BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033E09

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98898.1|  unnamed protein product                              95.1    2e-19   Coffea canephora [robusta coffee]
ref|XP_011090921.1|  PREDICTED: acyl-CoA-binding domain-containin...  92.4    2e-18   Sesamum indicum [beniseed]
ref|XP_009770759.1|  PREDICTED: acyl-CoA-binding domain-containin...  83.6    1e-16   Nicotiana sylvestris
ref|XP_009629069.1|  PREDICTED: acyl-CoA-binding domain-containin...  83.6    2e-15   Nicotiana tomentosiformis
gb|EYU43915.1|  hypothetical protein MIMGU_mgv1a002202mg              82.8    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_006342766.1|  PREDICTED: acyl-CoA-binding domain-containin...  82.0    7e-15   Solanum tuberosum [potatoes]
ref|XP_004229210.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    8e-15   Solanum lycopersicum
ref|XP_010321161.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    9e-15   Solanum lycopersicum
ref|XP_006342764.1|  PREDICTED: acyl-CoA-binding domain-containin...  81.6    9e-15   Solanum tuberosum [potatoes]
ref|XP_008340834.1|  PREDICTED: acyl-CoA-binding domain-containin...  77.4    2e-13   
ref|XP_009369118.1|  PREDICTED: acyl-CoA-binding domain-containin...  77.0    3e-13   Pyrus x bretschneideri [bai li]
ref|XP_007154239.1|  hypothetical protein PHAVU_003G102100g           76.6    4e-13   Phaseolus vulgaris [French bean]
ref|XP_009339843.1|  PREDICTED: acyl-CoA-binding domain-containin...  76.3    5e-13   Pyrus x bretschneideri [bai li]
ref|XP_003631976.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.9    9e-13   Vitis vinifera
ref|XP_004486043.1|  PREDICTED: acyl-CoA-binding domain-containin...  75.1    1e-12   Cicer arietinum [garbanzo]
ref|XP_003550179.1|  PREDICTED: acyl-CoA-binding domain-containin...  74.7    2e-12   Glycine max [soybeans]
gb|KHN03383.1|  Acyl-CoA-binding domain-containing protein 4          74.7    2e-12   Glycine soja [wild soybean]
ref|XP_010243563.1|  PREDICTED: acyl-CoA-binding domain-containin...  73.2    7e-12   Nelumbo nucifera [Indian lotus]
gb|KHN02994.1|  Acyl-CoA-binding domain-containing protein 4          72.4    1e-11   Glycine soja [wild soybean]
ref|XP_008813362.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.4    1e-11   Phoenix dactylifera
ref|XP_011462696.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.4    1e-11   Fragaria vesca subsp. vesca
ref|XP_008223119.1|  PREDICTED: acyl-CoA-binding domain-containin...  72.0    2e-11   Prunus mume [ume]
ref|XP_006419645.1|  hypothetical protein CICLE_v10004439mg           69.3    1e-10   Citrus clementina [clementine]
gb|KDO75106.1|  hypothetical protein CISIN_1g0050431mg                68.2    1e-10   Citrus sinensis [apfelsine]
gb|AES64218.2|  acyl-CoA-binding domain protein                       69.3    1e-10   Medicago truncatula
ref|XP_008438824.1|  PREDICTED: acyl-CoA-binding domain-containin...  69.3    1e-10   Cucumis melo [Oriental melon]
ref|XP_003593967.1|  Acyl-CoA-binding domain-containing protein       69.3    1e-10   
ref|XP_006489135.1|  PREDICTED: acyl-CoA-binding domain-containin...  68.2    3e-10   Citrus sinensis [apfelsine]
emb|CDY13903.1|  BnaC09g39230D                                        67.8    4e-10   Brassica napus [oilseed rape]
ref|XP_004134196.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.4    5e-10   Cucumis sativus [cucumbers]
ref|XP_006597532.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.0    7e-10   
ref|XP_006597533.1|  PREDICTED: acyl-CoA-binding domain-containin...  67.0    7e-10   
ref|XP_009120961.1|  PREDICTED: acyl-CoA-binding domain-containin...  66.2    1e-09   Brassica rapa
emb|CDX92598.1|  BnaA10g16370D                                        66.2    1e-09   
ref|XP_010904792.1|  PREDICTED: tip elongation aberrant protein 3...  64.3    6e-09   
ref|XP_010904791.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    6e-09   
ref|XP_010904789.1|  PREDICTED: acyl-CoA-binding domain-containin...  64.3    6e-09   Elaeis guineensis
ref|XP_010904790.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.9    7e-09   Elaeis guineensis
ref|XP_010241732.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010241717.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010241724.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010241693.1|  PREDICTED: acyl-CoA-binding domain-containin...  63.5    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_008804572.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  63.5    1e-08   
ref|XP_010098333.1|  hypothetical protein L484_023581                 63.2    1e-08   
ref|XP_006594496.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.4    3e-08   Glycine max [soybeans]
ref|XP_006594495.1|  PREDICTED: acyl-CoA-binding domain-containin...  62.4    3e-08   Glycine max [soybeans]
gb|EPS67095.1|  hypothetical protein M569_07681                       59.3    5e-08   Genlisea aurea
ref|XP_010931593.1|  PREDICTED: tip elongation aberrant protein 3...  60.1    1e-07   
ref|XP_010931591.1|  PREDICTED: tip elongation aberrant protein 3...  60.1    1e-07   Elaeis guineensis
ref|XP_010931595.1|  PREDICTED: tip elongation aberrant protein 3...  60.1    1e-07   Elaeis guineensis
ref|XP_007147881.1|  hypothetical protein PHAVU_006G162800g           60.1    1e-07   Phaseolus vulgaris [French bean]
ref|XP_010931592.1|  PREDICTED: tip elongation aberrant protein 3...  60.1    1e-07   Elaeis guineensis
dbj|BAH19562.1|  AT5G18590                                            59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197360.2|  kelch repeat-containing protein                     59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78582.1|  RanGAP1 interacting protein                           59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007035509.1|  Galactose oxidase/kelch repeat superfamily p...  59.3    2e-07   
ref|XP_007035508.1|  Galactose oxidase/kelch repeat superfamily p...  59.3    2e-07   
ref|XP_007035506.1|  Galactose oxidase/kelch repeat superfamily p...  59.3    3e-07   
ref|XP_009393228.1|  PREDICTED: acyl-CoA-binding domain-containin...  58.9    3e-07   
gb|KHG01869.1|  Acyl-CoA-binding domain-containing protein 4          58.9    4e-07   Gossypium arboreum [tree cotton]
ref|XP_006400408.1|  hypothetical protein EUTSA_v10012828mg           58.5    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_002315566.1|  hypothetical protein POPTR_0010s02240g           58.2    6e-07   
ref|XP_006380198.1|  hypothetical protein POPTR_0008s22830g           58.2    6e-07   
gb|KJB72597.1|  hypothetical protein B456_011G187500                  57.4    1e-06   Gossypium raimondii
gb|KJB72596.1|  hypothetical protein B456_011G187500                  57.0    1e-06   Gossypium raimondii
gb|KJB72599.1|  hypothetical protein B456_011G187500                  57.0    1e-06   Gossypium raimondii
gb|KJB72598.1|  hypothetical protein B456_011G187500                  57.0    1e-06   Gossypium raimondii
ref|XP_004508299.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    1e-06   Cicer arietinum [garbanzo]
ref|XP_004508300.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    2e-06   Cicer arietinum [garbanzo]
ref|XP_004508297.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    2e-06   
ref|XP_004508298.1|  PREDICTED: acyl-CoA-binding domain-containin...  57.0    2e-06   
ref|XP_002516884.1|  acyl-CoA binding protein, putative               56.6    2e-06   Ricinus communis
ref|XP_011012822.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.6    2e-06   Populus euphratica
ref|XP_011015377.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    3e-06   Populus euphratica
ref|XP_011005541.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    3e-06   Populus euphratica
ref|XP_011015380.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    3e-06   Populus euphratica
ref|XP_011005544.1|  PREDICTED: acyl-CoA-binding domain-containin...  56.2    3e-06   Populus euphratica
ref|XP_010492874.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.5    4e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004979880.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.5    4e-06   Setaria italica
ref|XP_010454111.1|  PREDICTED: acyl-CoA-binding domain-containin...  55.1    5e-06   
ref|XP_006287583.1|  hypothetical protein CARUB_v10000793mg           54.7    7e-06   
ref|XP_010524753.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.7    8e-06   
gb|KDP40010.1|  hypothetical protein JCGZ_02008                       54.7    9e-06   Jatropha curcas
gb|KCW61088.1|  hypothetical protein EUGRSUZ_H03862                   54.3    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010024637.1|  PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-bin...  54.3    1e-05   
ref|XP_010420634.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010420635.1|  PREDICTED: acyl-CoA-binding domain-containin...  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002873905.1|  kelch repeat-containing protein                  53.9    1e-05   
gb|KHG01870.1|  Acyl-CoA-binding domain-containing protein 4          53.9    1e-05   Gossypium arboreum [tree cotton]
ref|XP_009402528.1|  PREDICTED: acyl-CoA-binding domain-containin...  53.5    2e-05   
ref|XP_009402527.1|  PREDICTED: kelch repeat-containing protein 1...  53.5    2e-05   
gb|AES91804.2|  acyl-CoA-binding domain protein                       52.4    5e-05   Medicago truncatula
gb|AES91803.2|  acyl-CoA-binding domain protein                       52.4    5e-05   Medicago truncatula
ref|XP_003609607.1|  Acyl-CoA-binding domain-containing protein       52.4    5e-05   
ref|XP_003609606.1|  Acyl-CoA-binding domain-containing protein       52.0    5e-05   
ref|XP_010683938.1|  PREDICTED: acyl-CoA-binding domain-containin...  52.0    6e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003577276.1|  PREDICTED: acyl-CoA-binding domain-containin...  51.2    9e-05   Brachypodium distachyon [annual false brome]
ref|XP_010237468.1|  PREDICTED: uncharacterized protein LOC100836...  51.2    9e-05   
gb|KHG00526.1|  Acyl-CoA-binding domain-containing 4 -like protein    49.3    4e-04   Gossypium arboreum [tree cotton]
gb|KJB38635.1|  hypothetical protein B456_006G264600                  49.3    4e-04   Gossypium raimondii
ref|XP_002449932.1|  hypothetical protein SORBIDRAFT_05g025915        48.9    6e-04   



>emb|CDO98898.1| unnamed protein product [Coffea canephora]
Length=710

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR SS +G+ +  ++N S ES+CQ S+G
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRVSSYSGQGLAPALNASHESNCQTSSG  60

Query  474  A  476
            A
Sbjct  61   A  61



>ref|XP_011090921.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090922.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
 ref|XP_011090923.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Sesamum 
indicum]
Length=712

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFSRRRMKLGRL+VQLSD+AQGT+SPIRHPKRFS+S GE V  + ++++E +CQ S+ 
Sbjct  1    MFGFSRRRMKLGRLRVQLSDSAQGTRSPIRHPKRFSNSNGEGVAAASSEADELNCQSSSN  60

Query  474  A  476
            A
Sbjct  61   A  61



>ref|XP_009770759.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Nicotiana sylvestris]
Length=214

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----SSPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>ref|XP_009629069.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nicotiana 
tomentosiformis]
Length=707

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL      + QGT+SP+RHPKRFS+S+GEAV +S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRLS-----SPQGTRSPMRHPKRFSNSSGEAVPHSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>gb|EYU43915.1| hypothetical protein MIMGU_mgv1a002202mg [Erythranthe guttata]
Length=702

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRR+MK+GR+KVQLSD++QGT+SPIRH KRFSSS GE V  + ++S+E +C  S+
Sbjct  1    MFGFSRRKMKIGRVKVQLSDSSQGTRSPIRHAKRFSSSNGEGVALASSESDELNCHSSS  59



>ref|XP_006342766.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Solanum tuberosum]
Length=662

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>ref|XP_004229210.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 isoform 
X2 [Solanum lycopersicum]
Length=661

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>ref|XP_010321161.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010321165.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 isoform 
X1 [Solanum lycopersicum]
Length=700

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>ref|XP_006342764.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006342765.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Solanum tuberosum]
Length=701

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFS+RRMKLGRL     ++AQGT+SP+RHPKR S+S+GEAV  S NDSEE SCQ S+G
Sbjct  1    MFGFSKRRMKLGRL-----NSAQGTRSPMRHPKRSSNSSGEAVPPSNNDSEEKSCQCSSG  55

Query  474  A  476
            A
Sbjct  56   A  56



>ref|XP_008340834.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Malus 
domestica]
Length=715

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E   Q
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVPATSNSDELDSQ  56



>ref|XP_009369118.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009369119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E    + ++S+E
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDAPASSNSDE  52



>ref|XP_007154239.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
 gb|ESW26233.1| hypothetical protein PHAVU_003G102100g [Phaseolus vulgaris]
Length=709

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGRLKVQLS+  QGT++PIRHPKR  +S GE    S   S+E  C  ST
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANQGTRTPIRHPKRNGNSNGEGDAGSSGHSDEVDCLPST  59



>ref|XP_009339843.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
 ref|XP_009339844.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Pyrus x bretschneideri]
Length=711

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSC  458
            MFGFSRRRMKLGRLKVQLSD+AQGT+SPIRHPKR +SS  E   + +S +D  +  C
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSAQGTRSPIRHPKRNNSSNNECDVLASSNSDELDGQC  57



>ref|XP_003631976.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Vitis 
vinifera]
 emb|CBI26099.3| unnamed protein product [Vitis vinifera]
Length=717

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFS-SSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGRLKVQL+D+AQGT+SPI+  KR S ++ GE+ G +   S+E +CQ+S+
Sbjct  1    MFGFSRRRMKLGRLKVQLADSAQGTRSPIKQSKRTSNTNNGESGGRASGQSDELNCQYSS  60

Query  471  GA  476
             A
Sbjct  61   DA  62



>ref|XP_004486043.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=709

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFSRR  KL R+KVQLSDT QGT+SPIR+PKR  +S G+ V  +   SEE  CQ S+ 
Sbjct  1    MFGFSRRHKKLSRVKVQLSDTTQGTRSPIRYPKRNGNSNGDGVAGTSGHSEEIDCQFSST  60

Query  474  A  476
            A
Sbjct  61   A  61



>ref|XP_003550179.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Glycine max]
Length=708

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST  59



>gb|KHN03383.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=736

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGRLKVQLS+   GT++P+R PKR  +  G+A G S   S+E  CQ ST
Sbjct  1    MFGFSRRRMKLGRLKVQLSEANPGTRTPVRPPKRNGTEIGDAAGGSSGHSDEVDCQPST  59



>ref|XP_010243563.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Nelumbo 
nucifera]
Length=707

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGRLKVQLSD+ QGT+SPIR  KR   S GE    + + ++E +CQ S+
Sbjct  1    MFGFSRRRMKLGRLKVQLSDSTQGTRSPIRPAKRVGHSNGENTAPTSSHTDELNCQCSS  59



>gb|KHN02994.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGN---SINDSEESSCQH  464
            MFG SRRRMKLGRLKVQLS+   GT++PIRHPKR  +S GE  G+   S   S+E  CQ 
Sbjct  1    MFGISRRRMKLGRLKVQLSEANPGTRTPIRHPKRNGNSNGEGEGDAGGSSGHSDEVDCQP  60

Query  465  ST  470
            ST
Sbjct  61   ST  62



>ref|XP_008813362.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
 ref|XP_008813363.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Phoenix dactylifera]
Length=728

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 46/63 (73%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGRLKV L D +QGT+SPIRH KR S S GE  V  S+N  S++ +C+  
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPIRHTKRASQSNGENVVSASVNGRSDDINCRCP  63

Query  468  TGA  476
             GA
Sbjct  64   LGA  66



>ref|XP_011462696.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Fragaria 
vesca subsp. vesca]
Length=709

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MFGFSR+RMK+GRLKVQLSD+ QGT+SPIR PKR +SS  ++   + + S+E  CQ
Sbjct  1    MFGFSRKRMKIGRLKVQLSDSTQGTRSPIRQPKRNNSSNNDSDAPASSLSDELDCQ  56



>ref|XP_008223119.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Prunus 
mume]
Length=714

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFSRRR+KLGRLKVQLSD+AQGT+SPIR PK   SS  E    + ++S+E   Q S+ 
Sbjct  1    MFGFSRRRLKLGRLKVQLSDSAQGTRSPIRQPKPNKSSNSECDAPASSNSDEPDHQCSSA  60

Query  474  A  476
            A
Sbjct  61   A  61



>ref|XP_006419645.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
 gb|ESR32885.1| hypothetical protein CICLE_v10004439mg [Citrus clementina]
Length=717

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N ++E  C+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADERDCE  57



>gb|KDO75106.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75107.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75108.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
 gb|KDO75109.1| hypothetical protein CISIN_1g0050431mg, partial [Citrus sinensis]
Length=352

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCE  57



>gb|AES64218.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=699

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQH-S  467
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ  S
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60

Query  468  TG  473
            TG
Sbjct  61   TG  62



>ref|XP_008438824.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Cucumis 
melo]
Length=677

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 40/52 (77%), Gaps = 1/52 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR SSS  E    +   SEE
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSSSNSECAAPASRHSEE  51



>ref|XP_003593967.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=764

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSR+  KLGR+K VQLSDT QGT+SP+RHPKR ++S  + V  S   SEE  CQ ++
Sbjct  1    MFGFSRKHKKLGRVKKVQLSDTTQGTRSPLRHPKRNANSNDDGVEGSSGHSEEIDCQFTS  60



>ref|XP_006489135.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Citrus sinensis]
Length=717

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MFGFSRRRMKLGR+K VQLSD+AQ  +SPIR PKR S+   E V  S N +++  C+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCE  57



>emb|CDY13903.1| BnaC09g39230D [Brassica napus]
Length=674

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  470
            MF FS+RRMKLGR+KVQLSD+AQGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSAQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|XP_004134196.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 ref|XP_004171907.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
[Cucumis sativus]
 gb|KGN57083.1| hypothetical protein Csa_3G152100 [Cucumis sativus]
Length=678

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGF RRRMKLGRLKVQLSD AQGT+SPIR+PKR S S  E    +   SEE
Sbjct  1    MFGF-RRRMKLGRLKVQLSDPAQGTRSPIRNPKRGSGSNSECAAPASRHSEE  51



>ref|XP_006597532.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
 gb|KHN33131.1| Acyl-CoA-binding domain-containing protein 4 [Glycine soja]
Length=715

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  471  GA  476
             A
Sbjct  57   AA  58



>ref|XP_006597533.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=711

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH KR     G+ V  +   SEE  C  S+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTQGTRSPIRHHKR----NGDRVAGTSGHSEEIDCPLSS  56

Query  471  GA  476
             A
Sbjct  57   AA  58



>ref|XP_009120961.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Brassica 
rapa]
Length=700

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  470
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>emb|CDX92598.1| BnaA10g16370D [Brassica napus]
Length=700

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVG-NSINDSEESSCQHST  470
            MF FS+RRMKLGR+KVQLSD++QGTKSP+R  KR  +ST EA    + + S+E   Q S+
Sbjct  1    MFSFSKRRMKLGRVKVQLSDSSQGTKSPLRVTKRVDNSTNEAAALAATSHSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|XP_010904792.1| PREDICTED: tip elongation aberrant protein 3-like isoform X4 
[Elaeis guineensis]
Length=705

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV  422
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENV  46



>ref|XP_010904791.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Elaeis guineensis]
Length=706

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV  422
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENV  46



>ref|XP_010904789.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Elaeis guineensis]
Length=732

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV  422
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENV  46



>ref|XP_010904790.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Elaeis guineensis]
Length=729

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAV  422
            MFGFSRRRMKLGRLKV L D +QGT+SP+R  KR S + GE V
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPVRPTKRASQANGENV  46



>ref|XP_010241732.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Nelumbo nucifera]
Length=576

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+   + +  +E
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGESAAPASSHCDE  52



>ref|XP_010241717.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Nelumbo nucifera]
Length=705

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGES  42



>ref|XP_010241724.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Nelumbo nucifera]
Length=704

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGES  42



>ref|XP_010241693.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241702.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010241709.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Nelumbo nucifera]
Length=710

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MFGFSRRR+KLGR KVQLSD+ +GT+SPIR  KR + S GE+
Sbjct  1    MFGFSRRRLKLGRXKVQLSDSTEGTRSPIRSTKRLNHSNGES  42



>ref|XP_008804572.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 5 [Phoenix dactylifera]
Length=715

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGRLKV L D +QGT+SP R  KR + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRLKVHLGDPSQGTRSPSRPTKRVNQSDGENVVSASVSGRSDDINCPCS  63

Query  468  TGA  476
             GA
Sbjct  64   VGA  66



>ref|XP_010098333.1| hypothetical protein L484_023581 [Morus notabilis]
 gb|EXB74837.1| hypothetical protein L484_023581 [Morus notabilis]
Length=674

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHSTG  473
            MFGFSRRRMKLGRLKVQL+++A GT  PIR PKR  +S  E  G     S E   Q S+ 
Sbjct  1    MFGFSRRRMKLGRLKVQLNESANGT--PIRQPKRTGNSNSECDGPVSRKSNEVDAQCSSA  58

Query  474  A  476
            A
Sbjct  59   A  59



>ref|XP_006594496.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Glycine max]
Length=699

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK  53



>ref|XP_006594495.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Glycine max]
Length=710

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGFSRR MKLG RLKVQLSDT  GT+SPIRH KR  +S G+ V  +   SE+
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTTLGTRSPIRHHKRNVNSNGDRVTGTSGHSEK  53



>gb|EPS67095.1| hypothetical protein M569_07681 [Genlisea aurea]
Length=238

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  416
            MFGFS+RRMKLGRLKV LSD++QG +SP R  KRFS +  E
Sbjct  1    MFGFSKRRMKLGRLKVHLSDSSQGLRSPHRPAKRFSHTNVE  41



>ref|XP_010931593.1| PREDICTED: tip elongation aberrant protein 3 isoform X3 [Elaeis 
guineensis]
Length=727

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  468  TGA  476
            +GA
Sbjct  64   SGA  66



>ref|XP_010931591.1| PREDICTED: tip elongation aberrant protein 3 isoform X1 [Elaeis 
guineensis]
Length=733

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  468  TGA  476
            +GA
Sbjct  64   SGA  66



>ref|XP_010931595.1| PREDICTED: tip elongation aberrant protein 3 isoform X4 [Elaeis 
guineensis]
Length=717

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  468  TGA  476
            +GA
Sbjct  64   SGA  66



>ref|XP_007147881.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
 gb|ESW19875.1| hypothetical protein PHAVU_006G162800g [Phaseolus vulgaris]
Length=710

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +3

Query  294  MFGFSRRRMKLG-RLKVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MFGFSRR MKLG RLKVQLSDT QGT+SPIRH ++     G+ V  +   SEE
Sbjct  1    MFGFSRRHMKLGSRLKVQLSDTPQGTRSPIRHHQK---RNGDGVARTSGHSEE  50



>ref|XP_010931592.1| PREDICTED: tip elongation aberrant protein 3 isoform X2 [Elaeis 
guineensis]
Length=730

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE-AVGNSIND-SEESSCQHS  467
            MFGFSRRRMKLGR+KV L D +QG +SP R   R + S GE  V  S++  S++ +C  S
Sbjct  4    MFGFSRRRMKLGRMKVHLGDPSQGIRSPSRPTNRVNQSNGENVVSTSVSGRSDDINCMCS  63

Query  468  TGA  476
            +GA
Sbjct  64   SGA  66



>dbj|BAH19562.1| AT5G18590 [Arabidopsis thaliana]
Length=708

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|NP_197360.2| kelch repeat-containing protein [Arabidopsis thaliana]
 ref|NP_850846.1| kelch repeat-containing protein [Arabidopsis thaliana]
 dbj|BAE98374.1| RanGAP1 interacting protein [Arabidopsis thaliana]
 gb|AED92582.1| kelch repeat-containing protein [Arabidopsis thaliana]
 gb|AED92583.1| kelch repeat-containing protein [Arabidopsis thaliana]
Length=708

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>gb|AAM78582.1| RanGAP1 interacting protein [Arabidopsis thaliana]
Length=708

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  SS+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|XP_007035509.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
 gb|EOY06435.1| Galactose oxidase/kelch repeat superfamily protein isoform 4 
[Theobroma cacao]
Length=701

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGES  45



>ref|XP_007035508.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
 gb|EOY06434.1| Galactose oxidase/kelch repeat superfamily protein isoform 3, 
partial [Theobroma cacao]
Length=679

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGES  45



>ref|XP_007035506.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007035507.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06432.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY06433.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=716

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MF FSRRRMKLGR+K VQLS++A G KSPIR PKR +++ GE+
Sbjct  3    MFSFSRRRMKLGRVKKVQLSESAHGIKSPIRPPKRSNNTNGES  45



>ref|XP_009393228.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393229.1| PREDICTED: acyl-CoA-binding domain-containing protein 4 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSST--GEAVGNSINDSEESSCQHS  467
            +FGFSRRR KLGRLKV L+D  QGT+SPIR  KR S S    E + +S   S++ +C  S
Sbjct  4    IFGFSRRRTKLGRLKVHLADPVQGTRSPIRPSKRHSQSNEENEVLPSSSGRSDDHNCHCS  63

Query  468  T  470
            +
Sbjct  64   S  64



>gb|KHG01869.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=709

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDE  53



>ref|XP_006400408.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
 gb|ESQ41861.1| hypothetical protein EUTSA_v10012828mg [Eutrema salsugineum]
Length=701

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQLSD+ QG KSP+R  KR  +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSDSVQGFKSPLRATKRADNSSNEAALAATSYSDELDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|XP_002315566.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
 gb|EEF01737.1| hypothetical protein POPTR_0010s02240g [Populus trichocarpa]
Length=663

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 4/56 (7%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEE  449
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E V  + N+S+E
Sbjct  1    MFGFSKRRTKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNANSEGVALTTNNSDE  56



>ref|XP_006380198.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
 gb|ERP57995.1| hypothetical protein POPTR_0008s22830g [Populus trichocarpa]
Length=707

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 43/64 (67%), Gaps = 6/64 (9%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRF-----SSSTGEAVGNSINDSEESS  455
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR      ++S G A+  S +D  +  
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISNNNANSEGVALTASNSDDLDYH  60

Query  456  CQHS  467
            C  S
Sbjct  61   CSSS  64



>gb|KJB72597.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=606

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDE  53



>gb|KJB72596.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
 gb|KJB72600.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=709

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDE  53



>gb|KJB72599.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=706

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDE  53



>gb|KJB72598.1| hypothetical protein B456_011G187500 [Gossypium raimondii]
Length=679

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++   E+   ++N S+E
Sbjct  1    MFSFSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNPNVESAMLAVNHSDE  53



>ref|XP_004508299.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X3 [Cicer arietinum]
Length=716

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  443
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  444  EESSC  458
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_004508300.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X4 [Cicer arietinum]
Length=690

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  443
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  444  EESSC  458
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_004508297.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Cicer arietinum]
Length=782

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  443
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  444  EESSC  458
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_004508298.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Cicer arietinum]
Length=776

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 12/65 (18%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPI--RHPKRFSSST--------GEAVGNSINDS  443
            MFGFSRRR KLGRLKVQ    ++GT+SPI  RHPKR  +S         G+AV  S   S
Sbjct  1    MFGFSRRRTKLGRLKVQ--QLSEGTRSPIIVRHPKRIPNSILNGEEEEDGDAVAGSSGHS  58

Query  444  EESSC  458
            +E+ C
Sbjct  59   DENVC  63



>ref|XP_002516884.1| acyl-CoA binding protein, putative [Ricinus communis]
 gb|EEF45498.1| acyl-CoA binding protein, putative [Ricinus communis]
Length=713

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQ  461
            MF FS RRMKLGR+K VQLSD+A  T+SPIR  KR ++   E V  + + S+E  CQ
Sbjct  1    MFSFSGRRMKLGRVKKVQLSDSALVTRSPIRPQKRTNNPNSEGVAPTTSHSDELDCQ  57



>ref|XP_011012822.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012823.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011012825.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=721

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSS  407
            MFGFS+RRMKLGR+K VQLSD++ G +SPIR PKR  S+
Sbjct  1    MFGFSKRRMKLGRVKKVQLSDSSPGIRSPIRPPKRIISN  39



>ref|XP_011015377.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015378.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011015379.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEE  449
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDE  56



>ref|XP_011005541.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005542.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
 ref|XP_011005543.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Populus euphratica]
Length=720

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEE  449
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDE  56



>ref|XP_011015380.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEE  449
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDE  56



>ref|XP_011005544.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Populus euphratica]
Length=700

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTG---EAVGNSINDSEE  449
            MFGFS+RR KLGR+K VQLSD+  G +SPIR PKR  SS     E    + N+S+E
Sbjct  1    MFGFSKRRAKLGRVKKVQLSDSTPGIRSPIRPPKRIISSNNVNSEGAALTTNNSDE  56



>ref|XP_010492874.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
 ref|XP_010492875.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVDFQPSS  60



>ref|XP_004979880.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Setaria italica]
Length=685

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  416
            MFGFSRRRMKLGRLK  L D   G++SP R  KRFS   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPSRQTKRFSHPNGE  44



>ref|XP_010454111.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
[Camelina sativa]
Length=707

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDEVGFQPSS  60



>ref|XP_006287583.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
 gb|EOA20481.1| hypothetical protein CARUB_v10000793mg [Capsella rubella]
Length=498

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSSEAPVAATSYSDEHDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>ref|XP_010524753.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524754.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
 ref|XP_010524755.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Tarenaya 
hassleriana]
Length=698

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FSRRR KLGR+K VQLSD+A G  SP+R  KR ++ST E        S+E   Q   
Sbjct  1    MFSFSRRRTKLGRVKKVQLSDSASGRASPLRQTKRVNNSTNEGAETEARHSDELDFQSPP  60

Query  471  G  473
            G
Sbjct  61   G  61



>gb|KDP40010.1| hypothetical protein JCGZ_02008 [Jatropha curcas]
Length=709

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = +3

Query  294  MFGFSRRRMKLGRL-KVQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFGFSRRRMKLGR+ KVQLSD+   T+SP+R  KR  +  GE    + +  +E  CQ S+
Sbjct  1    MFGFSRRRMKLGRVKKVQLSDSTLVTRSPVRTQKR--NPNGEGAAPTTSHFDELDCQCSS  58

Query  471  G  473
             
Sbjct  59   A  59



>gb|KCW61088.1| hypothetical protein EUGRSUZ_H03862 [Eucalyptus grandis]
Length=510

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  471  GA  476
             A
Sbjct  61   SA  62



>ref|XP_010024637.1| PREDICTED: LOW QUALITY PROTEIN: acyl-CoA-binding domain-containing 
protein 4 [Eucalyptus grandis]
Length=696

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MFG SRRRMK+GR+K VQLSD  QGT+SP+R  KR ++   E    + + S E+  Q  +
Sbjct  1    MFGISRRRMKIGRVKKVQLSDATQGTRSPMRQIKRGNNQNNEGAVPASDCSNENDSQSPS  60

Query  471  GA  476
             A
Sbjct  61   SA  62



>ref|XP_010420634.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X1 [Camelina sativa]
Length=707

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDE  53



>ref|XP_010420635.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Camelina sativa]
Length=691

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            MF FS+RRM+LGR+K VQL+++ QG KSP+R  KR  +S+ EAV  + + S+E
Sbjct  1    MFSFSKRRMRLGRVKKVQLAESVQGYKSPLRTIKRADNSSNEAVLAATSYSDE  53



>ref|XP_002873905.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50164.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=709

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEESSCQHST  470
            MF FS+RRM+LGR+K VQLS++ QG KSP+R  K   +S+ EA   + + S+E   Q S+
Sbjct  1    MFSFSKRRMRLGRVKKVQLSESVQGYKSPLRVTKLADNSSNEAAVAATSYSDEFDFQPSS  60

Query  471  G  473
            G
Sbjct  61   G  61



>gb|KHG01870.1| Acyl-CoA-binding domain-containing protein 4 [Gossypium arboreum]
Length=733

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = +3

Query  303  FSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEAVGNSINDSEE  449
            FSRRRMKLGR+K VQLS++A G KSP+R PK+ ++S  E+   ++N S+E
Sbjct  28   FSRRRMKLGRVKKVQLSESANGIKSPMRPPKQSNNSNVESAMLAVNHSDE  77



>ref|XP_009402528.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=553

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  467
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  468  T  470
            +
Sbjct  64   S  64



>ref|XP_009402527.1| PREDICTED: kelch repeat-containing protein 1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=733

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE--AVGNSINDSEESSCQHS  467
            +FGFSRRR K+GRLKV L D  QGT+SPIR   + S +  E   + +S   S++ +C  S
Sbjct  4    IFGFSRRRKKIGRLKVHLKDPLQGTRSPIRSSNQLSQTNEENGGLASSSGRSDDPNCHFS  63

Query  468  T  470
            +
Sbjct  64   S  64



>gb|AES91804.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=711

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSS--TGEAVGNSINDSEESSC  458
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  459  QHS  467
             HS
Sbjct  58   GHS  60



>gb|AES91803.2| acyl-CoA-binding domain protein [Medicago truncatula]
Length=719

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSS--TGEAVGNSINDSEESSC  458
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  459  QHS  467
             HS
Sbjct  58   GHS  60



>ref|XP_003609607.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=735

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  458
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  459  QHS  467
             HS
Sbjct  58   GHS  60



>ref|XP_003609606.1| Acyl-CoA-binding domain-containing protein [Medicago truncatula]
Length=743

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKV-QLSDTAQGTKSP--IRHPKRFSSST--GEAVGNSINDSEESSC  458
            MFGFSRRR K GR KV QLSD   GT+SP  +RHPKR  +S   GE   + I D+   S 
Sbjct  1    MFGFSRRRTKFGRFKVQQLSD---GTRSPVSVRHPKRIPNSILNGEGEEDGIGDAVTGSS  57

Query  459  QHS  467
             HS
Sbjct  58   GHS  60



>ref|XP_010683938.1| PREDICTED: acyl-CoA-binding domain-containing protein 5 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGEA-VGNSINDSEESS  455
            MF FSRRR KLGR+KV LSD  QGTKSP+R  KR S+S  E+ V  +   SE SS
Sbjct  3    MFSFSRRRTKLGRMKV-LSDPTQGTKSPLRPLKRASNSNVESFVATADRVSEPSS  56



>ref|XP_003577276.1| PREDICTED: acyl-CoA-binding domain-containing protein 5-like 
isoform X1 [Brachypodium distachyon]
Length=685

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  416
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGE  44



>ref|XP_010237468.1| PREDICTED: uncharacterized protein LOC100836074 isoform X2 [Brachypodium 
distachyon]
Length=682

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFSSSTGE  416
            MFGFSRRRMKLGRLK  L D   G++SP R  KR S   GE
Sbjct  4    MFGFSRRRMKLGRLKGHLHDPFHGSRSPARLTKRSSYPNGE  44



>gb|KHG00526.1| Acyl-CoA-binding domain-containing 4 -like protein [Gossypium 
arboreum]
Length=703

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVES  45



>gb|KJB38635.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
 gb|KJB38637.1| hypothetical protein B456_006G264600 [Gossypium raimondii]
Length=706

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLK-VQLSDTAQGTKSPIRHPKRFSSSTGEA  419
            MF FSRRRMKL R+K VQLS++  GT+SPIR  KR +++  E+
Sbjct  3    MFSFSRRRMKLNRVKKVQLSESVHGTRSPIRPSKRNNNTIVES  45



>ref|XP_002449932.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
 gb|EES08920.1| hypothetical protein SORBIDRAFT_05g025915 [Sorghum bicolor]
Length=649

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  294  MFGFSRRRMKLGRLKVQLSDTAQGTKSPIRHPKRFS  401
            MFGFSRRRMKLGRLK  L D    ++SP R  KRFS
Sbjct  4    MFGFSRRRMKLGRLKGHLHDHFHASRSPSRTTKRFS  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730