPRLFGGIMLTAALLGLSTSYFVGISVPTLLYPFADRSIFHKKKH  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII  KGPPV
Sbjct  61   GKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIATKGPPV  112



>gb|KCW80819.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=338

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  205  MEFES-NSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            ME ES N+WI DG  Y+PHLFGG+MLTAALLGLST YFG I VP+LP+L  D+ +F KKK
Sbjct  1    MEHESLNNWIWDGLYYHPHLFGGLMLTAALLGLSTGYFGGIGVPSLPHLWSDVGIFQKKK  60

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            R K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   RGKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  113



>ref|XP_002308992.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
 gb|EEE92515.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
Length=395

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+ES+S I DG  YYPHLFGG+MLTAALLGLST+YFG +    LPY+  DL VF+KKK 
Sbjct  1    MEYESSSSIWDGVYYYPHLFGGLMLTAALLGLSTSYFGGLGYSYLPYMWSDLGVFYKKKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   EKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_010048543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 gb|KCW80818.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=418

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  205  MEFES-NSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            ME ES N+WI DG  Y+PHLFGG+MLTAALLGLST YFG I VP+LP+L  D+ +F KKK
Sbjct  1    MEHESLNNWIWDGLYYHPHLFGGLMLTAALLGLSTGYFGGIGVPSLPHLWSDVGIFQKKK  60

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            R K+RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   RGKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  113



>ref|XP_007014459.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007014460.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32078.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32079.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
Length=424

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI DG  Y PHLFGG+MLTAALLGLS  YFG I +  L Y+  DL +FHKKK
Sbjct  2    AMEYESNNWIWDGVYYCPHLFGGLMLTAALLGLSATYFGGIGLFPLSYVWSDLGIFHKKK  61

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            R K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   REKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  114



>ref|XP_004240130.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010321543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=427

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+FESNSWI +   YYP LFGG+MLTAALLG+ST+Y   I  PTLP++LP+LS+F KKKR
Sbjct  1    MDFESNSWIGERLFYYPRLFGGVMLTAALLGVSTSYLTGISAPTLPHILPNLSIFRKKKR  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVY+DGCFD+MHYGHANA+RQAK LGDELIVGVVSDEEI+ NKGPPV
Sbjct  61   GKKRIRVYVDGCFDLMHYGHANAIRQAKELGDELIVGVVSDEEIVANKGPPV  112



>gb|KDO54358.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=282

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESNSWI DG  YYPH FGG+MLTAALLG+ST+YFG I V +LP+L  D   FHKKK
Sbjct  2    TMEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKK  59

Query  382  rakr-rvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+ RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  60   CGKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>gb|KHG01776.1| Ethanolamine-phosphate cytidylyltransferase [Gossypium arboreum]
Length=425

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI DG  Y P LFGG+MLTAALLGLST YFG I +  L Y+  D  +FHKKK
Sbjct  3    AMEYESNNWIWDGVYYCPRLFGGLMLTAALLGLSTTYFGGIGLFPLSYVWSDSGIFHKKK  62

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  63   CEKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  115



>gb|KJB23397.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
 gb|KJB23399.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=424

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI DG  Y P LFGG+MLTAALLGLST YFG I +  L Y+  D  +FHKKK
Sbjct  2    AMEYESNNWIWDGVYYCPRLFGGLMLTAALLGLSTTYFGGIGLFPLSYVWSDSGIFHKKK  61

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   CEKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  114



>gb|KJB23398.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=423

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI DG  Y P LFGG+MLTAALLGLST YFG I +  L Y+  D  +FHKKK
Sbjct  2    AMEYESNNWIWDGVYYCPRLFGGLMLTAALLGLSTTYFGGIGLFPLSYVWSDSGIFHKKK  61

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  62   CEKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  114



>gb|KDO54356.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=366

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESNSWI DG  YYPH FGG+MLTAALLG+ST+YFG I V +LP+L  D   FHKKK
Sbjct  2    TMEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKK  59

Query  382  rakr-rvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+ RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  60   CGKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>ref|XP_004503546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=421

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 100/115 (87%), Gaps = 3/115 (3%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTL--PYLLPDLSVFHkk  378
            M++ES+SWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+L  PY   +L +FHKK
Sbjct  1    MDYESSSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGGIGVPSLLLPYSWSNLGIFHKK  60

Query  379  kra-krrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K   KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   KNIGKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  115


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   L++A+ LGD L+VG+ SDE +  N+G
Sbjct  260  YIDGAFDLFHAGHVEVLKRARELGDFLLVGIHSDETVSENRG  301



>gb|KDO54355.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=420

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESNSWI DG  YYPH FGG+MLTAALLG+ST+YFG I V +LP+L  D   FHKKK
Sbjct  2    TMEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKK  59

Query  382  rakr-rvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+ RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  60   CGKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>ref|XP_006428518.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 ref|XP_006491802.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491803.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Citrus sinensis]
 gb|ESR41758.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 gb|KDO54353.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
 gb|KDO54354.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=423

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESNSWI DG  YYPH FGG+MLTAALLG+ST+YFG I V +LP+L  D   FHKKK
Sbjct  2    TMEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKK  59

Query  382  rakr-rvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+ RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  60   CGKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>gb|KDO54357.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=379

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESNSWI DG  YYPH FGG+MLTAALLG+ST+YFG I V +LP+L  D   FHKKK
Sbjct  2    TMEYESNSWIWDGLYYYPHFFGGLMLTAALLGVSTSYFGGIGVFSLPHLWSD--CFHKKK  59

Query  382  rakr-rvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K+ RVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  60   CGKKKRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  113



>ref|XP_011020099.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME+ S+S I DG  Y+PHLFGG+MLTAALLGLST+YFG +    LPY+  DL VF+KKK 
Sbjct  1    MEYVSSSSIWDGVYYHPHLFGGLMLTAALLGLSTSYFGGLGYSYLPYMWSDLGVFYKKKS  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             K+R+RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   EKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  112



>ref|XP_003630621.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=272

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESNSWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+LP      ++  KKK 
Sbjct  1    MDYESNSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGVIGVPSLPLPCSWYNLGKKKKT  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   GKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  112



>ref|XP_003525313.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Glycine max]
 ref|XP_006580492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Glycine max]
 gb|KHM99852.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVP--TLPYLLPDLSVFHkk  378
            M++E+NSWI +G  YYP +FGG+M+TAALLGLST+YFG I VP  +LP    +L +FHKK
Sbjct  1    MDYENNSWIWEGVNYYPRVFGGLMVTAALLGLSTSYFGGIGVPYLSLPCSWSNLGIFHKK  60

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  KRR+RVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   KSGKRRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  114



>ref|XP_003530503.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006584793.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
 gb|KHN16693.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVP--TLPYLLPDLSVFHkk  378
            M++E+NSWI +G  YYP +FGG+M+TAALLGLST+YFG I VP  +LP    +L +FH+K
Sbjct  1    MDYENNSWIWEGVNYYPCVFGGLMVTAALLGLSTSYFGGIGVPYLSLPCSWSNLGIFHQK  60

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  KRR+RVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   KSGKRRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  114



>ref|XP_003630619.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
 gb|AET05095.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=418

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESNSWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+LP      ++  KKK 
Sbjct  1    MDYESNSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGVIGVPSLPLPCSWYNLGKKKKT  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   GKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  112


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   L++A+ LGD L+VG+ SDE +  N+G
Sbjct  257  YIDGAFDLFHAGHVQMLKRARELGDFLLVGIHSDETVSENRG  298



>ref|XP_003630620.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=431

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESNSWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+LP      ++  KKK 
Sbjct  1    MDYESNSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGVIGVPSLPLPCSWYNLGKKKKT  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   GKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  112


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   L++A+ LGD L+VG+ SDE +  N+G
Sbjct  270  YIDGAFDLFHAGHVQMLKRARELGDFLLVGIHSDETVSENRG  311



>gb|AET05096.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=382

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESNSWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+LP      ++  KKK 
Sbjct  1    MDYESNSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGVIGVPSLPLPCSWYNLGKKKKT  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   GKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  112


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   L++A+ LGD L+VG+ SDE +  N+G
Sbjct  257  YIDGAFDLFHAGHVQMLKRARELGDFLLVGIHSDETVSENRG  298



>gb|ACJ85759.1| unknown [Medicago truncatula]
 gb|AFK45819.1| unknown [Medicago truncatula]
Length=418

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M++ESNSWI +G  YYPHLFGG+M+TAALLGLST+YFG I VP+LP      ++  KKK 
Sbjct  1    MDYESNSWIWEGVYYYPHLFGGLMVTAALLGLSTSYFGVIGVPSLPLPCSWYNLGKKKKT  60

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             KRRV VYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  61   GKRRVHVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPV  112


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   L++A+ LGD L+VG+ SDE +  N+G
Sbjct  257  YIDGAFDLFHAGHVQMLKRARELGDFLLVGIHSDETVSENRG  298



>ref|XP_007160226.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 ref|XP_007160227.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32220.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32221.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
Length=420

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVP--TLPYLLPDLSVFHkk  378
            M++E+NSWI +G  YYP +FGG+M+TAALLGLS++YFG I VP  +LP    +L +FHKK
Sbjct  1    MDYENNSWIWEGVNYYPRVFGGLMVTAALLGLSSSYFGGIGVPYLSLPCSWSNLGIFHKK  60

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            K  KRR+RVYMDGCFD+MHYGHANALRQAKALGDEL+VG+VSDEEI   KGPPV
Sbjct  61   KSGKRRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIAATKGPPV  114



>ref|XP_010913786.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=362

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHL--FGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            GS+EF++N WI +G CY P L   GGIM+T A+L LST YFG I VP  PY   DL +F 
Sbjct  7    GSVEFDTNRWIWNGACY-PQLVGLGGIMITIAILWLSTGYFGGIGVPYFPYFWLDLGIFC  65

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  66   KKKDRKRPVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  121



>ref|XP_008781724.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
 ref|XP_008781725.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=420

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHL-FGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHk  375
            GS+EF++N WI DG CY   +  GGIM+T A+L LST YFG I +P  PY   DL +F+K
Sbjct  3    GSVEFDTNRWIWDGACYSQLVGLGGIMITIAILWLSTGYFGGIGLPYFPYFWLDLGIFYK  62

Query  376  kkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KK  KR VRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  63   KKSRKRPVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  117



>ref|XP_010928770.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928771.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928772.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            GS+EFE+N WI DG CY P LFG  GIM+T A+L LST Y G I +P  P++  DL  F+
Sbjct  2    GSVEFETNRWIWDGACY-PQLFGLGGIMITIAILWLSTGYLGGIGLPYFPFVWLDLRFFY  60

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK+LGDEL+VGVVSDEEI+ NKGPPV
Sbjct  61   KKKSRKRPVRVYMDGCFDLMHYGHANALRQAKSLGDELVVGVVSDEEIVANKGPPV  116



>gb|KDP45833.1| hypothetical protein JCGZ_17440 [Jatropha curcas]
Length=425

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +1

Query  205  MEFES-NSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            ME+E+ NSWI DG  +YPH+FGG+MLTAALLGLST+YFG I   + PY+  DL   +KK+
Sbjct  1    MEYETTNSWIWDGVYHYPHVFGGLMLTAALLGLSTSYFGGIGFSSFPYICWDLGTLYKKR  60

Query  382  rakrrv--rvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              K++   RVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  61   YEKKKKRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  115



>ref|XP_010913784.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010913785.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=424

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHL--FGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            GS+EF++N WI +G CY P L   GGIM+T A+L LST YFG I VP  PY   DL +F 
Sbjct  7    GSVEFDTNRWIWNGACY-PQLVGLGGIMITIAILWLSTGYFGGIGVPYFPYFWLDLGIFC  65

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEI+ NKGPPV
Sbjct  66   KKKDRKRPVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIVANKGPPV  121



>ref|XP_010928769.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=443

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 94/119 (79%), Gaps = 3/119 (3%)
 Frame = +1

Query  190  KGWGSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLS  363
            K  GS+EFE+N WI DG CY P LFG  GIM+T A+L LST Y G I +P  P++  DL 
Sbjct  23   KTMGSVEFETNRWIWDGACY-PQLFGLGGIMITIAILWLSTGYLGGIGLPYFPFVWLDLR  81

Query  364  VFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
             F+KKK  KR VRVYMDGCFD+MHYGHANALRQAK+LGDEL+VGVVSDEEI+ NKGPPV
Sbjct  82   FFYKKKSRKRPVRVYMDGCFDLMHYGHANALRQAKSLGDELVVGVVSDEEIVANKGPPV  140



>gb|KHG07400.1| Ethanolamine-phosphate cytidylyltransferase [Gossypium arboreum]
Length=286

 Score =   139 bits (351),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI +     PHLFGG+MLTAALLG ST+YFG I    + Y   +L    KKK
Sbjct  2    AMEYESNNWIWEWMYNTPHLFGGLMLTAALLGFSTSYFGGIGNFPVSYAWSNLGFLLKKK  61

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            R KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPP+
Sbjct  62   RDKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPI  114



>ref|XP_010669056.1| PREDICTED: uncharacterized protein LOC104886293, partial [Beta 
vulgaris subsp. vulgaris]
Length=122

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = +1

Query  193  GWGSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G+ +ME+E +SWI DG CYYPH+FGGIM+T ALLGLST+YFG I    LPYL     +  
Sbjct  16   GFVAMEYEIHSWIWDGVCYYPHVFGGIMVTTALLGLSTSYFG-IGFHYLPYLGHGFGILK  74

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEI  516
            K+   K+RVRVYMDGCFD+MHY HANALRQAKALGDEL+VGVV DEEI
Sbjct  75   KQAHEKKRVRVYMDGCFDLMHYDHANALRQAKALGDELVVGVVRDEEI  122



>gb|KJB83345.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
 gb|KJB83346.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
Length=424

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  SMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkk  381
            +ME+ESN+WI +     PHLFGG+MLTAALLG ST+YFG I    + Y   +L    KKK
Sbjct  2    AMEYESNNWIWEWMYNTPHLFGGLMLTAALLGFSTSYFGGIGNFPVSYAWSNLGFLLKKK  61

Query  382  rakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            R KRRVRVYMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPP+
Sbjct  62   REKRRVRVYMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPI  114



>dbj|BAD03428.1| putative phosphoethanolamine cytidylyltransferase [Oryza sativa 
Japonica Group]
 gb|EEC83124.1| hypothetical protein OsI_28285 [Oryza sativa Indica Group]
 gb|EEE68256.1| hypothetical protein OsJ_26465 [Oryza sativa Japonica Group]
Length=428

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FESN  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L+   
Sbjct  2    GLLAFESNQGLWNSG-YYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLAQLP  60

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  61   KKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  116



>gb|EMT24851.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=418

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE+N  + +GG YY   FG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFENNQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQVP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+VNKGPPV
Sbjct  63   KKKERQRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVVNKGPPV  118


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG-PPV  540
            Y+DG FD+ H GH   LR A+ LGD L+VGV  D+ I   +G PP+
Sbjct  258  YIDGAFDLFHAGHVEILRSARQLGDFLLVGVHDDQSIREKRGYPPI  303



>ref|NP_001064493.1| Os10g0387000 [Oryza sativa Japonica Group]
 gb|ABB47464.1| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26407.1| Os10g0387000 [Oryza sativa Japonica Group]
Length=425

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FESN  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFESNQGLWNSG-YYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQLP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118



>gb|EAZ15919.1| hypothetical protein OsJ_31340 [Oryza sativa Japonica Group]
Length=423

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FESN  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  2    GLLAFESNQGLWNSG-YYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQLP  60

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  61   KKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  116



>ref|XP_006659222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=429

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FESN  +   G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  3    GLLAFESNQGLWSSG-YYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQLP  61

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  62   KKKERKRPVRVYMDGCFDLMHYGHANALRQAKVLGDQLVVGVVSDEEIVANKGPPV  117



>dbj|BAJ95410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE+N  + +GG YY   FG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFENNQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQLP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKKERQRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG-PPV  540
            Y+DG FD+ H GH   LR A+ LGD L+VGV  D+ I   +G PP+
Sbjct  258  YIDGAFDLFHAGHVEILRSARQLGDFLLVGVHDDQSIREKRGYPPI  303



>emb|CDM85025.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE+N  + +GG YY   FG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFENNQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQVP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKKERQRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG-PPV  540
            Y+DG FD+ H GH   LR A+ LGD L+VGV  D+ I   +G PP+
Sbjct  258  YIDGAFDLFHAGHVEILRSARQLGDFLLVGVHDDQSIREKRGYPPI  303



>gb|EMS51700.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=428

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE+N  + +GG YY   FG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFENNQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQVP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKKERQRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118



>gb|AAK13093.1|AC078839_9 Putative phospholipid cytidylyltransferase [Oryza sativa Japonica 
Group]
Length=742

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G   FESN  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  346  GDPAFESNQGLWNSG-YYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQLP  404

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  405  KKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  460



>ref|XP_004972546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Setaria italica]
 ref|XP_004972547.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X6 [Setaria italica]
Length=462

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FES+  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  3    GLLAFESHQGLWNSG-YYSQLFGIGGVMITIAILMLSTGYFGGIGAPFAPYFWPYLGQVP  61

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  62   KKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  117



>ref|XP_003564627.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=418

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE++  + +GG YY   FG  G+M+T A+L LST YFG    P  PY  P L    
Sbjct  4    GVLAFENDQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFGGFGAPFAPYFWPYLGQLP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKKERQRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118



>ref|XP_003573570.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010234484.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=416

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 4/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FE+N  + +GG YY   FG  G+M+T A+L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFENNQGLWNGG-YYSQFFGIGGVMVTVAILWLSTGYFG-IGAPFAPYFWPYLGQLP  61

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KKK  +R VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  62   KKKEQRRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  117



>ref|XP_004972545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Setaria italica]
Length=466

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  190  KGWGSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLS  363
            K  G + FES+  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L 
Sbjct  42   KMMGLLAFESHQGLWNSG-YYSQLFGIGGVMITIAILMLSTGYFGGIGAPFAPYFWPYLG  100

Query  364  VFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
               KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  101  QVPKKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  159



>ref|XP_004972543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Setaria italica]
Length=494

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  190  KGWGSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLS  363
            K  G + FES+  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L 
Sbjct  42   KMMGLLAFESHQGLWNSG-YYSQLFGIGGVMITIAILMLSTGYFGGIGAPFAPYFWPYLG  100

Query  364  VFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
               KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  101  QVPKKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  159



>ref|XP_004972544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Setaria italica]
Length=476

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  190  KGWGSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLS  363
            K  G + FES+  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L 
Sbjct  42   KMMGLLAFESHQGLWNSG-YYSQLFGIGGVMITIAILMLSTGYFGGIGAPFAPYFWPYLG  100

Query  364  VFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
               KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  101  QVPKKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  159



>ref|XP_004972542.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Setaria italica]
Length=504

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = +1

Query  190  KGWGSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLS  363
            K  G + FES+  + + G YY  LFG  G+M+T A+L LST YFG I  P  PY  P L 
Sbjct  42   KMMGLLAFESHQGLWNSG-YYSQLFGIGGVMITIAILMLSTGYFGGIGAPFAPYFWPYLG  100

Query  364  VFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
               KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  101  QVPKKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  159



>gb|AFW57038.1| hypothetical protein ZEAMMB73_658422 [Zea mays]
Length=425

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFG--GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFH  372
            G + FES+  + + G YY  LFG  G+++T  +L LST YFG I  P  PY  P L    
Sbjct  4    GLLAFESHQGLWNSG-YYSQLFGIGGVLITLTILMLSTGYFGGIGAPFAPYFWPYLGQVP  62

Query  373  kkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            KK+  KR VRVYMDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  63   KKRERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  118



>gb|EPS64234.1| hypothetical protein M569_10547, partial [Genlisea aurea]
Length=423

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 8/112 (7%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            ME ES SW +DG  +  HLFGGIM++ ALL   T       +P +P+LL      + KK 
Sbjct  1    MEIESCSWHKDGLYFLSHLFGGIMISCALLRFFTKN-----LPKMPHLLRG---SNSKKP  52

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            AK++VRVY+DGCFD+MHYGHANALRQAKALGDEL+VGV SDEEII+ KGPPV
Sbjct  53   AKKKVRVYIDGCFDLMHYGHANALRQAKALGDELVVGVASDEEIILYKGPPV  104



>emb|CCW28789.1| putative cytidylyltransferase [Arachis duranensis]
Length=400

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 72/91 (79%), Gaps = 5/91 (5%)
 Frame = +1

Query  268  GIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHYGHA  447
            G  + AALLGLST+YFG      +     +L +F KK+  KRRVRVYMDGCFD+MHYGHA
Sbjct  9    GCFVAAALLGLSTSYFG-----GMTNSWSNLGIFPKKRSGKRRVRVYMDGCFDLMHYGHA  63

Query  448  NALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            NALRQAKALGDEL+VG+VSDEEI+ NKGPPV
Sbjct  64   NALRQAKALGDELVVGLVSDEEILANKGPPV  94



>ref|XP_002990148.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
 gb|EFJ08708.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
Length=416

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L  G++L AA+LGLS+++ G I     P  +P   +F  KK+  RRVRVYMDGCFD+MHY
Sbjct  13   LVAGLILAAAVLGLSSHFLGFI-----PVAIPAFGIFLPKKKENRRVRVYMDGCFDLMHY  67

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GHANALRQA+ALGDEL+VGVVSD EI  NKGPPV
Sbjct  68   GHANALRQARALGDELVVGVVSDGEIESNKGPPV  101



>ref|XP_002992541.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
 gb|EFJ06479.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
Length=420

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L  G++L AA+LGLS+++ G I     P  +P   +F  KK+  RRVRVYMDGCFD+MHY
Sbjct  17   LVAGLILAAAVLGLSSHFLGFI-----PVAIPAFGIFLPKKKENRRVRVYMDGCFDLMHY  71

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GHANALRQA+ALGDEL+VGVVSD EI  NKGPPV
Sbjct  72   GHANALRQARALGDELVVGVVSDGEIESNKGPPV  105



>gb|ABX10446.1| ethanolamine-phosphate cytidylyltransferase 2 [Gossypium hirsutum]
Length=413

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  295  GLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKAL  474
            G ST+YFG I    + Y   +L    KKKR KRRVRVYMDGCFD+MHYGHANALRQAKAL
Sbjct  22   GFSTSYFGGIGNFPVSYAWSNLGFLLKKKREKRRVRVYMDGCFDLMHYGHANALRQAKAL  81

Query  475  GDELIVGVVSDEEIIVNKGPPV  540
            GDEL+VGVVSDEEII NKGPP+
Sbjct  82   GDELVVGVVSDEEIIANKGPPI  103



>ref|XP_004978492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GGI+L A++L L  +  G   +P+LP L  D      ++R +R VRVYMDGCFDMMHY
Sbjct  18   VIGGIVLGASVLAL--HLAGPAAIPSLPPL--DALRRRLRRRRRRPVRVYMDGCFDMMHY  73

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGDELIVGV+SD+EI  NKGPPV
Sbjct  74   GHCNALRQARALGDELIVGVISDDEIKANKGPPV  107



>ref|XP_002526236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36133.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  23   YMDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  67



>gb|EEC67567.1| hypothetical protein OsI_34911 [Oryza sativa Indica Group]
Length=424

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GGI+L A+++ L  +  G + +P LP +  D      ++  +R VRVYMDGCFDMMHY
Sbjct  17   VIGGIVLGASVVAL--HLAGPVAIPALPPV--DALRRRFRRGRRRPVRVYMDGCFDMMHY  72

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGDELIVGVVSD+EI  NKGPPV
Sbjct  73   GHCNALRQARALGDELIVGVVSDDEITANKGPPV  106



>dbj|BAJ86064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +1

Query  262  FGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHYG  441
             GGI+L AA++ L  +  G + VP LP   P  ++  + +R  R VRVYMDGCFDMMHYG
Sbjct  16   IGGIVLGAAVVAL--HVAGPVAVPGLP---PLDALRRRFRRRHRPVRVYMDGCFDMMHYG  70

Query  442  HANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            H NALRQA+ALGD+LIVGVVSD+EI  NKGPPV
Sbjct  71   HCNALRQARALGDQLIVGVVSDDEITANKGPPV  103



>gb|ABA91254.1| phosphoethanolamine cytidylyltransferase, putative, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GGI+L A+++ L  +  G + +P LP +  D      ++  +R VRVYMDGCFDMMHY
Sbjct  17   VIGGIVLGASVVAL--HLAGPVAIPALPPV--DALRRRFRRGRRRPVRVYMDGCFDMMHY  72

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGDELIVGVVSD EI  NKGPPV
Sbjct  73   GHCNALRQARALGDELIVGVVSDHEITANKGPPV  106



>gb|AAO43227.1| phosphoethanolamine cytidylyltransferase [Hordeum vulgare subsp. 
vulgare]
Length=421

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 9/112 (8%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+  SN+      C    + GGI+L A+++ L   + G    P  P L P  ++  + +R
Sbjct  1    MDSASNNARTVAAC----VIGGIVLGASVVAL---HLG--AGPAAPSLPPVEALRRRFRR  51

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              R VRVYMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  52   RCRPVRVYMDGCFDMMHYGHCNALRQARALGDELVVGVVSDDEITANKGPPV  103



>ref|XP_006842638.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
 gb|ERN04313.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
Length=423

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 11/94 (12%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
              GG +L+A+LLG    YFG    P+  ++         K++ K  +RVYMDGCFDMMHY
Sbjct  20   FIGGCLLSASLLGF---YFG---FPSASHVFS-----FGKRKKKGPIRVYMDGCFDMMHY  68

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  69   GHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  102



>ref|XP_006664291.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=423

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 68/94 (72%), Gaps = 8/94 (9%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GGI+L A++L L       + +PTLP +  D      ++R +R VRVYMDGCFDMMHY
Sbjct  20   VIGGIVLGASVLAL------HLSIPTLPPV--DDLRRRLRRRRRRPVRVYMDGCFDMMHY  71

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA ALGDELIVGVVSD+EI  NKGPPV
Sbjct  72   GHCNALRQAHALGDELIVGVVSDDEITANKGPPV  105



>ref|XP_004160346.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=351

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 13/94 (14%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG+++  ++LGL   +FG  + P+L             +R K+ VRVYMDGCFDMMHY
Sbjct  33   LIGGLVIGISVLGL---HFGAPHQPSL----------RIWRRKKKPVRVYMDGCFDMMHY  79

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  80   GHCNALRQARALGDQLVVGVVSDSEIIANKGPPV  113



>gb|ABX10445.1| ethanolamine-phosphate cytidylyltransferase 1 [Gossypium hirsutum]
Length=384

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFD+MHYGHANALRQAK LGDEL+VGVVSDEEII NKGPPV
Sbjct  30   YMDGCFDLMHYGHANALRQAKTLGDELVVGVVSDEEIIANKGPPV  74



>ref|XP_010931423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 11/94 (12%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GG++L AA+L +     GR      P +LP L +   + R K+ VRVYMDGCFDMMHY
Sbjct  21   VLGGLVLGAAVLAVQ---LGR-----APPVLPPLGI---RWRKKKPVRVYMDGCFDMMHY  69

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  70   GHCNALRQARALGDELVVGVVSDDEITANKGPPV  103



>dbj|BAK04174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 9/112 (8%)
 Frame = +1

Query  205  MEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkr  384
            M+  S+S      C    + GGI+L A+++ L   + G    P  P L P  ++  + +R
Sbjct  1    MDSASSSARTVAAC----VIGGIVLGASVVAL---HLG--AGPAAPSLPPVEALRRRFRR  51

Query  385  akrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
              R VRVYMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  52   RCRPVRVYMDGCFDMMHYGHCNALRQARALGDELVVGVVSDDEITANKGPPV  103



>emb|CBI40665.3| unnamed protein product [Vitis vinifera]
Length=362

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFD+MHYGHANALRQAKALGDEL+VGVVSDEEII NKGPPV
Sbjct  1    MDGCFDLMHYGHANALRQAKALGDELVVGVVSDEEIIANKGPPV  44



>ref|XP_004977412.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            +  GI+L A+++ L  +  G   +P+LP L  D      ++R +R VRVYMDGCFDMMHY
Sbjct  18   VIRGIVLGASVIAL--HLVGPAAIPSLPPL--DAVRRRLRRRRRRPVRVYMDGCFDMMHY  73

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGDELIVGV+SD+EI  NKGPPV
Sbjct  74   GHCNALRQARALGDELIVGVISDDEIKANKGPPV  107



>ref|NP_001066024.1| Os12g0121300 [Oryza sativa Japonica Group]
 gb|ABA95682.2| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29043.1| Os12g0121300 [Oryza sativa Japonica Group]
 dbj|BAG94236.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52664.1| hypothetical protein OsJ_35038 [Oryza sativa Japonica Group]
Length=424

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GGI+L A+++ L  +  G + +P LP +  D      ++  +R VRVYMDGCFDMMHY
Sbjct  17   VIGGIVLGASVVAL--HLAGPVAIPALPPV--DALRRRFRRGRRRPVRVYMDGCFDMMHY  72

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA ALGDELIVGVVSD+EI  NKGPPV
Sbjct  73   GHCNALRQAHALGDELIVGVVSDDEITANKGPPV  106



>ref|XP_004137664.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN58672.1| hypothetical protein Csa_3G727900 [Cucumis sativus]
Length=431

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 13/94 (14%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG+++  ++LGL   +FG  + P+L             +R K+ VRVYMDGCFDMMHY
Sbjct  33   LIGGLVIGISVLGL---HFGAPHQPSL----------RIWRRKKKPVRVYMDGCFDMMHY  79

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  80   GHCNALRQARALGDQLVVGVVSDSEIIANKGPPV  113



>gb|KHN40576.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=181

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  52   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  96



>ref|XP_010529960.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Tarenaya hassleriana]
Length=397

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  60   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  104



>gb|ABN08306.1| Cytidylyltransferase [Medicago truncatula]
Length=246

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  99



>ref|XP_006293474.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
 gb|EOA26372.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
Length=420

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  102



>ref|NP_181401.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
 sp|Q9ZVI9.1|PECT1_ARATH RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine cytidylyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAC67351.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM12983.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM91207.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AEC09568.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
Length=421

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  102



>ref|XP_002879759.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56018.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  102



>emb|CDY18374.1| BnaA04g22130D [Brassica napus]
 emb|CDX93310.1| BnaC04g45860D [Brassica napus]
Length=409

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  100



>ref|XP_010509160.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Camelina 
sativa]
Length=420

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  102



>ref|XP_010517175.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=420

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  102



>ref|XP_008442303.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Cucumis melo]
Length=430

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 24/125 (19%)
 Frame = +1

Query  187  RKGWGSMEFESN------SWIR-DGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPY  345
            R G GS++ +++       W R    C    L GG+++  ++LGL   +FG  + P+L  
Sbjct  5    RTGTGSVDLDADPSENTQRWARFVATC----LIGGLVIGISVLGL---HFGAPHQPSL--  55

Query  346  LLPDLSVFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVN  525
                       +R K+ VRVYMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  N
Sbjct  56   --------RIWRRKKKPVRVYMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDSEITAN  107

Query  526  KGPPV  540
            KGPPV
Sbjct  108  KGPPV  112



>emb|CDX91484.1| BnaC04g06660D [Brassica napus]
Length=411

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  57   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  101



>ref|XP_009141755.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=417

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  100



>ref|XP_010529959.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=422

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  60   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  104



>ref|XP_009133281.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=418

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  100



>ref|XP_007140015.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
 gb|ESW12009.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
Length=421

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 14/94 (15%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            + GG+++  +LLG  ++  G  +        P              VRVYMDGCFDMMHY
Sbjct  21   MVGGVIVGVSLLGAYSSQLGMFWKTRKRNKKP--------------VRVYMDGCFDMMHY  66

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  67   GHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  100



>gb|KFK36771.1| hypothetical protein AALP_AA4G168400 [Arabis alpina]
Length=419

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  100


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   LRQA+ LGD L+VG+ +D+ +   +G
Sbjct  256  YIDGAFDLFHAGHVEILRQARELGDFLLVGIHNDQTVSAKRG  297



>ref|XP_001759318.1| predicted protein [Physcomitrella patens]
 gb|EDQ76002.1| predicted protein [Physcomitrella patens]
Length=422

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGHANALRQA+ALGDEL+VGV+SDEEI  NKGPPV
Sbjct  58   YMDGCFDMMHYGHANALRQARALGDELVVGVMSDEEIKANKGPPV  102


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGP  534
            YMDG FD+ H GH   L+ A+A+GD L+VG+ SD+ +  ++GP
Sbjct  256  YMDGAFDLFHVGHVETLKAARAMGDFLLVGIHSDQIVSAHRGP  298



>ref|XP_006411085.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
 gb|ESQ52538.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
Length=423

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  60   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  104



>emb|CDY07710.1| BnaA03g18010D [Brassica napus]
Length=439

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  100



>ref|XP_003623696.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=355

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  99



>gb|AES79914.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=358

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  102



>emb|CDY14442.1| BnaC03g21530D [Brassica napus]
Length=426

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  52   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  96



>ref|XP_008364008.1| PREDICTED: LOW QUALITY PROTEIN: ethanolamine-phosphate cytidylyltransferase-like 
[Malus domestica]
Length=329

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110



>ref|XP_008442302.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Cucumis melo]
Length=493

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 24/125 (19%)
 Frame = +1

Query  187  RKGWGSMEFESN------SWIR-DGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPY  345
            R G GS++ +++       W R    C    L GG+++  ++LGL   +FG  + P+L  
Sbjct  5    RTGTGSVDLDADPSENTQRWARFVATC----LIGGLVIGISVLGL---HFGAPHQPSL--  55

Query  346  LLPDLSVFHkkkrakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVN  525
                       +R K+ VRVYMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  N
Sbjct  56   --------RIWRRKKKPVRVYMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDSEITAN  107

Query  526  KGPPV  540
            KGPPV
Sbjct  108  KGPPV  112



>ref|XP_008370315.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110



>ref|XP_003623695.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=419

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  99



>gb|AFK43034.1| unknown [Medicago truncatula]
Length=422

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  102



>gb|AES79913.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=422

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD+EII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDDEIIANKGPPV  102



>ref|XP_010553187.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Tarenaya 
hassleriana]
Length=421

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGV+SDEEII NKGPPV
Sbjct  59   YMDGCFDMMHYGHCNALRQARALGDQLVVGVISDEEIIANKGPPV  103



>ref|XP_008358193.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   LR+A+ LGD L+VG+ +D+ +  N+G
Sbjct  265  YIDGAFDLFHAGHVEILRKARELGDFLLVGIHTDQTVSANRG  306



>ref|XP_009337844.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   LR+A+ LGD L+VG+ +D+ +  N+G
Sbjct  265  YIDGAFDLFHAGHVEILRKARELGDFLLVGIHTDQTVSANRG  306



>ref|XP_009370855.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   LR+A+ LGD L+VG+ +D+ +  N+G
Sbjct  265  YIDGAFDLFHAGHVEILRKARELGDFLLVGIHTDQTVSANRG  306



>ref|XP_007207330.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
 gb|EMJ08529.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
Length=428

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110



>ref|XP_004302493.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Fragaria 
vesca subsp. vesca]
Length=428

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EIIVNKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIVNKGPPV  110



>ref|XP_001780359.1| predicted protein [Physcomitrella patens]
 gb|EDQ54813.1| predicted protein [Physcomitrella patens]
Length=393

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGHANALRQA+ LGDEL+VGV+SDEEI  NKGPPV
Sbjct  34   YMDGCFDMMHYGHANALRQARVLGDELVVGVISDEEIKANKGPPV  78


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            YMDG FD+ H GH   L+ A+A+GD L+VG+ SD+ +  N+G
Sbjct  232  YMDGAFDLFHAGHVETLKAARAMGDFLLVGIHSDQIVSANRG  273



>ref|XP_006850949.1| hypothetical protein AMTR_s00025p00194560 [Amborella trichopoda]
 gb|ERN12530.1| hypothetical protein AMTR_s00025p00194560 [Amborella trichopoda]
Length=232

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFD+MHYGHANALRQA+ALGDEL+VG+VSDEEII NKGPPV
Sbjct  1    MDGCFDLMHYGHANALRQARALGDELVVGMVSDEEIIKNKGPPV  44



>ref|XP_006587893.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
Length=393

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  49   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  93



>ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
 gb|EEF42304.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
Length=418

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD EII NKGPPV
Sbjct  58   YMDGCFDMMHYGHCNALRQARALGDELVVGVVSDAEIIANKGPPV  102



>ref|XP_009801689.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
sylvestris]
Length=413

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 60/94 (64%), Gaps = 20/94 (21%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG++L  ++LGL      R  +P      P              +RVYMDGCFDMMHY
Sbjct  22   LVGGVVLGLSVLGL------RFALPKKKKKRP--------------IRVYMDGCFDMMHY  61

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  62   GHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  95



>ref|XP_002323699.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
 gb|EEF05460.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
Length=427

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EII NKGPPV
Sbjct  65   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEIIANKGPPV  109



>gb|KDO64220.1| hypothetical protein CISIN_1g021802mg [Citrus sinensis]
Length=307

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  99



>ref|XP_009606107.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
tomentosiformis]
Length=413

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 60/94 (64%), Gaps = 20/94 (21%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG++L  ++LGL      R  +P      P              +RVYMDGCFDMMHY
Sbjct  22   LVGGVVLGLSVLGL------RFALPKKKKKRP--------------IRVYMDGCFDMMHY  61

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  62   GHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  95



>ref|XP_010505515.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=362

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALRQA+ALGD+L+VGVVSDEEII NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALRQARALGDQLVVGVVSDEEIIANKGPPV  44



>gb|KDP21814.1| hypothetical protein JCGZ_00601 [Jatropha curcas]
Length=417

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD EII NKGPPV
Sbjct  53   YMDGCFDMMHYGHCNALRQARALGDELVVGVVSDAEIIANKGPPV  97



>gb|KDO64219.1| hypothetical protein CISIN_1g021802mg [Citrus sinensis]
Length=296

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  99



>ref|XP_003533643.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
Length=415

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  49   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  93



>ref|XP_009143367.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Brassica 
rapa]
Length=420

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ LGD+L+VGVVSDEEII NKGPPV
Sbjct  57   YMDGCFDMMHYGHCNALRQARVLGDQLVVGVVSDEEIIANKGPPV  101



>gb|EYU26697.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26698.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26699.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
Length=409

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 18/94 (19%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG+++  +LLGL              Y LP+ +     K+ KR +RVYMDGCFDMMHY
Sbjct  16   LIGGLVIGMSLLGLR-------------YALPEHN-----KKKKRPIRVYMDGCFDMMHY  57

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+ALGD+L+VGVVSD EI VNKGPPV
Sbjct  58   GHCNALRQARALGDQLVVGVVSDAEITVNKGPPV  91



>gb|KHN29458.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=414

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  49   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  93



>emb|CDX74894.1| BnaA05g06400D [Brassica napus]
Length=430

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ LGD+L+VGVVSDEEII NKGPPV
Sbjct  57   YMDGCFDMMHYGHCNALRQARVLGDQLVVGVVSDEEIIANKGPPV  101



>emb|CDX84098.1| BnaC08g07750D [Brassica napus]
Length=322

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALR+A+ALGDEL+VGVVSDEEII NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALREARALGDELVVGVVSDEEIIANKGPPV  44



>ref|XP_004492610.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=418

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  100



>ref|XP_003552337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
1 [Glycine max]
Length=420

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+LIVGVVSD EII NKGPPV
Sbjct  54   YMDGCFDMMHYGHCNALRQARALGDQLIVGVVSDAEIIANKGPPV  98



>ref|XP_010922838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 71/114 (62%), Gaps = 16/114 (14%)
 Frame = +1

Query  199  GSMEFESNSWIRDGGCYYPHLFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkk  378
            GSME  + S      C    + GG++L AA+L              L  + P L     +
Sbjct  6    GSMEILATSRFA-AAC----VLGGLVLGAAVLA-----------GKLSQVAPVLPPLGIR  49

Query  379  krakrrvrvYMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            +R K+ VRVYMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  50   RRKKKPVRVYMDGCFDMMHYGHCNALRQAQALGDELVVGVVSDDEITANKGPPV  103



>ref|XP_008804653.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=414

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  52   YMDGCFDMMHYGHCNALRQARALGDELVVGVVSDDEITANKGPPV  96



>ref|XP_010036048.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Eucalyptus grandis]
Length=425

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI+VNKGPPV
Sbjct  63   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIVVNKGPPV  107



>ref|XP_010036047.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Eucalyptus grandis]
 gb|KCW47570.1| hypothetical protein EUGRSUZ_K01317 [Eucalyptus grandis]
Length=425

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI+VNKGPPV
Sbjct  63   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIVVNKGPPV  107



>gb|EEC66861.1| hypothetical protein OsI_33354 [Oryza sativa Indica Group]
Length=351

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFD+MHYGHANALRQAK LGD+L+VGVVSDEEI+ NKGPPV
Sbjct  1    MDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPV  44



>ref|XP_003577861.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=425

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGVVSD+EI  NKGPPV
Sbjct  63   YMDGCFDMMHYGHCNALRQARALGDELVVGVVSDDEITANKGPPV  107



>ref|XP_006362326.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=414

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  52   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  96



>ref|XP_004249014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=413

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  51   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  95



>gb|KJB27590.1| hypothetical protein B456_005G001400 [Gossypium raimondii]
Length=418

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +1

Query  259  LFGGIMLTAALLGLSTNYFGRIYVPTLPYLLPDLSVFHkkkrakrrvrvYMDGCFDMMHY  438
            L GG ++ A  +GL   Y G +    LP     + ++ K KR K+ +RVYMDGCFDMMHY
Sbjct  9    LIGGAVVVAMAVGL---YLG-VAKRGLPPEGLGMGLWRKIKRKKKPLRVYMDGCFDMMHY  64

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GH NALRQA+A+GD+L+VGVVSD EII NKGPPV
Sbjct  65   GHCNALRQARAVGDQLVVGVVSDAEIIANKGPPV  98



>ref|XP_008244222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Prunus 
mume]
Length=428

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  110



>ref|XP_006429675.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
 ref|XP_006481274.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Citrus 
sinensis]
 gb|ESR42915.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
Length=416

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  99



>ref|XP_011101976.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Sesamum 
indicum]
Length=427

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI VNKGPPV
Sbjct  65   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITVNKGPPV  109



>ref|XP_011018911.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Populus 
euphratica]
Length=428

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  66   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  110



>ref|XP_006381291.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
 gb|ERP59088.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
Length=423

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  62   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  106



>ref|XP_002450173.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
 gb|EES09161.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
Length=423

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGV+SD+EI  NKGPPV
Sbjct  62   YMDGCFDMMHYGHCNALRQARALGDELVVGVISDDEIKANKGPPV  106



>ref|XP_010684667.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  60   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDKEITANKGPPV  104



>ref|XP_009381352.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=419

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  57   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEITANKGPPV  101



>ref|XP_003579008.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=427

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  64   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEITANKGPPV  108



>ref|XP_008679350.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Zea 
mays]
 gb|AFW64659.1| hypothetical protein ZEAMMB73_095669 [Zea mays]
Length=422

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGV+SD+EI  NKGPPV
Sbjct  61   YMDGCFDMMHYGHCNALRQARALGDELVVGVISDDEIKANKGPPV  105



>ref|XP_009410481.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  59   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEITANKGPPV  103



>ref|XP_010278899.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nelumbo 
nucifera]
Length=418

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EII NKGPPV
Sbjct  56   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEIIANKGPPV  100



>ref|XP_008788034.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=417

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  55   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDDEITANKGPPV  99



>ref|NP_001170703.1| hypothetical protein [Zea mays]
 gb|ACR34556.1| unknown [Zea mays]
 tpg|DAA39300.1| TPA: hypothetical protein ZEAMMB73_839605 [Zea mays]
Length=424

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGDEL+VGV+SD+EI  NKGPPV
Sbjct  63   YMDGCFDMMHYGHCNALRQARALGDELVVGVISDDEIKANKGPPV  107



>gb|EPS71148.1| hypothetical protein M569_03610, partial [Genlisea aurea]
Length=373

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI +NKGPPV
Sbjct  10   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITLNKGPPV  54


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            Y+DG FD+ H GH   LR A+ LGD L+VG+ +D+ + +N+G
Sbjct  209  YIDGAFDLFHAGHVEILRLARGLGDFLLVGIHTDQTVSINRG  250



>ref|XP_009384337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD+EI  NKGPPV
Sbjct  59   YMDGCFDMMHYGHCNALRQAQALGDQLVVGVVSDDEITANKGPPV  103


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGP  534
            Y+DG FD+ H GH   LR A+ LGD L+VG+ +D+ I   +GP
Sbjct  258  YIDGAFDLFHAGHVEVLRLARELGDFLLVGIHTDQTISATQGP  300



>gb|EEE51553.1| hypothetical protein OsJ_32765 [Oryza sativa Japonica Group]
Length=362

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALRQA+ALGDELIVGVVSD EI  NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALRQARALGDELIVGVVSDHEITANKGPPV  44



>ref|XP_002265169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 emb|CAQ58612.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=421

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  NKGPPV
Sbjct  59   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITANKGPPV  103



>emb|CAQ58636.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=424

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  NKGPPV
Sbjct  59   YMDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITANKGPPV  103



>gb|EEC68755.1| hypothetical protein OsI_37278 [Oryza sativa Indica Group]
Length=412

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALRQA ALGDELIVGVVSD+EI  NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALRQAHALGDELIVGVVSDDEITANKGPPV  44



>emb|CDP06353.1| unnamed protein product [Coffea canephora]
Length=362

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITANKGPPV  44



>emb|CBI31131.3| unnamed protein product [Vitis vinifera]
Length=362

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFDMMHYGH NALRQA+ALGD+L+VGVVSD EI  NKGPPV
Sbjct  1    MDGCFDMMHYGHCNALRQARALGDQLVVGVVSDAEITANKGPPV  44



>ref|XP_011006224.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Populus euphratica]
Length=393

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH +ALRQA+ALGD+L+VGVVS +EII NKGPPV
Sbjct  65   YMDGCFDMMHYGHCHALRQARALGDQLVVGVVSVDEIIANKGPPV  109



>ref|XP_011006223.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Populus euphratica]
Length=426

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFDMMHYGH +ALRQA+ALGD+L+VGVVS +EII NKGPPV
Sbjct  65   YMDGCFDMMHYGHCHALRQARALGDQLVVGVVSVDEIIANKGPPV  109



>ref|XP_005538734.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82698.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=442

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFD+MHYGHANA+RQA +LGDELIVGV SDEEI  +KGPPV
Sbjct  63   YLDGCFDLMHYGHANAIRQAASLGDELIVGVCSDEEITKHKGPPV  107



>ref|XP_002950808.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
 gb|EFJ48123.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
Length=402

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFDMMHYGHANALRQAKA+GDEL+VG+++D EI+  KGPPV
Sbjct  34   YLDGCFDMMHYGHANALRQAKAVGDELVVGLINDAEILRCKGPPV  78


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGP  534
            Y+DG FD  H GH   L+ AKA GD L+VG+ +DEE+   +GP
Sbjct  238  YIDGAFDCFHPGHVKILKAAKAEGDFLLVGLHTDEEVQARRGP  280



>ref|XP_001692963.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
 gb|AAO60076.1| CTP:ethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|AAP21826.1| CTP-phosphoethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|EDP03532.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
Length=443

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFDMMHYGHANALRQAKA+GDEL+VG+++D EI+  KGPPV
Sbjct  75   YLDGCFDMMHYGHANALRQAKAVGDELVVGLINDAEIMRCKGPPV  119



>ref|XP_004991058.1| phosphoethanolamine cytidylyltransferase [Salpingoeca rosetta]
 gb|EGD76686.1| phosphoethanolamine cytidylyltransferase [Salpingoeca rosetta]
Length=377

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGCFDMMH+GHANALRQAKA+GD LIVGV SDEEI  NKGPPV
Sbjct  17   WCDGCFDMMHFGHANALRQAKAMGDYLIVGVHSDEEIRKNKGPPV  61



>ref|XP_005647873.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23329.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=461

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 65/94 (69%), Gaps = 8/94 (9%)
 Frame = +1

Query  283  AALLGLSTNYFGRI------YVP-TLPYLLPDLSVFHkkkrakrr-vrvYMDGCFDMMHY  438
            AA+  LS N   R+      Y P T+   + +L   H K+R + + +RVY+DGCFD+MHY
Sbjct  38   AAVWWLSENTINRLAPREYQYRPGTVSEYISELFAKHAKRRRRTKPLRVYLDGCFDVMHY  97

Query  439  GHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            GHANALRQA+ LGD+L+VG++SD+EI   KGPPV
Sbjct  98   GHANALRQARMLGDQLVVGLISDDEIRAAKGPPV  131



>emb|CDS08409.1| hypothetical protein LRAMOSA09772 [Absidia idahoensis var. thermophila]
Length=377

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAKA+GD L+VGV SD EI+ NKGP V
Sbjct  16   WVDGCFDMMHYGHANALRQAKAMGDVLVVGVHSDAEILKNKGPTV  60



>ref|XP_003283291.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
 gb|EGC40222.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
Length=361

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFD+MH+GHANALRQA+ LGD L+VGV +DEEI  NKGPPV
Sbjct  13   YVDGCFDLMHFGHANALRQARELGDILVVGVHTDEEITKNKGPPV  57


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            YMDG FD+ H GH  AL+QAKALGD LIVGV  D+ +   KG
Sbjct  204  YMDGGFDLFHVGHTEALKQAKALGDFLIVGVHDDKTVNQQKG  245



>ref|XP_001744354.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91057.1| predicted protein [Monosiga brevicollis MX1]
Length=359

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y DGCFD+MH+GHANALRQAKALGD L+VG+ +DE+I  NKGPPV
Sbjct  17   YADGCFDLMHFGHANALRQAKALGDILVVGIHNDEDIEKNKGPPV  61



>emb|CDH58541.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=377

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAKA+GD L+VGV SD EI  NKGP V
Sbjct  15   WVDGCFDMMHYGHANALRQAKAMGDYLVVGVHSDAEITKNKGPTV  59



>emb|CDH52899.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=395

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAKA+GD L+VGV SD EI+ NKGP V
Sbjct  34   WVDGCFDMMHYGHANALRQAKAMGDILVVGVHSDAEILKNKGPTV  78



>ref|XP_646687.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
 sp|Q55BZ4.1|PCY2_DICDI RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine transferase [Dictyostelium 
discoideum]
 gb|EAL72499.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
Length=360

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFD+MH+GHANALRQA+ LGD L+VGV +DEEI  NKGPPV
Sbjct  13   YVDGCFDLMHFGHANALRQARELGDILVVGVHTDEEIAKNKGPPV  57


 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            YMDG FD+ H GH  AL+QA+ALGD LIVGV  D  +   KG
Sbjct  203  YMDGGFDLFHVGHTEALKQARALGDYLIVGVHDDRVVHEQKG  244



>emb|CDH58540.1| ethanolamine-phosphate cytidylyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=378

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAKA+GD L+VGV SD EI  NKGP V
Sbjct  16   WVDGCFDMMHYGHANALRQAKAMGDYLVVGVHSDAEITKNKGPTV  60



>gb|AAW24841.1| SJCHGC06128 protein [Schistosoma japonicum]
Length=412

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFD++H+GHANALRQAK+LGD+LIVG+ SD+EI  +KGPPV
Sbjct  15   WVDGCFDLVHFGHANALRQAKSLGDQLIVGIHSDKEITKHKGPPV  59



>ref|XP_001988302.1| GH11091 [Drosophila grimshawi]
 gb|EDW03169.1| GH11091 [Drosophila grimshawi]
Length=385

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  NKGPPV
Sbjct  28   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKNKGPPV  72



>gb|KDD76579.1| hypothetical protein H632_c175p1 [Helicosporidium sp. ATCC 50920]
Length=468

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFD+MHYGHANALRQA+ LGDEL+VG++ D EI   KGPP+
Sbjct  17   YMDGCFDLMHYGHANALRQARVLGDELVVGLIPDSEIERCKGPPI  61



>ref|XP_003081234.1| CTP:ethanolamine cytidylyltransferase (ISS) [Ostreococcus tauri]
Length=361

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFD MHYGHANALRQA+A GD L+VGVV+D EI   KGPPV
Sbjct  68   YMDGCFDTMHYGHANALRQARACGDVLLVGVVNDAEIRRCKGPPV  112



>dbj|GAM28819.1| hypothetical protein SAMD00019534_119950, partial [Acytostelium 
subglobosum LB1]
Length=361

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFD+MH+GHANALRQAK LGD L+VGV +D EI  NKGPPV
Sbjct  19   YVDGCFDLMHFGHANALRQAKELGDILVVGVHTDAEIARNKGPPV  63


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNK  528
            YMDG FD+ H GH  ALRQAK  GD LIVGV  D  ++VN+
Sbjct  207  YMDGGFDVFHVGHCEALRQAKEQGDFLIVGVHDD--LVVNE  245



>emb|CEF99073.1| Rossmann-like alpha/beta/alpha sandwich fold [Ostreococcus tauri]
Length=404

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            YMDGCFD MHYGHANALRQA+A GD L+VGVV+D EI   KGPPV
Sbjct  68   YMDGCFDTMHYGHANALRQARACGDVLLVGVVNDAEIRRCKGPPV  112



>emb|CDS11051.1| Putative Ethanolamine-phosphatecytidylyltransferase [Absidia 
idahoensis var. thermophila]
Length=379

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  15   WVDGCFDMMHYGHANALRQAKEMGDYLVVGVHSDAEIAKNKGPTV  59



>ref|XP_001419566.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97859.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=337

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  409  MDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            MDGCFD MHYGHANALRQA+A GD+L+VGVV+D EI   KGPPV
Sbjct  1    MDGCFDTMHYGHANALRQARACGDKLLVGVVNDAEIRRCKGPPV  44



>ref|XP_004353870.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
 gb|EGG14461.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
Length=363

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            Y+DGCFD+MH+GHANALRQA+ LGD L+VGV +D EI  NKGPPV
Sbjct  19   YVDGCFDLMHFGHANALRQARELGDILVVGVHTDAEIAKNKGPPV  63


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKG  531
            YMDG FD+ H GH  ALRQAK LGD LIVGV  D+ +   KG
Sbjct  209  YMDGGFDLFHVGHTEALRQAKELGDFLIVGVHDDKVVNEQKG  250



>ref|XP_003742761.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
4 [Metaseiulus occidentalis]
Length=363

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN LRQAKA+GD LIVGV +DEEII +KGPPV
Sbjct  15   WCDGCYDMVHFGHANQLRQAKAMGDYLIVGVHTDEEIIAHKGPPV  59



>ref|XP_002611477.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
 gb|EEN67487.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
Length=382

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDM+H+GHANALRQAK +GD LIVGV SDEEI  +KGPPV
Sbjct  20   WVDGCFDMVHFGHANALRQAKKMGDYLIVGVHSDEEISKHKGPPV  64



>ref|XP_003742758.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
1 [Metaseiulus occidentalis]
Length=369

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN LRQAKA+GD LIVGV +DEEII +KGPPV
Sbjct  15   WCDGCYDMVHFGHANQLRQAKAMGDYLIVGVHTDEEIIAHKGPPV  59



>ref|XP_009027596.1| hypothetical protein HELRODRAFT_107813 [Helobdella robusta]
 gb|ESN94545.1| hypothetical protein HELRODRAFT_107813 [Helobdella robusta]
Length=390

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDM+H+GHANALRQAK +GD L+VG+ SDEEI  +KGPPV
Sbjct  22   WVDGCFDMVHFGHANALRQAKQMGDVLVVGIHSDEEITKHKGPPV  66



>ref|XP_003742759.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
2 [Metaseiulus occidentalis]
Length=378

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN LRQAKA+GD LIVGV +DEEII +KGPPV
Sbjct  15   WCDGCYDMVHFGHANQLRQAKAMGDYLIVGVHTDEEIIAHKGPPV  59



>ref|XP_006675067.1| hypothetical protein BATDEDRAFT_9006 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84070.1| hypothetical protein BATDEDRAFT_9006 [Batrachochytrium dendrobatidis 
JAM81]
Length=336

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFD MHYGHANALRQAK +GD LIVGV SDEEI  NKGP V
Sbjct  9    WVDGCFDGMHYGHANALRQAKMMGDHLIVGVHSDEEIERNKGPTV  53



>ref|XP_829470.1| ethanolamine-phosphate cytidylyltransferase [Trypanosoma brucei 
brucei TREU927]
 gb|EAN80358.1| ethanolamine-phosphate cytidylyltransferase, putative [Trypanosoma 
brucei brucei TREU927]
 emb|CAX32459.1| CTP-phosphoethanolamine cytidyltransferase [Trypanosoma brucei 
brucei]
 emb|CBH18461.1| ethanolamine-phosphate cytidylyltransferase,putative [Trypanosoma 
brucei gambiense DAL972]
Length=384

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPP  537
            ++DGCFDM+H+GHANALRQA+++GDEL VG  +DEEII +KGPP
Sbjct  38   WVDGCFDMLHFGHANALRQARSMGDELFVGCHTDEEIIRHKGPP  81



>ref|XP_001623420.1| predicted protein [Nematostella vectensis]
 gb|EDO31320.1| predicted protein [Nematostella vectensis]
Length=373

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGCFDM+H+GHANALRQAKA+GD L VGV SD EI  NKGPPV
Sbjct  16   WTDGCFDMVHFGHANALRQAKAMGDWLCVGVHSDAEIAHNKGPPV  60



>ref|XP_003742760.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
3 [Metaseiulus occidentalis]
Length=393

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN LRQAKA+GD LIVGV +DEEII +KGPPV
Sbjct  15   WCDGCYDMVHFGHANQLRQAKAMGDYLIVGVHTDEEIIAHKGPPV  59



>emb|CEG66906.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=300

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  10   WVDGCFDMMHYGHANALRQAKEMGDILVVGVHSDAEIEKNKGPTV  54



>ref|XP_004343166.1| phosphoethanolamine-cytidyltransferase [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE97449.1| phosphoethanolamine-cytidyltransferase [Capsaspora owczarzaki 
ATCC 30864]
Length=388

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DMMH+GHAN+LRQAK +GD L+VGV +DEEI  NKGPPV
Sbjct  30   WCDGCYDMMHFGHANSLRQAKLMGDWLVVGVHTDEEITRNKGPPV  74



>emb|CEP15035.1| hypothetical protein [Parasitella parasitica]
Length=373

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAKA+GD L+VGV SD +I  NKGP V
Sbjct  12   WVDGCFDMMHYGHANALRQAKAMGDILVVGVHSDADIEKNKGPTV  56



>ref|XP_007228977.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Astyanax 
mexicanus]
Length=123

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+HYGH+N LRQAKA+GD L+VGV +DEEI  +KGPPV
Sbjct  28   WCDGCYDMVHYGHSNQLRQAKAMGDYLVVGVHTDEEISKHKGPPV  72



>ref|XP_002423231.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
 gb|EEB10493.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
Length=434

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD L+VGV +DEEII +KGPPV
Sbjct  43   WCDGCYDMVHFGHANSLRQAKALGDYLVVGVHNDEEIIKHKGPPV  87



>gb|EXX58968.1| ethanolamine-phosphate cytidylyltransferase [Rhizophagus irregularis 
DAOM 197198w]
Length=364

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMH+GHANALRQAKA+GD L+VGV SDEEI  +KGP V
Sbjct  13   WVDGCFDMMHHGHANALRQAKAMGDFLVVGVHSDEEIEKHKGPTV  57



>ref|XP_002600903.1| hypothetical protein BRAFLDRAFT_263711 [Branchiostoma floridae]
 ref|XP_002600908.1| hypothetical protein BRAFLDRAFT_263704 [Branchiostoma floridae]
 gb|EEN56915.1| hypothetical protein BRAFLDRAFT_263711, partial [Branchiostoma 
floridae]
 gb|EEN56920.1| hypothetical protein BRAFLDRAFT_263704, partial [Branchiostoma 
floridae]
Length=365

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDM H+GHANALRQAK +GD L+VG+ SDEEI  +KGPPV
Sbjct  15   WVDGCFDMAHFGHANALRQAKKMGDYLVVGIHSDEEITKHKGPPV  59



>ref|XP_001969670.1| GG23821 [Drosophila erecta]
 gb|EDV58729.1| GG23821 [Drosophila erecta]
Length=384

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  27   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  71



>ref|XP_011188404.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Bactrocera cucurbitae]
Length=420

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  50   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  94



>emb|CEG84347.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  10   WVDGCFDMMHYGHANALRQAKEMGDILVVGVHSDAEIEKNKGPTV  54



>ref|NP_723791.2| phosphoethanolamine cytidylyltransferase, isoform C [Drosophila 
melanogaster]
 gb|AAN10827.2| phosphoethanolamine cytidylyltransferase, isoform C [Drosophila 
melanogaster]
Length=374

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>ref|XP_002042126.1| GM10235 [Drosophila sechellia]
 gb|EDW45993.1| GM10235 [Drosophila sechellia]
Length=381

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>ref|XP_011188405.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Bactrocera cucurbitae]
Length=407

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  50   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  94



>ref|XP_002079297.1| GD23872 [Drosophila simulans]
 gb|EDX04882.1| GD23872 [Drosophila simulans]
Length=381

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>ref|NP_609613.2| phosphoethanolamine cytidylyltransferase, isoform E [Drosophila 
melanogaster]
 gb|AAF53258.2| phosphoethanolamine cytidylyltransferase, isoform E [Drosophila 
melanogaster]
Length=371

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>emb|CEG66905.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  10   WVDGCFDMMHYGHANALRQAKEMGDILVVGVHSDAEIEKNKGPTV  54



>ref|XP_002088547.1| pect [Drosophila yakuba]
 gb|EDW88259.1| pect [Drosophila yakuba]
Length=384

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  27   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  71



>gb|EKC33550.1| Ethanolamine-phosphate cytidylyltransferase [Crassostrea gigas]
Length=329

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDM+H+GHANA+RQA+ +GD LIVGV SDEEI  +KGPPV
Sbjct  13   WVDGCFDMVHFGHANAIRQARQMGDYLIVGVHSDEEISKHKGPPV  57



>gb|EPB91886.1| ethanolamine-phosphate cytidylyltransferase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=373

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  13   WVDGCFDMMHYGHANALRQAKEMGDILVVGVHSDAEIEKNKGPTV  57



>ref|XP_002065671.1| GK14544 [Drosophila willistoni]
 gb|EDW76657.1| GK14544 [Drosophila willistoni]
Length=393

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  36   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  80



>ref|NP_723790.2| phosphoethanolamine cytidylyltransferase, isoform D [Drosophila 
melanogaster]
 gb|AAO24945.1| RE62261p [Drosophila melanogaster]
 gb|AAN10826.2| phosphoethanolamine cytidylyltransferase, isoform D [Drosophila 
melanogaster]
 gb|ACL87813.1| Pect-PA, partial [synthetic construct]
Length=381

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>ref|XP_011202025.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Bactrocera dorsalis]
Length=420

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  50   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  94



>ref|NP_723789.2| phosphoethanolamine cytidylyltransferase, isoform B [Drosophila 
melanogaster]
 gb|AAF53257.2| phosphoethanolamine cytidylyltransferase, isoform B [Drosophila 
melanogaster]
 gb|ADR83708.1| GH23180p [Drosophila melanogaster]
Length=393

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  24   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  68



>ref|XP_005181838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Musca domestica]
Length=385

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  28   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  72



>ref|XP_011202026.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Bactrocera dorsalis]
Length=407

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  50   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  94



>ref|XP_002002855.1| GI17607 [Drosophila mojavensis]
 gb|EDW12297.1| GI17607 [Drosophila mojavensis]
Length=394

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  37   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  81



>emb|CEP18288.1| hypothetical protein [Parasitella parasitica]
Length=372

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            ++DGCFDMMHYGHANALRQAK +GD L+VGV SD EI  NKGP V
Sbjct  13   WVDGCFDMMHYGHANALRQAKEMGDILVVGVHSDAEIEKNKGPTV  57



>ref|XP_004527208.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Ceratitis capitata]
Length=422

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  52   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  96



>ref|XP_004527209.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Ceratitis capitata]
Length=409

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  52   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  96



>ref|XP_005181836.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Musca domestica]
Length=406

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  28   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPV  72



>ref|XP_001962647.1| GF15564 [Drosophila ananassae]
 gb|EDV31868.1| GF15564 [Drosophila ananassae]
Length=393

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  406  YMDGCFDMMHYGHANALRQAKALGDELIVGVVSDEEIIVNKGPPV  540
            + DGC+DM+H+GHAN+LRQAKALGD++IVG+ +DEEI  +KGPPV
Sbjct  36   WCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEIAKHKGPPV  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645