BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033E02

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234196.1|  FtsH-like protein precursor                        161   3e-43   
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    150   3e-39   Solanum tuberosum [potatoes]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    130   3e-32   Capsicum annuum
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    130   9e-32   Nicotiana sylvestris
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    129   2e-31   Sesamum indicum [beniseed]
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    127   1e-30   Nicotiana tomentosiformis
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    126   1e-30   Nicotiana tomentosiformis
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    126   2e-30   Nicotiana sylvestris
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    126   2e-30   Nicotiana tabacum [American tobacco]
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         124   1e-29   Jatropha curcas
emb|CDP07308.1|  unnamed protein product                                119   5e-28   Coffea canephora [robusta coffee]
ref|XP_002510649.1|  Cell division protease ftsH, putative              118   1e-27   
gb|KJB14312.1|  hypothetical protein B456_002G118800                    115   7e-27   Gossypium raimondii
gb|KJB14313.1|  hypothetical protein B456_002G118800                    115   8e-27   Gossypium raimondii
gb|KJB14314.1|  hypothetical protein B456_002G118800                    115   9e-27   Gossypium raimondii
gb|KJB14315.1|  hypothetical protein B456_002G118800                    115   9e-27   Gossypium raimondii
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    115   1e-26   Genlisea aurea
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    115   1e-26   Gossypium arboreum [tree cotton]
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          113   4e-26   
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    114   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       114   4e-26   
gb|EYU17514.1|  hypothetical protein MIMGU_mgv1a004291mg                112   8e-26   Erythranthe guttata [common monkey flower]
emb|CDP03477.1|  unnamed protein product                                108   2e-25   Coffea canephora [robusta coffee]
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    111   4e-25   Gossypium arboreum [tree cotton]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    110   7e-25   
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    109   1e-24   Sesamum indicum [beniseed]
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    109   1e-24   
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    109   1e-24   Pyrus x bretschneideri [bai li]
emb|CDP18582.1|  unnamed protein product                                104   4e-24   Coffea canephora [robusta coffee]
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   8e-24   Fragaria vesca subsp. vesca
gb|KJB57986.1|  hypothetical protein B456_009G188700                    105   1e-23   Gossypium raimondii
gb|KJB57987.1|  hypothetical protein B456_009G188700                    106   2e-23   Gossypium raimondii
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    105   3e-23   Citrus sinensis [apfelsine]
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    105   3e-23   Cucumis sativus [cucumbers]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             105   3e-23   Citrus clementina [clementine]
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   105   4e-23   Citrus sinensis [apfelsine]
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    103   2e-22   Cucumis melo [Oriental melon]
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    103   3e-22   Tarenaya hassleriana [spider flower]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     101   8e-22   Vitis vinifera
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    101   1e-21   Vitis vinifera
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             100   3e-21   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.8    4e-21   Prunus mume [ume]
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...  99.4    6e-21   Populus euphratica
ref|XP_002306970.2|  Cell division protein ftsH                       98.6    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...  97.8    2e-20   Eucalyptus grandis [rose gum]
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg              96.7    5e-20   Erythranthe guttata [common monkey flower]
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg              96.7    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_002301927.1|  Cell division protein ftsH                       95.9    8e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...  94.7    3e-19   Populus euphratica
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803           92.0    2e-18   
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH          92.0    2e-18   Morus notabilis
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5           90.5    7e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56755.1|  AT5G42270                                            90.1    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...  86.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg           85.1    4e-16   Capsella rubella
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...  82.8    3e-15   Camelina sativa [gold-of-pleasure]
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein       82.0    4e-15   Medicago truncatula
emb|CDY01840.1|  BnaC06g28800D                                        82.4    4e-15   
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein       82.0    6e-15   Medicago truncatula
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg           80.1    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.7    4e-14   Glycine max [soybeans]
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.3    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...  79.3    5e-14   Camelina sativa [gold-of-pleasure]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...  77.8    1e-13   Medicago sativa [alfalfa]
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...  77.8    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950           77.8    2e-13   Arabidopsis lyrata subsp. lyrata
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...  77.8    2e-13   
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...  75.5    8e-13   Brassica rapa
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...  75.5    1e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g           72.8    8e-12   Phaseolus vulgaris [French bean]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                  71.2    3e-11   Arabis alpina [alpine rockcress]
emb|CDX96068.1|  BnaA07g26630D                                        69.7    9e-11   
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg           69.3    1e-10   Capsella rubella
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg           66.6    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...  65.1    3e-09   Cicer arietinum [garbanzo]
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...  63.9    8e-09   Camelina sativa [gold-of-pleasure]
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                  63.5    9e-09   
gb|AFW75732.1|  hypothetical protein ZEAMMB73_601488                  62.4    1e-08   
emb|CAA73318.1|  ATPase                                               62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1           62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA68141.1|  chloroplast FtsH protease                            62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81336.1|  hypothetical protein OsI_24516                        62.0    3e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001058625.1|  Os06g0725900                                     62.0    3e-08   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                        61.6    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...  61.2    5e-08   Phoenix dactylifera
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...  61.2    5e-08   Setaria italica
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                   60.5    8e-08   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...  58.2    5e-07   Elaeis guineensis
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...  56.6    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...  56.2    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760        53.9    1e-05   Amborella trichopoda
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...  52.4    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726           51.6    7e-05   



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            SRR+++ PQS L+K SN D+FK + SKA +AALLFSSI PQA ALDN TPAAPP  I+AE
Sbjct  32   SRRKYIVPQSILSKKSNSDNFKNVPSKAAIAALLFSSITPQAFALDNTTPAAPPQVIEAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            AP+P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVK
Sbjct  92   APKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVK  138



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            S+R+ + PQS L K  N D+FK + SKA LAALLFSSI P A ALDN TPAAPP  I+AE
Sbjct  32   SKRKCIVPQSILNKKPNSDNFKNVPSKAALAALLFSSITPHAFALDNTTPAAPPQVIEAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A +P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVK
Sbjct  92   ALKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVK  138



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP-AAPPTEIQA  310
            S+R+ +  QS L K  N D+FK   SKA LAALLFSSI P AIALD+A P A+PP  ++ 
Sbjct  7    SKRKCIITQSTLNKKPNSDNFKNAQSKAALAALLFSSITPHAIALDDAAPIASPPQVMEV  66

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            EAP P  SN  PFSQN+VLNAPK QA P SDLPE +QWRYSEFLNAVK
Sbjct  67   EAPNPNTSNPLPFSQNLVLNAPKTQASPVSDLPESTQWRYSEFLNAVK  114



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +2

Query  140  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  313
            R+ F  PQS L K  N D  K   S+A LAALLFSSI PQA ALDN TP APP + +QAE
Sbjct  34   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALLFSSITPQAFALDNTTPTAPPPSVVQAE  93

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             P+P   N S FSQN++LNAPKPQAQ  SD+P+GSQWRYSEFLNAVK
Sbjct  94   TPKPNPLNPSSFSQNLILNAPKPQAQSTSDIPDGSQWRYSEFLNAVK  140



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 3/105 (3%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQAEAP  319
            R+F+ PQS+  N N +  K +SS   LAALLFSSIAPQA+ALDN  P AP P  I+ EA 
Sbjct  31   RKFIVPQSILNNKNSNKSKVVSSHGALAALLFSSIAPQALALDNTPPPAPAPQVIEIEAQ  90

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +   S +SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVK
Sbjct  91   K--TSQSSPFAQNLILNAPKPQAQSTSDLPEGSQWRYSEFLNAVK  133



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = +2

Query  140  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAA-PPTEIQAE  313
            R+ F  PQS L K  N D  K   S+A LAAL FSSI PQA ALDN TP A PP+ +QAE
Sbjct  38   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALFFSSITPQAFALDNTTPTAPPPSVVQAE  97

Query  314  APQPTASNASPFSQNVVLNAPKPQ-AQPASDLPEGSQWRYSEFLNAVK  454
             P+P   N SPFSQN++LNAPKPQ AQ +SD+P+GSQWRYSEFLNAVK
Sbjct  98   TPKPNPLNPSPFSQNLILNAPKPQAAQSSSDIPDGSQWRYSEFLNAVK  145



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNLKNIPSKAALAALLFSSITPHAFALDNTTPTVPTPQVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            EA  P+ SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVK
Sbjct  92   EAANPSTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVK  137



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPQVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVK
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVK  137



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  310
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPRVIQA  91

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVK
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVK  137



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  188  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  367
            DS K + S+ATLAALLFSS+ PQA+ALDN+T   PP  I+A+  +P+ASN+SPFSQN++L
Sbjct  57   DSLKSIPSQATLAALLFSSLTPQALALDNSTVPTPPPVIEAQPTKPSASNSSPFSQNLLL  116

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             APKPQ+Q  +DLPEG+QWRYSEFLNAVK
Sbjct  117  TAPKPQSQSTTDLPEGTQWRYSEFLNAVK  145



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = +2

Query  143  RRFLAPQSLTK----NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  310
            R+FL PQS+      NS   S K + SKATLAALLFSSI P+A+A+DN  P   P  IQA
Sbjct  29   RKFLVPQSILGGKKSNSISQSLKDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQA  88

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            EAPQP+ SN SPFSQN++LNAPKPQAQP++DLPEGSQWRYSEFLNAVK
Sbjct  89   EAPQPSPSNPSPFSQNLILNAPKPQAQPSTDLPEGSQWRYSEFLNAVK  136



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +2

Query  188  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  367
            DS K + ++ATLA LLFSS++PQA ALDN TP+ PP  ++A+  +P  SN+SPFSQN++L
Sbjct  62   DSLKSIQTQATLATLLFSSLSPQAFALDNPTPSPPPV-LEAQPTKPNPSNSSPFSQNLLL  120

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             APKPQ+Q  SDLPEG+QWRYSEFLNAVK
Sbjct  121  TAPKPQSQSTSDLPEGTQWRYSEFLNAVK  149



>gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=588

 Score =   115 bits (288),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>gb|KJB14313.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=600

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ  322
            R+   PQS+      +  K + + A  AA LFSS+AP A+ALDN +P AP   I+ EA +
Sbjct  27   RKLFVPQSILDGKCSNRSKCIQNHAAFAAFLFSSVAPNALALDNVSPPAPQV-IEIEAQK  85

Query  323  PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             T+S  SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVK
Sbjct  86   TTSS--SPFAQNLILNAPKPQAQSNSDLPEGSQWRYSEFLNAVK  127



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 6/107 (6%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            R+    QS+  N  P+S    K L S ATLAALLFS++APQA+A+DNA P  PP  I+A+
Sbjct  26   RKLQVTQSIL-NKKPNSSHTVKTLQSHATLAALLFSAVAPQALAVDNAPPTPPPV-IEAQ  83

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  84   PTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>ref|XP_007017988.1| FTSH protease 1 isoform 2 [Theobroma cacao]
 gb|EOY15213.1| FTSH protease 1 isoform 2 [Theobroma cacao]
Length=577

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +2

Query  191  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVK  132



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 9/114 (8%)
 Frame = +2

Query  137  SRRRFLAPQSLTKN---SNPDSFKGLSSKATLAALLFSSIA---PQAIALDNA--TPAAP  292
            ++R+FL  +S  K    SN ++ + + S+ATLAAL+FSSIA   P A+A+DN   TP+ P
Sbjct  38   TKRKFLITKSTLKRNPISNSNTLRNIPSQATLAALIFSSIAQNPPAALAIDNNINTPSPP  97

Query  293  PTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P  I+AEA +   S +SPFSQN++L APKPQAQ  SDLPEGSQWRYSEFLNAVK
Sbjct  98   PA-IEAEATKANPSASSPFSQNLLLTAPKPQAQSTSDLPEGSQWRYSEFLNAVK  150



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 2/88 (2%)
 Frame = +2

Query  191  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVK  132



>gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Erythranthe guttata]
Length=534

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 17/114 (15%)
 Frame = +2

Query  143  RRFLAPQSL----------TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP  292
            RRFL PQS+          TK++N +    +++ A LAALLFSSI PQA ALDN+ P AP
Sbjct  35   RRFLLPQSILNRRIISDKSTKSNNNN----ITNHAALAALLFSSITPQAFALDNSPPPAP  90

Query  293  PTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
               I+ EA +  A  +SP +QN+VLNAPKPQAQ  SDLPEGSQWRYSEFLNAVK
Sbjct  91   QV-IEIEAQK--AVQSSPVAQNLVLNAPKPQAQSNSDLPEGSQWRYSEFLNAVK  141



>emb|CDP03477.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 82/103 (80%), Gaps = 1/103 (1%)
 Frame = +2

Query  149  FLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQP  325
            FL+P +  T  S P  F  + SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP
Sbjct  15   FLSPPTPKTTKSLPRKFLDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQP  74

Query  326  TASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            + SN SPFSQN++LNAP+PQAQP++DLPEGSQWRYSEFLNAVK
Sbjct  75   SPSNPSPFSQNLILNAPQPQAQPSTDLPEGSQWRYSEFLNAVK  117



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 4/106 (4%)
 Frame = +2

Query  143  RRFLAPQSLTKN--SNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            R+    QS+  N  ++  +F+ L S ATLAAL FSS+ PQA+A+DNA P  PP  I+A+ 
Sbjct  26   RKLQVTQSILNNKPNSNHTFRALQSHATLAALYFSSVTPQALAVDNAPPTPPPV-IEAQP  84

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              P+  N SPFSQ+++L APKPQ+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  85   TNPSPLNQSPFSQDLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVK  129



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 5/108 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  310
            S+R+  A +++  NS PDS   K  +S+ATLAALLFSS+ PQA+A+DN     PP  +Q 
Sbjct  44   SKRKLFATKNIF-NSQPDSEPLKSAASQATLAALLFSSLTPQALAIDNTPTPTPPPVLQP  102

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +  +  A  ASPFSQN++LNAPKPQ+Q A+DLPEGSQWRYSEFLNAVK
Sbjct  103  QPSKSNA--ASPFSQNLLLNAPKPQSQVATDLPEGSQWRYSEFLNAVK  148



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 7/107 (7%)
 Frame = +2

Query  143  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNA---TPAAPPTEIQAE  313
            R FL PQ++    N    K +++ A LAALLFSS+ PQA+ALD+     PAA   EI+A+
Sbjct  31   RSFLVPQAILNRKNSSKSKNVANHAALAALLFSSVTPQALALDSTPPPAPAAQVIEIEAQ  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             P P+    SPF+QN++LNAPKPQ+QP SDLPEGSQWRYSEFLNAVK
Sbjct  91   RPGPS----SPFAQNLILNAPKPQSQPTSDLPEGSQWRYSEFLNAVK  133



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  307
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  308  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVK
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVK  151



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 6/110 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  307
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  308  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVK
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVK  151



>emb|CDP18582.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  209  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  388
            SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP+ SN SPFSQN++LNAP+PQA
Sbjct  9    SKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQPSPSNPSPFSQNLILNAPQPQA  68

Query  389  QPASDLPEGSQWRYSEFLNAVK  454
            QP++DLPEGSQWRYSEFLNAVK
Sbjct  69   QPSTDLPEGSQWRYSEFLNAVK  90



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +2

Query  182  NPDSFKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQAEAPQPTASNASPFSQN  358
            N DS K ++S+ATLAALLFSS+  Q A+A+DN TP + P  +  EA QPT  N+SPFSQ 
Sbjct  52   NSDSIKSITSQATLAALLFSSLTTQPALAVDNVTPPSQPAPV-LEA-QPTKPNSSPFSQA  109

Query  359  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            + L APKPQ+Q A+DLPEGSQWRYSEFLNAVK
Sbjct  110  LNLTAPKPQSQAATDLPEGSQWRYSEFLNAVK  141



>gb|KJB57986.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=531

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  176  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  355
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  356  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVK
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVK  148



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  176  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  355
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  356  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVK
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVK  148



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVK  454
            Q+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVK  153



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  319
            R+ FL    L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+A 
Sbjct  41   RKSFLTRSVLSEKPNFEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQAV  100

Query  320  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVK
Sbjct  101  SPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVK  145



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVK  454
            Q+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVK  153



>gb|KDO85047.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=606

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  382
            ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L APKP
Sbjct  71   VTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKP  130

Query  383  QAQPASDLPEGSQWRYSEFLNAVK  454
            Q+Q +SDLPEGSQWRYSEFLNAVK
Sbjct  131  QSQ-SSDLPEGSQWRYSEFLNAVK  153



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  137  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  313
            S+R+ +  QS L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+
Sbjct  39   SKRKSVLTQSVLSEKPNSEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQ  98

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A  P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVK
Sbjct  99   AVSPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVK  145



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +2

Query  137  SRRRFLAPQSLT----KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTE  301
            SRRR+   +S       +S+    K LSS+A LAALLFSS++P+A ALD  AT + PP  
Sbjct  38   SRRRYQITRSALGRKPNSSDAKPMKSLSSQAALAALLFSSVSPRASALDEPATVSPPPMV  97

Query  302  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            ++A+A +P+ + AS F QN+V+ APKPQAQ  SDLP+GSQWRYSEFLNAVK
Sbjct  98   VEAQAAKPSPT-ASSFGQNLVMTAPKPQAQ--SDLPDGSQWRYSEFLNAVK  145



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 5/106 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFEVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVK
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVK  136



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 81/106 (76%), Gaps = 5/106 (5%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  316
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFDVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVK
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVK  136



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  310
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPVKSAASQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYSEFLNAVK
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQVATDLPEGSQWRYSEFLNAVK  149



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  310
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPLKSATSQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYS+FLNAVK
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQAATDLPEGSQWRYSDFLNAVK  149



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 9/107 (8%)
 Frame = +2

Query  149  FLAPQSLTKNSNP---DSFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+ALDN      P   I+A 
Sbjct  33   FLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALALDNPALPPTPPPVIEAL  92

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVK
Sbjct  93   PTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVK  135



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 9/107 (8%)
 Frame = +2

Query  149  FLAPQSLTKNSNP---DSFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+A+DN  P   P   I+A 
Sbjct  33   FLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALAIDNPAPPPTPPPVIEAL  92

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVK
Sbjct  93   PTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVK  135



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 5/108 (5%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNP--DSFKGLSSKATLAALLF-SSIAPQAIALDNATPAAPPTEIQA  310
            RR+  A +S+  N  P  +  K   SKA+LAALLF SSI PQA A D      PP  IQA
Sbjct  38   RRKLRATRSVLNNDVPNFERLKSAQSKASLAALLFASSIVPQAQAADAPNLPTPPPVIQA  97

Query  311  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +  +P+ S++SPF+QN++L APKP A  +SDLPEGSQWRYSEFL+AVK
Sbjct  98   QPTKPSPSDSSPFAQNLLLTAPKPSA--SSDLPEGSQWRYSEFLSAVK  143



>gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=656

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +2

Query  143  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE  313
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P  +  P  I+ E
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A +      SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVK
Sbjct  91   AQKSPLQ--SPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVK  135



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +2

Query  143  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE  313
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P  +  P  I+ E
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A +      SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVK
Sbjct  91   AQKSPLQ--SPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVK  135



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 9/107 (8%)
 Frame = +2

Query  149  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKKFQKIVNEKNYESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+++ A    QN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVK
Sbjct  92   PTRPSSTVA----QNLLLTAPKPQSQSTSDLPEGSQWRYSEFLNAVK  134



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 9/107 (8%)
 Frame = +2

Query  149  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  313
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKNFQKIVNEKNHESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
              +P+    S  +QN++L APKPQ+Q  SDLPEGS WRYSEFLNAVK
Sbjct  92   PTRPS----STLAQNLLLTAPKPQSQSTSDLPEGSXWRYSEFLNAVK  134



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 16/107 (15%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  313
            SRRR+ + + +         K L S+A LAALLFSS +PQA+A++    P AP   ++A+
Sbjct  40   SRRRYQSEKLM---------KSLPSQAALAALLFSSTSPQALAVNEPVQPPAPTVTVEAQ  90

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +P     N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVK
Sbjct  91   SP-----NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVK  131



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 76/112 (68%), Gaps = 8/112 (7%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSF---KGLSSKATLAALLFSSIAPQAIALD---NATPAAPPT  298
            S R+FL  +++  +  PDS      + +KATLA LLFSS+APQA+ALD          P 
Sbjct  31   STRKFLIARNVL-DKKPDSKPSKNSIQTKATLATLLFSSLAPQALALDAPNPPPQTTTPP  89

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +QA  P  + S++SPF QN++L APKP+++  SDLPEGSQWRYSEFL+AVK
Sbjct  90   VLQAR-PSQSESSSSPFGQNLLLTAPKPESRNVSDLPEGSQWRYSEFLSAVK  140



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 13/107 (12%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  313
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVK
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVK  134



>dbj|BAH56755.1| AT5G42270 [Arabidopsis thaliana]
Length=574

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 13/107 (12%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  313
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVK
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVK  134



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 67/107 (63%), Gaps = 9/107 (8%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  313
            SRRR    QS          K L S+A LAALLFSS +PQA+A++    P AP   I  E
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNEPVQPLAPAPTITVE  93

Query  314  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVK
Sbjct  94   A-QATNPNLS-FGQNVMMTAPNPQQAQSSDLPDGTQWRYSEFLNAVK  138



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 16/111 (14%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-----ATPAAPPTE  301
            SRRR    QS          K L S+A LAALLFSS +PQA+A++      A   AP   
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSASPQALAVNEPVQPQAPVPAPTMT  93

Query  302  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            ++A+A  P  S    F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVK
Sbjct  94   VEAQATSPNLS----FGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVK  139



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 68/109 (62%), Gaps = 13/109 (12%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNAT--PA-APPTEIQ  307
            SRRR+   QS          K L S+A LAA+LFSS + QA+A++     PA AP   ++
Sbjct  40   SRRRYQISQS------EKLMKSLPSQAALAAVLFSSSSLQALAVNEPVQPPAPAPTIAVE  93

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A+A  P  S    F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVK
Sbjct  94   AQATNPNLS----FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVK  138



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  391
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  392  PASDLPEGSQWRYSEFLNAVK  454
             ++DLP+GSQWRYSEFLNAVK
Sbjct  116  SSTDLPDGSQWRYSEFLNAVK  136



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = +2

Query  167  LTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTA  331
            +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ 
Sbjct  32   ITRSSLDDKPIKSLPSRAALAAILFSSSISSQSPKALALDEPLTPTQPIVIEAQSLSPSP  91

Query  332  SNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            S+ SPF+QN V+ AP P+AQ +SDLP+GSQWRYSEFLNAVK
Sbjct  92   SSLSPFAQNQVITAPNPKAQSSSDLPDGSQWRYSEFLNAVK  132



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQ  391
            A ++AL+ SS+  P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKPQ+Q
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKPQSQ  115

Query  392  PASDLPEGSQWRYSEFLNAVK  454
             ++DLP+GSQWRYSEFLNAVK
Sbjct  116  SSTDLPDGSQWRYSEFLNAVK  136



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 5/98 (5%)
 Frame = +2

Query  173  KNSNPDSFKGLSSKATLAALLFSSIAPQ---AIALDNATPAAPPTEIQAEAPQPTASNAS  343
            +  N    K L S+  LAA+LFSSI+     A+ALD    A     ++A+A +P+ S  S
Sbjct  55   EEDNGKPIKSLPSRVALAAILFSSISSSPRGALALDEPIAATQTVVVEAQAVKPSTS-PS  113

Query  344  PFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVK  454
            PFS+   + AP P+AQ +S DLPEG+QWRYSEFLNAVK
Sbjct  114  PFSETQTITAPNPKAQSSSSDLPEGTQWRYSEFLNAVK  151



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 73/106 (69%), Gaps = 13/106 (12%)
 Frame = +2

Query  149  FLAPQSLTKNSNPDSFKGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  316
            FL  +S+ K  N +  K  SS+A LAAL+ SS    + P+A+A DN TP  PP  I+A+ 
Sbjct  30   FLFKRSILKAQNSEQVKSASSRAALAALIVSSASLSVTPEALAADNLTP--PPV-IEAQQ  86

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             QP+    SPFSQN++L APKPQ+  +SDLPEG+ WRYS+FLNAVK
Sbjct  87   SQPS----SPFSQNLLLTAPKPQS--SSDLPEGTNWRYSDFLNAVK  126



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 7/87 (8%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P P++   SDLPEGSQWRYSEFLNAVK
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVK  151



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 61/87 (70%), Gaps = 7/87 (8%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P P++   SDLPEGSQWRYSEFLNAVK
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVK  151



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = +2

Query  215  ATLAALLFSSI-APQAIALDNATPAAPPTEIQAEAPQPT-ASNASPFSQNVVLNAPKPQA  388
            A ++AL+ SS+  P A+A DN  P  PP  ++A+  Q   A++ SPFSQN+ L APKPQA
Sbjct  57   AAVSALILSSMFTPAALAADNLPPPPPPV-LEAQPNQLNPANSTSPFSQNISLTAPKPQA  115

Query  389  QPASDLPEGSQWRYSEFLNAVK  454
            Q ++DLP+GSQWRYSEFLNAVK
Sbjct  116  QSSTDLPDGSQWRYSEFLNAVK  137



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 8/87 (9%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA--PQAIALDNATPA-APPTEIQAEAPQPTASNASPFSQNVVLNA  373
            LSSK  LAA+LFSSI+  P+A+AL +  P+ +   E QA+A +P+ S    F QN +L A
Sbjct  69   LSSKVALAAILFSSISSSPRALALVDEPPSPSLVVEAQAQAVKPSTS--PLFIQNEILKA  126

Query  374  PKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P P++   SDLPEGSQWRYSEFLNAVK
Sbjct  127  PSPKS---SDLPEGSQWRYSEFLNAVK  150



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 8/88 (9%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLN  370
             SS+  LAA+LFSSI+   P+A+A+ +  PA+P   ++A+A     S +SP F QN +L 
Sbjct  65   FSSQVALAAILFSSISSSPPRALAVVD-EPASPSVVVEAQAQAVKPSTSSPLFIQNEILK  123

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            AP P++   SDLPEGSQWRYSEFLNAVK
Sbjct  124  APSPKS---SDLPEGSQWRYSEFLNAVK  148



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%), Gaps = 10/88 (11%)
 Frame = +2

Query  206  SSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEAPQ-PTASNASPFSQNVVLN  370
            +S+A LAAL+FSS    + PQA+A DN TP  PP  I+A+  Q   ++++SPFSQN++L 
Sbjct  42   NSQAALAALIFSSASLSVTPQALAADNVTP--PPV-IEAQQSQLNPSNSSSPFSQNLLLT  98

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            APKPQA  +SDLPEG+ WRYSEFLNAVK
Sbjct  99   APKPQA--SSDLPEGTNWRYSEFLNAVK  124



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = +2

Query  167  LTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTA  331
            +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ 
Sbjct  32   ITRSSVDDKPLKSLPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSP  91

Query  332  SNASPFSQNVVLNAPKPQAQ-PASDLPEGSQWRYSEFLNAVK  454
            S+ SPF+Q+ V+ AP P+AQ  +SDLP+GSQWRYSEFLNAVK
Sbjct  92   SSLSPFAQSQVITAPNPKAQSSSSDLPDGSQWRYSEFLNAVK  133



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = +2

Query  137  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSI--APQAIALDNATPAAPPTE--I  304
            SR++F+  QS   + N    K  S+ A   AL+ SS   + QA+A+DN  P        I
Sbjct  32   SRKKFVITQSFPNSQN---LKFPSNSALTTALILSSTLGSQQALAVDNLPPPQSQPPQVI  88

Query  305  QAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            +A+   P   N+SPFSQN++LNAPKP + P  DLPEG+QWRYSEFL AVK
Sbjct  89   EAQPNNPNLPNSSPFSQNLILNAPKP-SNP--DLPEGAQWRYSEFLTAVK  135



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 14/84 (17%)
 Frame = +2

Query  209  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ--PTASNASPFSQNVVLNAPKP  382
            S ATL+A       P A+A DN TP  PP  I+A+  Q  P+ S +SPFS N+ L APKP
Sbjct  68   SSATLSA------TPHALAADNVTP--PPV-IEAQQSQLNPSNSTSSPFSTNL-LTAPKP  117

Query  383  QAQPASDLPEGSQWRYSEFLNAVK  454
            QA  +SDLPEG+ WRYSEFLNAVK
Sbjct  118  QA--SSDLPEGTNWRYSEFLNAVK  139



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 8/68 (12%)
 Frame = +2

Query  251  PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRY  430
            PQA+A+D   P AP   ++A+A  P+A     F Q V++ AP PQ Q +SDLP+G+QWRY
Sbjct  76   PQALAIDE--PPAPVITVEAQAVNPSA-----FGQKVLMTAPNPQGQ-SSDLPDGTQWRY  127

Query  431  SEFLNAVK  454
            SEFLNAVK
Sbjct  128  SEFLNAVK  135



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ S+ SPF+Q+  + 
Sbjct  17   LPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSPSSLSPFAQSQSIT  76

Query  371  APKPQAQ-PASDLPEGSQWRYSEFLNAVK  454
            AP P+AQ  +SDLP+GSQWRYSEFLNAVK
Sbjct  77   APNPKAQSSSSDLPDGSQWRYSEFLNAVK  105



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 61/88 (69%), Gaps = 10/88 (11%)
 Frame = +2

Query  203  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
             SSK  LAA+LFSS++    P+A+A+ +  P +P   ++A+A +P+ S    F QN +L 
Sbjct  65   FSSKVALAAILFSSMSSSSPPRALAVVD-EPPSPSVVVEAQAVKPSTS--PLFIQNEILK  121

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            AP P++   SDLPEGSQWRYSEFLNAVK
Sbjct  122  APSPKS---SDLPEGSQWRYSEFLNAVK  146



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +2

Query  203  LSSKATLAALLFSSIAPQAIA--LDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  376
            L S+A LA LLFSS    AIA     A P AP   I  EA Q    +A+ F QNV+  AP
Sbjct  54   LPSQAALATLLFSS-PSLAIAEPYTVAQPPAPTDTITVEA-QAITPSATAFGQNVLQTAP  111

Query  377  KPQAQPASDLPEGSQWRYSEFLNAVK  454
             PQAQ + D+P+G+QWRYSEFLN+VK
Sbjct  112  NPQAQ-SPDIPDGTQWRYSEFLNSVK  136



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 10/109 (9%)
 Frame = +2

Query  140  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQ  307
            + RF   Q    ++N +  K     A ++AL+ SS    I P A+A DN TP  PP    
Sbjct  41   KTRFSNSQKSINDNNSEPLK----SAAVSALILSSMTLNITPVALAADNITPPPPPVLEA  96

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
                   ++++SPFSQN+ L APKPQ+  +SDLP+G+QWRYSEFLNAVK
Sbjct  97   QPNKLNPSNSSSPFSQNISLTAPKPQS--SSDLPDGNQWRYSEFLNAVK  143



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  317  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            PQ T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVK
Sbjct  96   PQATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVK  140



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSA-AASDLPEGAQWRYSEFLSAVK  115



>gb|AFW75732.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=378

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSAA-ASDLPEGAQWRYSEFLSAVK  115



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVK
Sbjct  22   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVK  75



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVK  144



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 43/59 (73%), Gaps = 6/59 (10%)
 Frame = +2

Query  281  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVK  144



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 5/59 (8%)
 Frame = +2

Query  281  PAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AVK
Sbjct  59   PPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAVK  113



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 5/59 (8%)
 Frame = +2

Query  281  PAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AVK
Sbjct  59   PPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAVK  113



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 5/59 (8%)
 Frame = +2

Query  281  PAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AVK
Sbjct  59   PPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAVK  113



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 56/88 (64%), Gaps = 9/88 (10%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQ-----AIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  370
            S  A +A+ L S++A Q     A+A  + +P      +Q E+    ++ +SPFSQ++ L 
Sbjct  70   SVNAAVASFLLSTLAQQQPLSPALAD-DLSPPPDSPPVQLESATKPSAPSSPFSQSL-LT  127

Query  371  APKPQAQPASDLPEGSQWRYSEFLNAVK  454
            APKPQ  P  DLPEGSQWRYSEFLNAVK
Sbjct  128  APKPQTSP--DLPEGSQWRYSEFLNAVK  153



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 6/52 (12%)
 Frame = +2

Query  299  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            E+QAEA  PTA+   PF+ N +L APKP A  A+DLPEG+QWRYSEFL+AVK
Sbjct  67   ELQAEATTPTAN---PFA-NSLLTAPKPSA--AADLPEGAQWRYSEFLSAVK  112



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = +2

Query  347  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             +QN VL APKPQA P  D+PEGSQWRYSEFLNAVK
Sbjct  95   LTQNNVLTAPKPQANP--DIPEGSQWRYSEFLNAVK  128



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 11/89 (12%)
 Frame = +2

Query  206  SSKATLAALLFSSIAPQ-----AIALDNATP-AAPPTEIQAEAPQPTASNASPFSQNVVL  367
            S  A +A+ L S++A Q     A+A D + P A+PP ++++       S+        +L
Sbjct  69   SVNAAVASFLLSTLAHQQPLAPALAEDLSPPPASPPIQMESATKPSPPSSPF---SQSLL  125

Query  368  NAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             APKPQ+ P  DLPEGSQWRYSEFLNAVK
Sbjct  126  TAPKPQSSP--DLPEGSQWRYSEFLNAVK  152



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 10/97 (10%)
 Frame = +2

Query  173  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE---APQPTASNAS  343
            KNSN +      S A  AA L SS+ P AIA D A    P +    +   A +P     +
Sbjct  46   KNSNDNRLTLSPSVAAAAAFLLSSLPPVAIAEDVAPVPPPTSPPAVQFDAASKPD----N  101

Query  344  PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            PF+Q++ L AP+PQ   +SDLPEGSQWRYSEFL+AVK
Sbjct  102  PFAQSL-LTAPRPQT--SSDLPEGSQWRYSEFLDAVK  135



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 4/49 (8%)
 Frame = +2

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            A  P P AS ++PFSQ++ L AP+PQA P  DL +GSQWRYSEFLNAVK
Sbjct  100  ASKPAPPAS-SNPFSQSL-LTAPRPQASP--DLLDGSQWRYSEFLNAVK  144



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 2/39 (5%)
 Frame = +2

Query  338  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            ASPF+ N +L+APKPQ+  + D+P+GSQWRYSEFLNAVK
Sbjct  107  ASPFA-NSLLSAPKPQSS-SPDIPDGSQWRYSEFLNAVK  143



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 8/49 (16%)
 Frame = +2

Query  308  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
            AEAP P A+   PF+ + +L AP    QP+SD+P+G QWRYSEFL AVK
Sbjct  68   AEAPTPAAN---PFA-DTLLTAP----QPSSDIPDGGQWRYSEFLGAVK  108



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  338  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVK  454
             SPFS   ++ AP  +A+   DLPEG+QWRYSEFLNAVK
Sbjct  23   GSPFS---LMEAPPVEARKKLDLPEGNQWRYSEFLNAVK  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105