BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033C20

Length=549
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       214   5e-63   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       213   2e-62   Nicotiana sylvestris
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       205   1e-59   Solanum tuberosum [potatoes]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    204   2e-59   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    204   4e-59   Nicotiana tomentosiformis
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            203   5e-59   Solanum lycopersicum
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  198   1e-58   Citrus sinensis [apfelsine]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             198   5e-57   Citrus clementina [clementine]
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    196   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    196   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            196   4e-56   Solanum lycopersicum
emb|CDP11780.1|  unnamed protein product                                195   6e-56   Coffea canephora [robusta coffee]
emb|CDP11782.1|  unnamed protein product                                196   6e-56   Coffea canephora [robusta coffee]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             190   7e-56   
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    194   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    194   1e-55   Pyrus x bretschneideri [bai li]
emb|CDY19294.1|  BnaC01g31860D                                          194   1e-55   Brassica napus [oilseed rape]
emb|CDY39494.1|  BnaA01g24940D                                          194   2e-55   Brassica napus [oilseed rape]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       188   7e-55   
emb|CDY19295.1|  BnaC01g31850D                                          187   1e-54   Brassica napus [oilseed rape]
ref|XP_003605914.1|  Transparent testa 12 protein                       192   1e-54   Medicago truncatula
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    192   1e-54   Arabis alpina [alpine rockcress]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   3e-54   Brassica rapa
emb|CDY38631.1|  BnaA05g19560D                                          191   3e-54   Brassica napus [oilseed rape]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       190   6e-54   Brassica rapa
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   1e-53   
emb|CDY69153.1|  BnaAnng29470D                                          184   1e-53   Brassica napus [oilseed rape]
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            188   1e-53   
ref|XP_007045634.1|  MATE efflux family protein isoform 2               187   1e-53   
emb|CBI28939.3|  unnamed protein product                                185   2e-53   Vitis vinifera
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            188   3e-53   Vitis vinifera
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    188   3e-53   Cicer arietinum [garbanzo]
emb|CBI28937.3|  unnamed protein product                                188   5e-53   Vitis vinifera
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   5e-53   
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            187   6e-53   Glycine max [soybeans]
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   9e-53   Cucumis sativus [cucumbers]
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            186   1e-52   Tarenaya hassleriana [spider flower]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   2e-52   Cucumis melo [Oriental melon]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               186   2e-52   
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   2e-52   Elaeis guineensis
emb|CAN69305.1|  hypothetical protein VITISV_021605                     181   2e-52   Vitis vinifera
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    185   3e-52   Arabis alpina [alpine rockcress]
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             184   3e-52   
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   3e-52   Elaeis guineensis
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   5e-52   Elaeis guineensis
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   7e-52   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                          184   8e-52   Brassica napus [oilseed rape]
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             184   1e-51   Eutrema salsugineum [saltwater cress]
emb|CDP17486.1|  unnamed protein product                                184   1e-51   Coffea canephora [robusta coffee]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   1e-51   Prunus mume [ume]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            184   1e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   1e-51   Cicer arietinum [garbanzo]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    183   2e-51   Vitis vinifera
ref|XP_002883313.1|  mate efflux family protein                         183   2e-51   
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            183   3e-51   Phoenix dactylifera
gb|KEH39009.1|  MATE efflux family protein                              182   3e-51   Medicago truncatula
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   3e-51   Elaeis guineensis
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            182   7e-51   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             182   7e-51   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   8e-51   Elaeis guineensis
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            181   9e-51   Glycine soja [wild soybean]
ref|XP_003596992.1|  Transparent testa 12 protein                       181   1e-50   Medicago truncatula
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            181   1e-50   Vitis vinifera
emb|CDY24250.1|  BnaC03g42230D                                          176   2e-50   Brassica napus [oilseed rape]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   3e-50   Camelina sativa [gold-of-pleasure]
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                   178   4e-50   Citrus sinensis [apfelsine]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             179   6e-50   Capsella rubella
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                   178   7e-50   Citrus sinensis [apfelsine]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   8e-50   Cicer arietinum [garbanzo]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       179   8e-50   Brassica rapa
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            179   9e-50   
dbj|BAJ34540.1|  unnamed protein product                                178   1e-49   Eutrema halophilum
emb|CDY65669.1|  BnaCnng48120D                                          178   1e-49   Brassica napus [oilseed rape]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            178   1e-49   Glycine soja [wild soybean]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   2e-49   Prunus mume [ume]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   2e-49   Elaeis guineensis
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   177   3e-49   Citrus sinensis [apfelsine]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             177   3e-49   
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             177   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-49   Glycine max [soybeans]
emb|CDX92916.1|  BnaA03g36380D                                          177   4e-49   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             177   4e-49   Citrus clementina [clementine]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       176   7e-49   Cucumis sativus [cucumbers]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   8e-49   Brassica rapa
emb|CDY39493.1|  BnaA01g24950D                                          176   9e-49   Brassica napus [oilseed rape]
gb|ACZ55931.1|  MATE transporter 2                                      176   1e-48   Zea mays [maize]
gb|ACF85423.1|  unknown                                                 176   1e-48   Zea mays [maize]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    175   2e-48   Arabis alpina [alpine rockcress]
tpg|DAA50098.1|  TPA: putative MATE efflux family protein               174   2e-48   
gb|AGT17221.1|  transparent testa 12 protein                            175   2e-48   Saccharum hybrid cultivar R570
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-48   Populus euphratica
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-48   
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-48   
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   2e-48   
gb|KGN43522.1|  Mate efflux family protein                              174   3e-48   Cucumis sativus [cucumbers]
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   3e-48   Cucumis melo [Oriental melon]
gb|ACZ55932.1|  MATE transporter 2                                      175   3e-48   Zea mays [maize]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   3e-48   
ref|NP_001149176.1|  transparent testa 12 protein                       174   4e-48   Zea mays [maize]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   5e-48   Citrus sinensis [apfelsine]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   5e-48   Setaria italica
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              174   5e-48   Gossypium arboreum [tree cotton]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             174   5e-48   Populus trichocarpa [western balsam poplar]
ref|NP_001148084.1|  transparent testa 12 protein                       174   6e-48   Zea mays [maize]
ref|NP_188806.1|  MATE efflux family protein                            173   9e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    173   1e-47   Gossypium raimondii
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             173   1e-47   Phaseolus vulgaris [French bean]
gb|AAM20595.1|  integral membrane protein, putative                     173   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             172   2e-47   
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               173   2e-47   
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            172   2e-47   Vitis vinifera
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   2e-47   
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-47   Populus euphratica
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-47   Cucumis melo [Oriental melon]
gb|KJB57729.1|  hypothetical protein B456_009G178100                    169   2e-47   Gossypium raimondii
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             172   2e-47   
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             172   3e-47   Prunus persica
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    172   3e-47   Zea mays [maize]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             171   5e-47   
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   6e-47   Fragaria vesca subsp. vesca
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   6e-47   Populus euphratica
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             171   6e-47   Citrus clementina [clementine]
emb|CDM85992.1|  unnamed protein product                                171   6e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   7e-47   Cicer arietinum [garbanzo]
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       171   7e-47   Cucumis sativus [cucumbers]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   8e-47   Sesamum indicum [beniseed]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   8e-47   Fragaria vesca subsp. vesca
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   9e-47   Populus euphratica
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-46   Eucalyptus grandis [rose gum]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   1e-46   Cucumis melo [Oriental melon]
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   1e-46   Citrus sinensis [apfelsine]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   1e-46   Cucumis sativus [cucumbers]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                         167   1e-46   Jatropha curcas
gb|KJB57730.1|  hypothetical protein B456_009G178100                    170   1e-46   Gossypium raimondii
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   1e-46   Populus euphratica
gb|KJB57728.1|  hypothetical protein B456_009G178100                    170   2e-46   Gossypium raimondii
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       170   2e-46   Cucumis sativus [cucumbers]
gb|ABF97220.1|  MATE efflux family protein, expressed                   169   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050524.1|  Os03g0572900                                       169   2e-46   
gb|EEC75610.1|  hypothetical protein OsI_12322                          169   2e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   3e-46   
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   3e-46   Prunus mume [ume]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   169   4e-46   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   4e-46   Citrus sinensis [apfelsine]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              169   4e-46   Gossypium arboreum [tree cotton]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       169   4e-46   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    168   6e-46   
gb|AAS01962.1|  putative MATE efflux family protein                     169   7e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                     167   7e-46   Eucalyptus grandis [rose gum]
gb|ABF97209.1|  MATE efflux family protein, expressed                   168   7e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   8e-46   Prunus mume [ume]
gb|EEC75606.1|  hypothetical protein OsI_12318                          168   8e-46   Oryza sativa Indica Group [Indian rice]
gb|KJB69294.1|  hypothetical protein B456_011G014800                    167   1e-45   Gossypium raimondii
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-45   Eucalyptus grandis [rose gum]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-45   Setaria italica
tpg|DAA50097.1|  TPA: putative MATE efflux family protein               159   2e-45   
gb|KJB69293.1|  hypothetical protein B456_011G014800                    167   2e-45   Gossypium raimondii
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             166   2e-45   
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   3e-45   Prunus mume [ume]
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-45   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   3e-45   
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                166   5e-45   Erythranthe guttata [common monkey flower]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   7e-45   Brachypodium distachyon [annual false brome]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   7e-45   Malus domestica [apple tree]
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   9e-45   
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           165   1e-44   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   1e-44   Nicotiana sylvestris
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-44   
gb|AHI48506.1|  multidrug and toxic extrusion transporter               165   1e-44   Vaccinium corymbosum [American blueberry]
gb|KDP20759.1|  hypothetical protein JCGZ_21230                         161   1e-44   Jatropha curcas
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                   158   1e-44   Citrus sinensis [apfelsine]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   1e-44   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             164   2e-44   Phaseolus vulgaris [French bean]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-44   Pyrus x bretschneideri [bai li]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    164   3e-44   Nicotiana sylvestris
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   3e-44   Solanum tuberosum [potatoes]
emb|CDM86677.1|  unnamed protein product                                164   3e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007026054.1|  MATE efflux family protein isoform 1               164   3e-44   
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    164   3e-44   
ref|XP_002518495.1|  multidrug resistance pump, putative                164   3e-44   Ricinus communis
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-44   Nicotiana tomentosiformis
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            163   4e-44   Triticum urartu
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   4e-44   
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            163   5e-44   
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            163   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   5e-44   Vitis vinifera
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   6e-44   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   6e-44   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         163   6e-44   Jatropha curcas
ref|XP_002518493.1|  multidrug resistance pump, putative                163   6e-44   Ricinus communis
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   6e-44   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   7e-44   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   7e-44   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         166   8e-44   Jatropha curcas
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-43   Populus euphratica
emb|CDM86696.1|  unnamed protein product                                162   1e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-43   Sesamum indicum [beniseed]
emb|CDM86692.1|  unnamed protein product                                162   2e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    161   2e-43   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    161   2e-43   Solanum tuberosum [potatoes]
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                161   3e-43   Erythranthe guttata [common monkey flower]
ref|XP_007026057.1|  MATE efflux family protein                         161   3e-43   
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   3e-43   Populus euphratica
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    160   4e-43   Nicotiana tomentosiformis
gb|EPS61219.1|  hypothetical protein M569_13580                         152   4e-43   Genlisea aurea
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-43   Solanum lycopersicum
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   4e-43   Populus euphratica
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   5e-43   Populus euphratica
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             160   5e-43   Populus trichocarpa [western balsam poplar]
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                160   6e-43   Erythranthe guttata [common monkey flower]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   6e-43   Nicotiana sylvestris
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   6e-43   Nicotiana tomentosiformis
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   7e-43   Solanum tuberosum [potatoes]
ref|XP_007026056.1|  MATE efflux family protein                         160   8e-43   
gb|ABK24492.1|  unknown                                                 160   9e-43   Picea sitchensis
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   9e-43   Nicotiana tomentosiformis
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-42   Solanum lycopersicum
gb|KDP20757.1|  hypothetical protein JCGZ_21228                         155   1e-42   Jatropha curcas
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-42   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   1e-42   Tarenaya hassleriana [spider flower]
emb|CDM86687.1|  unnamed protein product                                159   1e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006389638.1|  MATE efflux family protein                         159   2e-42   
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            159   2e-42   Glycine soja [wild soybean]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   2e-42   Zea mays [maize]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   2e-42   Glycine max [soybeans]
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                159   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          157   7e-42   Sorghum bicolor [broomcorn]
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       157   7e-42   Morus notabilis
gb|EPS67796.1|  hypothetical protein M569_06975                         157   8e-42   Genlisea aurea
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   1e-41   Populus euphratica
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   1e-41   Zea mays [maize]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-41   Solanum lycopersicum
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   2e-41   Populus euphratica
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   4e-41   
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   5e-41   Tarenaya hassleriana [spider flower]
gb|EMT19998.1|  hypothetical protein F775_52364                         158   5e-41   
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   6e-41   Tarenaya hassleriana [spider flower]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   9e-41   Solanum tuberosum [potatoes]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   1e-40   Populus euphratica
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   2e-40   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   2e-40   Nicotiana tomentosiformis
emb|CBI23252.3|  unnamed protein product                                149   2e-40   Vitis vinifera
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   3e-40   Oryza brachyantha
gb|ADE77677.1|  unknown                                                 153   3e-40   Picea sitchensis
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   4e-40   
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                152   5e-40   Erythranthe guttata [common monkey flower]
gb|KEH36840.1|  MATE efflux family protein                              152   7e-40   Medicago truncatula
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   9e-40   
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            150   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             150   2e-39   Populus trichocarpa [western balsam poplar]
tpg|DAA62913.1|  TPA: putative MATE efflux family protein               151   3e-39   
ref|NP_001147791.1|  transparent testa 12 protein                       150   3e-39   Zea mays [maize]
emb|CDY33130.1|  BnaCnng07010D                                          146   5e-39   Brassica napus [oilseed rape]
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   6e-39   Nicotiana sylvestris
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   2e-38   
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             147   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_002518492.1|  multidrug resistance pump, putative                147   3e-38   Ricinus communis
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   4e-38   
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial     142   5e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04391.1|  unnamed protein product                                147   5e-38   Coffea canephora [robusta coffee]
gb|EEC75604.1|  hypothetical protein OsI_12313                          146   7e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            146   7e-38   Vitis vinifera
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   9e-38   Sesamum indicum [beniseed]
ref|NP_001050520.1|  Os03g0570800                                       145   2e-37   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   3e-37   
emb|CDY64820.1|  BnaA08g31640D                                          144   5e-37   
emb|CDY64933.1|  BnaCnng45550D                                          144   6e-37   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   6e-37   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    143   8e-37   
tpg|DAA40987.1|  TPA: putative MATE efflux family protein               143   8e-37   
gb|AAK82541.1|  At1g61890/F8K4_9                                        143   1e-36   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   1e-36   
ref|NP_564787.1|  MATE efflux family protein                            143   1e-36   
ref|XP_002886501.1|  mate efflux family protein                         143   1e-36   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein               142   1e-36   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   1e-36   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    142   2e-36   
emb|CDY07256.1|  BnaC04g19150D                                          134   2e-36   
ref|XP_002892653.1|  mate efflux family protein                         142   2e-36   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   2e-36   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   2e-36   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             142   2e-36   
gb|AAM98160.1|  unknown protein                                         142   3e-36   
ref|NP_172632.1|  MATE efflux family protein                            142   3e-36   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          141   3e-36   
gb|EAY90719.1|  hypothetical protein OsI_12317                          140   3e-36   
emb|CDY25329.1|  BnaC01g29980D                                          141   4e-36   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      141   4e-36   
emb|CDY47166.1|  BnaA01g22920D                                          141   4e-36   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   4e-36   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    141   4e-36   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               141   5e-36   
gb|AGT17223.1|  MATE efflux family protein                              141   5e-36   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            141   5e-36   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   7e-36   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   7e-36   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   7e-36   
emb|CDY34637.1|  BnaC08g41960D                                          140   8e-36   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   1e-35   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             140   1e-35   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    139   2e-35   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg             139   2e-35   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                            139   3e-35   
emb|CDY34833.1|  BnaA09g47590D                                          138   3e-35   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             139   4e-35   
emb|CDY19507.1|  BnaC09g13960D                                          138   5e-35   
emb|CDY12916.1|  BnaA09g13580D                                          138   5e-35   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   5e-35   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          138   6e-35   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             138   7e-35   
dbj|BAJ90668.1|  predicted protein                                      137   2e-34   
ref|NP_001142368.1|  uncharacterized protein LOC100274540               136   2e-34   
emb|CDX94061.1|  BnaC07g36950D                                          133   4e-33   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     132   5e-33   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          132   7e-33   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            132   8e-33   
emb|CDX94063.1|  BnaC07g36970D                                          131   2e-32   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             131   2e-32   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   3e-32   
emb|CDX98712.1|  BnaA03g44970D                                          130   4e-32   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       129   6e-32   
emb|CDX98711.1|  BnaA03g44960D                                          129   7e-32   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       129   8e-32   
gb|AGT17222.1|  MATE efflux family protein                              129   1e-31   
emb|CDX76391.1|  BnaA08g10090D                                          128   1e-31   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       128   2e-31   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       128   2e-31   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    127   3e-31   
emb|CDY27434.1|  BnaC03g64740D                                          127   4e-31   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    127   4e-31   
emb|CDX98713.1|  BnaA03g44980D                                          126   6e-31   
emb|CDP11781.1|  unnamed protein product                                126   7e-31   
ref|XP_002867814.1|  mate efflux family protein                         125   2e-30   
emb|CAA17158.1|  putative protein                                       125   2e-30   
emb|CDX79109.1|  BnaA01g11760D                                          125   3e-30   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             125   3e-30   
ref|XP_002867813.1|  mate efflux family protein                         124   3e-30   
dbj|BAH19969.1|  AT4G21910                                              124   4e-30   
ref|NP_974587.1|  MATE efflux family protein                            124   4e-30   
emb|CDY27431.1|  BnaC03g64710D                                          124   4e-30   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             124   5e-30   
ref|NP_001190793.1|  MATE efflux family protein                         125   5e-30   
ref|XP_008646561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   9e-30   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   9e-30   
emb|CBI28938.3|  unnamed protein product                                123   1e-29   
emb|CDX76392.1|  BnaA08g10080D                                          123   1e-29   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             121   5e-29   
ref|NP_567640.1|  MATE efflux family protein                            120   1e-28   
gb|AAM62936.1|  unknown                                                 120   2e-28   
dbj|BAC56017.1|  putative ripening regulated protein DDTFR18            119   2e-28   
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                            113   2e-28   
ref|NP_001059785.1|  Os07g0516600                                       119   2e-28   
gb|EEC82143.1|  hypothetical protein OsI_26198                          119   2e-28   
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            119   3e-28   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   4e-28   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   1e-27   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             117   1e-27   
emb|CBI23254.3|  unnamed protein product                                115   5e-27   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   6e-27   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            114   1e-26   
ref|XP_006858200.1|  hypothetical protein AMTR_s00062p00173640          107   3e-26   
emb|CBI23251.3|  unnamed protein product                                112   4e-26   
gb|EMT26283.1|  Protein TRANSPARENT TESTA 12                            106   5e-26   
emb|CDP20703.1|  unnamed protein product                                111   9e-26   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg             112   2e-25   
emb|CDP04390.1|  unnamed protein product                                111   2e-25   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg             111   3e-25   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                          110   4e-25   
gb|ABR18290.1|  unknown                                                 104   4e-25   
gb|KJB64207.1|  hypothetical protein B456_010G037100                    110   5e-25   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401             110   6e-25   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                    110   7e-25   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12            110   9e-25   
emb|CDX67772.1|  BnaA07g18120D                                          109   9e-25   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                   108   1e-24   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                       109   1e-24   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   1e-24   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg             108   1e-24   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   1e-24   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   2e-24   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12            108   2e-24   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                   108   3e-24   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                   108   3e-24   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg             108   3e-24   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                   107   3e-24   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg             107   3e-24   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12            108   3e-24   
gb|ACJ36211.1|  transparent testa 12 isoform 2                          108   3e-24   
gb|ACJ36215.1|  transparent testa 12                                    108   3e-24   
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   3e-24   
ref|XP_004491273.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   4e-24   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                   107   4e-24   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   5e-24   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein              107   5e-24   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   6e-24   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880          107   6e-24   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   7e-24   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   7e-24   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   7e-24   
gb|ACG29464.1|  hypothetical protein                                    101   9e-24   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   9e-24   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    105   9e-24   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   1e-23   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   1e-23   
emb|CDP01534.1|  unnamed protein product                                106   1e-23   
ref|NP_001119025.1|  mate efflux domain-containing protein              106   2e-23   
ref|NP_001190792.1|  mate efflux domain-containing protein              106   2e-23   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-23   
emb|CBI19217.3|  unnamed protein product                                106   3e-23   
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   3e-23   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            107   3e-23   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   3e-23   
gb|AHH83753.1|  multidrug and toxic extrusion transporter               105   3e-23   
gb|AAL06936.1|  AT5g38030/F16F17_30                                     103   3e-23   
gb|EEC74654.1|  hypothetical protein OsI_10313                          105   3e-23   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg            101   3e-23   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   3e-23   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          105   4e-23   
gb|AIW42903.1|  transparent testa 12                                    105   4e-23   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   4e-23   
gb|ACJ36209.1|  transparent testa 12 isoform 1                          105   4e-23   
ref|XP_002516716.1|  multidrug resistance pump, putative                103   5e-23   
emb|CDP11775.1|  unnamed protein product                                103   5e-23   
gb|KDP29740.1|  hypothetical protein JCGZ_18675                         105   6e-23   
ref|XP_010439174.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   6e-23   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                         104   6e-23   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   7e-23   
ref|XP_004299688.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   8e-23   
gb|ACU15197.1|  unknown                                                 100   8e-23   
ref|XP_009117173.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       100   8e-23   
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   9e-23   
ref|XP_007018128.1|  MATE efflux family protein isoform 2               103   9e-23   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   9e-23   
ref|XP_010999529.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   9e-23   
ref|XP_010045479.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   1e-22   
gb|ACX37118.1|  MATE transporter                                        103   1e-22   
ref|XP_009789598.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   1e-22   
ref|XP_007018127.1|  MATE efflux family protein isoform 1               103   1e-22   
ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   
ref|XP_006466279.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   
gb|KDO45799.1|  hypothetical protein CISIN_1g0118571mg                  102   1e-22   
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_009359346.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_003545155.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
gb|AET00276.2|  MATE efflux family protein                              104   2e-22   
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                   102   2e-22   
ref|XP_009588590.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   2e-22   
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                   102   2e-22   
ref|XP_010646476.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   2e-22   
ref|XP_003617317.1|  Protein TRANSPARENT TESTA                          104   2e-22   
gb|EEE59382.1|  hypothetical protein OsJ_11498                        98.6    2e-22   
ref|XP_008219413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
gb|AIW42905.1|  transparent testa 12                                    103   2e-22   
ref|XP_010524117.1|  PREDICTED: protein TRANSPARENT TESTA 12            103   2e-22   
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg             103   2e-22   
ref|XP_002302325.2|  hypothetical protein POPTR_0002s10240g             103   2e-22   
ref|XP_006357608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_009629826.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_009596939.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   2e-22   
ref|XP_006852302.1|  hypothetical protein AMTR_s00049p00190590          101   2e-22   
gb|KDO81079.1|  hypothetical protein CISIN_1g011186mg                   102   2e-22   
ref|XP_006472534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   3e-22   
gb|AAR00637.1|  hypothetical protein                                  97.4    3e-22   
ref|XP_002868811.1|  mate efflux family protein                         103   3e-22   
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                   102   3e-22   
ref|XP_006574630.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    100   3e-22   
ref|NP_198619.1|  MATE efflux family protein                            102   3e-22   
ref|XP_009765840.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   3e-22   
ref|XP_006433900.1|  hypothetical protein CICLE_v10000950mg             102   3e-22   
ref|XP_004252047.1|  PREDICTED: protein TRANSPARENT TESTA 12            102   3e-22   
gb|KJB44125.1|  hypothetical protein B456_007G235800                    102   3e-22   
ref|XP_010502591.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    102   3e-22   
ref|XP_009412505.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   3e-22   
ref|XP_009393552.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   4e-22   
ref|XP_011468003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   4e-22   
ref|XP_003613099.1|  Protein TRANSPARENT TESTA                          102   4e-22   
ref|XP_009777197.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    102   4e-22   
ref|XP_004308030.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   4e-22   
ref|XP_009777196.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    102   4e-22   
ref|XP_006290950.1|  hypothetical protein CARUB_v10017066mg             102   4e-22   
gb|KDO60633.1|  hypothetical protein CISIN_1g011035mg                   102   4e-22   
ref|XP_006442840.1|  hypothetical protein CICLE_v10024205mg             102   5e-22   
ref|XP_003517712.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       102   5e-22   
dbj|BAE98722.1|  hypothetical protein                                 98.6    5e-22   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRS  500
            VETLCGQAFGA K+++LG+YLQRS
Sbjct  121  VETLCGQAFGAKKFDMLGVYLQRS  144



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRS  500
            VETLCGQAFGA KY++LG+YLQRS
Sbjct  121  VETLCGQAFGAKKYDMLGVYLQRS  144



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRS  500
            ETLCGQAFGA KY++LG+YLQRS
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRS  143



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRS  500
            VETLCGQA+GA KY++LG+YLQRS
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRS  144



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRS  500
            VETLCGQA+GA KY++LG+YLQRS
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRS  144



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRS  500
            ETLCGQAFGA KY++LG+YLQRS
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRS  143



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 128/164 (78%), Gaps = 8/164 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S         P    V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQSHP-------PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            MGSAVETLCGQA+GA KYE+LGIYLQRS  LLTLTG+L+ ++YV
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYV  168



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 8/164 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            MGSAVETLCGQA+GA KYE+LGIYLQRS  LLTLTG+L+ ++YV
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYV  168



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 4/160 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            VETLCGQ++GAGKYE+LGIYLQRST LL  TG+ LA+IY+
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYI  160



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 128/160 (80%), Gaps = 4/160 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            VETLCGQ++GAGKYE+LGIYLQRST LL  TG+ LA+IY+
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYI  160



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 125/150 (83%), Gaps = 5/150 (3%)
 Frame = +3

Query  114  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGH+GNLELAAASLGNTGIQIF YGLMLGMGSAVETLCGQA+G
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAASLGNTGIQIFVYGLMLGMGSAVETLCGQAYG  120

Query  459  AGKYELLGIYLQRStxlltltgvllalIYV  548
            A KY++LG+YLQRST LL LTGVLL  +YV
Sbjct  121  ARKYDMLGVYLQRSTILLVLTGVLLTFVYV  150



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 125/156 (80%), Gaps = 9/156 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA KYE+LG+YLQRST LL+LTGVLLA+IYV
Sbjct  112  CGQAFGAKKYEMLGVYLQRSTILLSLTGVLLAIIYV  147



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 124/156 (79%), Gaps = 9/156 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQRST LL+LTGVLL +IYV
Sbjct  112  CGQAFGAKKFEMLGIYLQRSTILLSLTGVLLTIIYV  147



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   190 bits (483),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            MINYLMSMSTQIFSG LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA KY
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAASLGNTGIQLFAYGLMLGMGSAVETLCGQAFGAHKY  135

Query  471  ELLGIYLQRS  500
             +LG+YLQRS
Sbjct  136  GMLGLYLQRS  145



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GMGSAVETLCGQA+GA KYE+LGIYLQRS  LL   GVLL +IYV
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYV  162



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GMGSAVETLCGQA+GA KYE+LGIYLQRS  LL   GVLL +IYV
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYV  162



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFG  KYE+LGIYLQRST LLTLTGVLL LIYV
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYV  158



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 125/156 (80%), Gaps = 3/156 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFG  KYE+LGIYLQRST LLTLTGVLL LIYV
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYV  158



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   188 bits (477),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRS  500
             KYE+LGIYLQRS
Sbjct  132  QKYEMLGIYLQRS  144



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 124/159 (78%), Gaps = 4/159 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAASLGNTGI+ FAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAASLGNTGIKTFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            ETLCGQAFG  KYE+LGIYL+RST LLTL GVLL LIYV
Sbjct  120  ETLCGQAFGGRKYEMLGIYLRRSTVLLTLAGVLLTLIYV  158



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY+MSMSTQIFS
Sbjct  35   SKHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINYVMSMSTQIFS  94

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQAFGA KYE+LGIYLQRST LL
Sbjct  95   GHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAFGAKKYEMLGIYLQRSTVLL  154

Query  513  tltgvllalIYV  548
            T+ G++L +IY+
Sbjct  155  TIAGLILTIIYI  166



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 126/160 (79%), Gaps = 4/160 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            VETLCGQA+G  KYE+LGIYLQRST LLTLTGV L LIYV
Sbjct  121  VETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGVFLTLIYV  160



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRS  500
            ETLCGQAFG  KYE+LGIYLQRS
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRS  142



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRS  500
            ETLCGQAFG  KYE+LGIYLQRS
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRS  142



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 124/156 (79%), Gaps = 3/156 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFG  KYE+LGIYLQRST LLTLTGVLL LIYV
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYV  158



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 115/141 (82%), Gaps = 5/141 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQA+G  KYE+LG+YLQRS
Sbjct  117  LCGQAYGGKKYEMLGVYLQRS  137



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 115/143 (80%), Gaps = 5/143 (3%)
 Frame = +3

Query  75   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAV
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAV  125

Query  432  ETLCGQAFGAGKYELLGIYLQRS  500
            ETLCGQA+G  KYE+LGIYLQRS
Sbjct  126  ETLCGQAYGGRKYEMLGIYLQRS  148



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LGIYLQRS  LLTLTGV L  IYV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYV  152



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL+LGMGSAVETLCGQA GA
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLLGMGSAVETLCGQAHGA  133

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KY++LGIYLQRST LL   GVLL +IYV
Sbjct  134  QKYKMLGIYLQRSTVLLFFPGVLLTIIYV  162



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQAFGA KY++LGIYLQRS
Sbjct  116  LCGQAFGAHKYDMLGIYLQRS  136



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGM
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGM  121

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GSAVETLCGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  122  GSAVETLCGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  164



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  154



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA ASLGNTGIQIFAYGLMLGMGSAVET
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGASLGNTGIQIFAYGLMLGMGSAVET  120

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFGA KY++LGIYLQ+S+ LLTL G++L LIY+
Sbjct  121  LCGQAFGAKKYDMLGIYLQKSSVLLTLAGLILTLIYI  157



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  154

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  155  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  190



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRS  500
             KYE+LGIYLQRS
Sbjct  132  QKYEMLGIYLQRS  144



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VY+INYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  63   VIVYLINYLMSMSTQIFSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  122

Query  459  AGKYELLGIYLQRStxlltltgvllalIYV  548
            A KY +LG+Y+QRST LL+L GV+L +IYV
Sbjct  123  AQKYGMLGVYMQRSTILLSLAGVVLTVIYV  152



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRStxlltltgvllalIYV  548
            QRS+ LLTLTG +L LIY+
Sbjct  139  QRSSILLTLTGFVLTLIYI  157



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 122/156 (78%), Gaps = 8/156 (5%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  260
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETL  115

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQA+GAGK+E+LG+YLQRST LLTLTGV+L +IYV
Sbjct  116  CGQAYGAGKFEMLGVYLQRSTVLLTLTGVILTVIYV  151



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRS  500
            QRS
Sbjct  139  QRS  141



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQAFGA KY++LGIYLQRS
Sbjct  116  LCGQAFGAHKYDMLGIYLQRS  136



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKL  230
            P  L+  ++  ++     PLP S  + +    PH    +   LESIL +T +P  +RL+L
Sbjct  8    PQKLSTPLLAPADDE--HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRL  62

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLM
Sbjct  63   ATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLM  122

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  123  LGMGSAVETLCGQAYGAHKYEMLGVYLQRS  152



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  154



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 122/157 (78%), Gaps = 3/157 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  118

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG GKYE+LGIYLQRST LL+LTGVLL +IYV
Sbjct  119  LCGQAFGGGKYEMLGIYLQRSTVLLSLTGVLLTVIYV  155



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            SAVETLCGQAFG  KYE+LG+YLQRST LLTLTGVLL LIYV
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYV  162



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 117/150 (78%), Gaps = 7/150 (5%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKL  230
            P  L+  ++  ++     PLP S  + +    PH    +   LESIL +T +P  +RL+L
Sbjct  8    PQKLSTPLLAPADDE--HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRL  62

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLM
Sbjct  63   ATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLM  122

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  123  LGMGSAVETLCGQAYGAHKYEMLGVYLQRS  152



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRL  224
            P   P  L+  ++  S+     PLP S   ++    +   +S  LE IL DT IP  +RL
Sbjct  3    PVASPEKLSTPLLVPSDDD--QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRL  60

Query  225  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  404
             LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYG
Sbjct  61   PLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAASSLGNNGIQVFAYG  120

Query  405  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LMLGMGSAVETLCGQAFGA K+E+LGIYLQRS
Sbjct  121  LMLGMGSAVETLCGQAFGANKHEMLGIYLQRS  152



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LGIYLQRS  LLTLTGV L  IYV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYV  152



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LGIYLQRS  LLTLTGV L  IYV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYV  152



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 127/162 (78%), Gaps = 6/162 (4%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            SAVETLCGQAFG  KYE+LG+YLQRST LLTLTGVLL LIYV
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYV  162



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 3/159 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAASLGN G+Q FAYGLMLGMGSAV
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAASLGNNGVQTFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            ETLCGQA+GA +Y +LGIYLQRS  LLTLTGV L +IY+
Sbjct  121  ETLCGQAYGAHRYGMLGIYLQRSAILLTLTGVSLTIIYI  159



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 110/137 (80%), Gaps = 4/137 (3%)
 Frame = +3

Query  102  AYDPLP----ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            +Y P P    + D +     H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA
Sbjct  15   SYPPPPTLTTKHDDLPDLHLHHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLA  74

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
            +PAV+VYMINY+M+MSTQIF+GHLGNLELAAASLGN GIQ+FAYG+MLGMGSAVETLCGQ
Sbjct  75   SPAVIVYMINYVMAMSTQIFAGHLGNLELAAASLGNNGIQVFAYGVMLGMGSAVETLCGQ  134

Query  450  AFGAGKYELLGIYLQRS  500
            A+GA KYE+LGIYLQRS
Sbjct  135  AYGAHKYEMLGIYLQRS  151



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFSG
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFSG  88

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxllt  515
            HLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY +LGIYLQRST +L 
Sbjct  89   HLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYGMLGIYLQRSTVILM  148

Query  516  ltgvllalIYV  548
             TG+LL +IY+
Sbjct  149  ATGILLMVIYI  159



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  144  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  323
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  324  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRSt  503
            IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K+E+LG YLQRST
Sbjct  76   IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAEKFEMLGTYLQRST  135

Query  504  xlltltgvllalIYV  548
             LLT+ G+ L +IYV
Sbjct  136  ILLTIAGLFLTVIYV  150



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  154



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 125/157 (80%), Gaps = 5/157 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQA+G  KY++LG+YLQRST LLTLTG+LL LIYV
Sbjct  117  LCGQAYGGRKYDMLGVYLQRSTVLLTLTGLLLTLIYV  153



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQ  218
            P   P  L   ++  S+     PLP S  + +    PH    +S  LESIL DT +   +
Sbjct  3    PAASPEKLRTPLLGPSDDD--QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWAR  57

Query  219  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFA  398
            RL+LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FA
Sbjct  58   RLQLATIIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFA  117

Query  399  YGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            YGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  118  YGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  151



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 114/137 (83%), Gaps = 2/137 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StxlltltgvllalIYV  548
            ST LLT+TG  L +IYV
Sbjct  138  STILLTITGFFLTIIYV  154



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  64   HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRS  118



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+VY
Sbjct  23   PLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVY  82

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            M+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY
Sbjct  83   MLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKY  142

Query  471  ELLGIYLQRStxlltltgvllalIYV  548
             +LGIYLQRST LL  TGV LA+IYV
Sbjct  143  GMLGIYLQRSTILLMATGVPLAVIYV  168



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +3

Query  87   SSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            + N     PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +L
Sbjct  15   TGNDDVDQPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFL  74

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG
Sbjct  75   AAPAVMVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  134

Query  447  QAFGAGKYELLGIYLQRS  500
            QA+GA KYE+LGIY+QRS
Sbjct  135  QAYGAHKYEMLGIYMQRS  152



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = +3

Query  81   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  227
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  228  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL  407
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGL  120

Query  408  MLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            MLGMGSAVETLCGQA+GA KYE+LG+YLQR+  LLT TG LL L+YV
Sbjct  121  MLGMGSAVETLCGQAYGAHKYEMLGVYLQRAAVLLTATGFLLTLVYV  167



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +3

Query  102  AYDPLP----ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            +Y P P    + D +     H +  +SNELE +L DT  P  +RLK A WIE KLL YLA
Sbjct  15   SYPPPPTLTTKHDDLPDLHLHHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLA  74

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
            APAV+VYMINY+MSMSTQIF+GHLGNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQ
Sbjct  75   APAVIVYMINYVMSMSTQIFAGHLGNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQ  134

Query  450  AFGAGKYELLGIYLQRS  500
            A+GA KYE+LGIYLQRS
Sbjct  135  AYGAHKYEMLGIYLQRS  151



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 107/133 (80%), Gaps = 7/133 (5%)
 Frame = +3

Query  111  PLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PAV
Sbjct  23   PLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPAV  78

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
             VYM+NY+MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQA+GA
Sbjct  79   TVYMLNYVMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAYGA  138

Query  462  GKYELLGIYLQRS  500
             KYE+LGIYLQRS
Sbjct  139  HKYEMLGIYLQRS  151



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKK  137

Query  468  YELLGIYLQRStxlltltgvllalIYV  548
            +++LGIYLQRST LLTL G++L +IY+
Sbjct  138  FDMLGIYLQRSTVLLTLAGIILTIIYI  164



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 114/137 (83%), Gaps = 2/137 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StxlltltgvllalIYV  548
            ST LLT+TG  L +IYV
Sbjct  138  STILLTITGFFLTIIYV  154



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQAFGA K+E+LGIYLQ+ST LLT+TG LL  IY+
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYI  154



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LG+YLQRS  LLTLTGVLL +IYV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYV  152



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 110/140 (79%), Gaps = 3/140 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS     D       +  SP   ES ++ ELE++L D   P +QRL+ AT IE KLL 
Sbjct  1    MDSSRNDGVDQALLQRQL--SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLF  57

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVETL
Sbjct  58   NLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVETL  117

Query  441  CGQAFGAGKYELLGIYLQRS  500
            CGQA+GA KYE+LG+YLQRS
Sbjct  118  CGQAYGARKYEMLGVYLQRS  137



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 9/135 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRS  500
            GAG+YE+LG+Y+QR+
Sbjct  118  GAGRYEMLGVYMQRA  132



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 8/135 (6%)
 Frame = +3

Query  117  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV+VYMINYLMSMST+IFSGHLGNLELAAASLGNTGIQ+F+YGL+LGMGSAVETLCGQA+
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAASLGNTGIQVFSYGLLLGMGSAVETLCGQAY  122

Query  456  GAGKYELLGIYLQRS  500
            GA KYE+LG+YLQRS
Sbjct  123  GARKYEMLGVYLQRS  137



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 109/141 (77%), Gaps = 4/141 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  117

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQA+G  KYE+LG+YLQRS
Sbjct  118  LCGQAYGGKKYEMLGVYLQRS  138



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 9/135 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRS  500
            GAG+YE+LG+Y+QR+
Sbjct  118  GAGRYEMLGVYMQRA  132



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL  S+ +     HE   +  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNIGKPNLHE---SDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+ AYGLMLGMGSAVETLCGQAFGA K
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQMLAYGLMLGMGSAVETLCGQAFGAEK  127

Query  468  YELLGIYLQRStxlltltgvllalIYV  548
            +E+LG YLQRST LLT+ G+ L +IYV
Sbjct  128  FEMLGTYLQRSTILLTIAGLFLTVIYV  154



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KYE+LG+YLQRS  LLTLTGVLL  IYV
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYV  153



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 124/164 (76%), Gaps = 10/164 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  236
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAASLGN GIQIFAYGL+LG
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAASLGNNGIQIFAYGLLLG  118

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            MGSAVETLCGQA+GA K+++LGIYLQ+ST LLT+TGVLL  +Y+
Sbjct  119  MGSAVETLCGQAYGAKKFDMLGIYLQKSTVLLTITGVLLTFVYI  162



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 123/160 (77%), Gaps = 12/160 (8%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEE--SEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N     PL +        PH +  +E+SN ELE +L D   P   RL+ AT IE 
Sbjct  1    MDSSQNDGVNQPLLQ--------PHADHGTESSNGELERVLSDVETPLSSRLRKATMIES  52

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  53   KLLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  112

Query  429  VETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            VETLCGQAFG  KYE+LG+YLQRST LLTLTGVLL +IYV
Sbjct  113  VETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTIIYV  152



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            Y PL + D + + P  +  E    LE +L D   P + RL+ AT IE KLL  LAAPAVV
Sbjct  10   YQPLLQPDQLSALPESKNCE----LERVLADVETPLFLRLRKATMIETKLLFKLAAPAVV  65

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG  
Sbjct  66   VYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAFGGR  125

Query  465  KYELLGIYLQRStxlltltgvllalIYV  548
            KYE+LG+YLQRS  LLTLTGVLL  IYV
Sbjct  126  KYEMLGVYLQRSIVLLTLTGVLLTSIYV  153



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-------SNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            +PL  SD   S  P   +++         ELE IL +T +P  +R+  ATW+ELK L +L
Sbjct  12   EPLLVSDEPSSPQPPSFTQSFSSRHGSDGELERILSNTSVPFAKRIGPATWVELKFLFHL  71

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VY+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCG
Sbjct  72   AAPAVIVYLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCG  131

Query  447  QAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            QA+GA K+ +LGIYLQRST LLTL G+LL +IY+
Sbjct  132  QAYGAKKFNMLGIYLQRSTVLLTLAGILLTIIYI  165



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  98   GNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  150



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 115/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  111  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V 
Sbjct  23   PLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSVT  79

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+NY+MSMST I SGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA 
Sbjct  80   VYMLNYVMSMSTTIISGHLGNLELAAASLGNAGIQVFAYGLMLGMGSAVETLCGQAYGAH  139

Query  465  KYELLGIYLQRStxlltltgvllalIY  545
            KYE+LGIYLQRST LL  T V LA+IY
Sbjct  140  KYEMLGIYLQRSTILLMATAVPLAVIY  166



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 9/135 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRS  500
            GAG+YE+LG+Y+QR+
Sbjct  118  GAGRYEMLGVYMQRA  132



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGNTGIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLLLGMGSAVETLCGQAYGANRYEIL  123

Query  480  GIYLQRStxlltltgvllalIYV  548
            GIYLQRST LL LT + L +IY+
Sbjct  124  GIYLQRSTILLMLTALPLMVIYI  146



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYV  548
            L  T + L +IY+
Sbjct  134  LMATAIPLMVIYI  146



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNLE
Sbjct  41   ELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNLE  100

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LGIYLQRST LLTL G+LL
Sbjct  101  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKKFNMLGIYLQRSTVLLTLAGILL  160

Query  534  alIYV  548
             +IY+
Sbjct  161  TIIYI  165



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LG+YLQRS  LLTLTGVLL +IYV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYV  152



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 110/135 (81%), Gaps = 9/135 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRS  500
            GAG+YE+LG+Y+QR+
Sbjct  118  GAGRYEMLGVYMQRA  132



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
               + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFS
Sbjct  29   NHHKTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFS  88

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRS  LL
Sbjct  89   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYHMLGIYLQRSIILL  148

Query  513  tltgvllalIYV  548
            TLTG  +  IY+
Sbjct  149  TLTGFAITTIYI  160



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 120/157 (76%), Gaps = 6/157 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KY++LG+YLQRS  LLTLTGVLL +IYV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYV  152



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score =   176 bits (446),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 119/157 (76%), Gaps = 5/157 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQAFG  KYE+LG+YLQRS  LLTLTGVLL  IYV
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYV  153



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRS  500
            CGQA+GA KY++LGIYLQRS
Sbjct  121  CGQAYGAHKYDMLGIYLQRS  140



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRS  500
            CGQA+GA KY++LGIYLQRS
Sbjct  121  CGQAYGAHKYDMLGIYLQRS  140



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 117/161 (73%), Gaps = 18/161 (11%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  197
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAASLGN
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAASLGN  115

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            TGIQIFAYG+MLGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  116  TGIQIFAYGIMLGMGSAVETLCGQAYGAHKYEMLGVYLQRS  156



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 120/159 (75%), Gaps = 5/159 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAASLGNTGIQ FAYGLMLGMGSAV
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAASLGNTGIQGFAYGLMLGMGSAV  118

Query  432  ETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            ETLCGQA+G  KYE+LG+YLQRST LLTLTGV L LIYV
Sbjct  119  ETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGVFLTLIYV  157



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  146



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 6/126 (5%)
 Frame = +3

Query  141  SPP-----HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            +PP     H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINY
Sbjct  18   APPSPGSGHGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINY  77

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            LMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG
Sbjct  78   LMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLG  137

Query  483  IYLQRS  500
            IYLQRS
Sbjct  138  IYLQRS  143



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYV  548
            L    + L +IY+
Sbjct  134  LMAAAIPLMVIYI  146



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 116/147 (79%), Gaps = 6/147 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStxlltltgvllalIYV  548
            YE+LGIYLQRST LLT+   LL L+Y+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYI  148



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 3/118 (3%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  64   FSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  121



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S  LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYV  548
            TLTG +L ++Y+
Sbjct  132  TLTGFVLTIVYI  143



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRS  500
            YE+LGIYLQRS
Sbjct  122  YEMLGIYLQRS  132



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltlt  521
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRST LLTLT
Sbjct  93   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYNMLGIYLQRSTILLTLT  152

Query  522  gvllalIYV  548
            G +L +IY+
Sbjct  153  GFVLTIIYI  161



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  86   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  142



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 105/131 (80%), Gaps = 6/131 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRS  500
            YE+LGIYLQRS
Sbjct  122  YEMLGIYLQRS  132



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  146



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 109/135 (81%), Gaps = 9/135 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRS  500
            GAG+YE+LG+Y+QR+
Sbjct  118  GAGRYEMLGVYMQRA  132



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS
Sbjct  88   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRS  144



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 117/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAHK  126

Query  468  YELLGIYLQRStxlltltgvllalIYV  548
            Y++LGIYLQRS  LLT TG+LL LIYV
Sbjct  127  YDMLGIYLQRSAVLLTFTGILLTLIYV  153



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 113/134 (84%), Gaps = 1/134 (1%)
 Frame = +3

Query  150  HEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStx  506
            F GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRST 
Sbjct  75   FCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSTV  134

Query  507  lltltgvllalIYV  548
            LL   G+ L +IY+
Sbjct  135  LLMAAGIPLMMIYI  148



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLG+TGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGHTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRS  500
            CGQA+GA KY++LGIYLQRS
Sbjct  121  CGQAYGAHKYDMLGIYLQRS  140



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQA+G  KYE+LG+YLQRST LLTLTG+LL LIYV
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYV  153



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAFG  123

Query  459  AGKYELLGIYLQRStxlltltgvllalIYV  548
            A KY++LGIYLQRS  LLT TG+LL LIYV
Sbjct  124  AHKYDMLGIYLQRSAVLLTFTGILLTLIYV  153



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltg  524
            NLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRST LL+L G
Sbjct  97   NLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAKKYHMLGIYLQRSTVLLSLAG  156

Query  525  vllalIYV  548
            VLL +IYV
Sbjct  157  VLLTIIYV  164



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL       S         + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHPQPSPSP----PESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            LCGQA+G  KYE+LG+YLQRST LLTLTG+LL LIYV
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYV  153



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRS  500
            LGIYLQR+
Sbjct  135  LGIYLQRA  142



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  146



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETL  119

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQA+GA + E+LGIYLQR+T +LT TG  L +IYV
Sbjct  120  CGQAYGANRSEMLGIYLQRATVVLTATGFPLTVIYV  155



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA  YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNNGIQVFAYGLLLGMGSAVETLCGQAYGANSYEIL  123

Query  480  GIYLQRStxlltltgvllalIYV  548
            GIYLQRST LL L  + L +IY+
Sbjct  124  GIYLQRSTILLMLAALPLLVIYI  146



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQRS  LL
Sbjct  72   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQRSAILL  131

Query  513  tltgvllalIYV  548
            TLTG +L ++Y+
Sbjct  132  TLTGFVLTIVYI  143



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRS  500
            GSAVETLCGQA+GA +Y++LGIYLQRS
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRS  149



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 3/131 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            DP P  D  +S   H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+V
Sbjct  4    DP-PRLDFKLSY--HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIV  60

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G+ +
Sbjct  61   YLLNNVVSMSTQIFCGHLGNLELAAVSLGNNGIQMFAYGLMLGMGSAVETLCGQAYGSNR  120

Query  468  YELLGIYLQRS  500
            +E+LGIYLQRS
Sbjct  121  HEMLGIYLQRS  131



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 106/128 (83%), Gaps = 7/128 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRS  500
            LGIYLQR+
Sbjct  135  LGIYLQRA  142



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  146



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 7/165 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  4    NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  58

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  59   TFIELKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  118

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GMGSAVETLCGQA+GA KYE+LGIYLQRST LL  TG+ L +IY+
Sbjct  119  GMGSAVETLCGQAYGAHKYEILGIYLQRSTVLLMATGIPLMMIYI  163



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQI+ GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYL
Sbjct  75   MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYL  134

Query  492  QRStxlltltgvllalIYV  548
            QRST LL  TG+ +  IY+
Sbjct  135  QRSTILLMATGIPVMFIYI  153



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxl  509
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRS  L
Sbjct  75   CGHLGNLELAAVSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSAVL  134

Query  510  ltltgvllalIYV  548
            L  TG+ L +IY+
Sbjct  135  LMATGIPLMMIYI  147



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 6/155 (4%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  
Sbjct  7    DINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFR  60

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPA++VYM+N L+SMSTQIF GHLGNLELAA SLG+TGIQ+FA+GLMLGMGSA ETLC
Sbjct  61   LAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVSLGSTGIQVFAFGLMLGMGSATETLC  120

Query  444  GQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GQA+GA KY++LG+YLQRS  +LT TG+ L +IY+
Sbjct  121  GQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYI  155



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  30   RASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGHL  89

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltlt  521
            G LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRST LL  T
Sbjct  90   GTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMAT  149

Query  522  gvllalIYV  548
            G+ LA+IYV
Sbjct  150  GIPLAVIYV  158



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFS
Sbjct  28   SKHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFS  87

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GH+GNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LGIYLQ+S+ LL
Sbjct  88   GHIGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAFGAKKYDMLGIYLQKSSVLL  147

Query  513  tltgvllalIYV  548
            TL G++L LIY+
Sbjct  148  TLAGLILTLIYI  159



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 114/147 (78%), Gaps = 6/147 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN GIQ FAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGIQSFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStxlltltgvllalIYV  548
            YE+LGIYLQRST LLT+   LL L+Y+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYI  148



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 7/146 (5%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +IN  MSMST+IFSGHLGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GAG+Y
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGAGRY  130

Query  471  ELLGIYLQRStxlltltgvllalIYV  548
            E+LG+YLQR+T +L +  + + ++YV
Sbjct  131  EMLGVYLQRATVVLMMFSLPIVVVYV  156



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 6/127 (5%)
 Frame = +3

Query  138  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
              MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++L
Sbjct  73   NTMSVSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAQMYDML  132

Query  480  GIYLQRS  500
            GIYLQR+
Sbjct  133  GIYLQRA  139



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 7/165 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GMGSAVETLCGQA+GA KYE+LGIYLQRST LL  TG+ L +IY+
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYI  181



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 113/134 (84%), Gaps = 3/134 (2%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStx  506
            F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G+ +Y +LGIY+QR+  
Sbjct  89   FAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGSSRYNMLGIYMQRAMV  148

Query  507  lltltgvllalIYV  548
            +LT TG+ L +IYV
Sbjct  149  VLTATGIPLTIIYV  162



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYAMSTSTQIFSGHLGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRS  500
            E+LGIYLQRS
Sbjct  136  EMLGIYLQRS  145



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStxlltltgvllalIYV  548
            KY++LG+YLQRS  +LT TG+ L +IY+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYI  154



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYTMSTSTQIFSGHLGNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRS  500
            E+LGIYLQRS
Sbjct  136  EMLGIYLQRS  145



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF GHLGN
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIFVGHLGN  78

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgv  527
            LELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST LL    +
Sbjct  79   LELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMAASI  138

Query  528  llalIYV  548
             L L+YV
Sbjct  139  PLTLLYV  145



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRS  500
            GSAVETLCGQA+GA +Y++LGIYLQRS
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRS  149



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 7/165 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GMGSAVETLCGQA+GA KYE+LGIYLQRST LL  TG+ L +IY+
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYI  181



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRS  500
            GSAVETLCGQA+GA +Y++LGIYLQRS
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRS  149



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S  LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYV  548
            TLTG +L ++Y+
Sbjct  132  TLTGFVLTIVYI  143



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRS  125



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRS  125



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRS  125



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS
Sbjct  75   LELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRS  125



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 105/128 (82%), Gaps = 7/128 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY++
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSA+ETLCGQA+GA  Y++
Sbjct  75   NYLMSLSTRLFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSALETLCGQAYGAENYDM  134

Query  477  LGIYLQRS  500
            LGIYLQR+
Sbjct  135  LGIYLQRA  142



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStxlltltgvllalIYV  548
            KY++LG+YLQRS  +LT TG+ L +IY+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYI  154



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 6/148 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStxlltltgvllalIYV  548
            KY++LG+YLQRS  +LT TG+ L +IY+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYI  154



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   169 bits (428),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 6/147 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRS  500
            GSAVETLCGQA+GA +Y++LGIYLQRS
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRS  149



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  117  PESDG----VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            P SD     ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+
Sbjct  16   PPSDHASPPLLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVI  75

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYMINYLMSMSTQI SGHLGNLELAA+SLGN G+QIFAYGLMLGMGSAVETLCGQA+GA 
Sbjct  76   VYMINYLMSMSTQIVSGHLGNLELAASSLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAQ  135

Query  465  KYELLGIYLQRS  500
            KY +LGIYLQRS
Sbjct  136  KYGMLGIYLQRS  147



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  171  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  350
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  351  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            ELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRS
Sbjct  93   ELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGASKFDMLGIYMQRS  142



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 105/133 (79%), Gaps = 6/133 (5%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRS  500
             KYE+LGIY+QRS
Sbjct  124  HKYEMLGIYMQRS  136



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score =   169 bits (427),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRS  152



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 14/155 (9%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GQA+GA KYE+LG+YLQRST LL  T + +  IY+
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYI  161



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRS  152



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRS  500
            LGIYLQR+
Sbjct  135  LGIYLQRA  142



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRS  152



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST +LTLTG+ L L+YV
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYV  169



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 14/155 (9%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GQA+GA KYE+LG+YLQRST LL  T + +  IY+
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYI  161



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  76   LAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYEMLGIYLQRS  124



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGH
Sbjct  7    ADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFSGH  63

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  64   LGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  117



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST +LTLTG+ L L+YV
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYV  169



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltg  524
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIY+QRST LL  T 
Sbjct  64   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYMQRSTILLLATS  123

Query  525  vllalIYV  548
            + L +IY+
Sbjct  124  IPLMIIYI  131



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = +3

Query  117  PESDGVVSSP-----PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            P SD  +S P            S ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  122

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KY++LGIY+QRST LL  T + L +IY+
Sbjct  123  HKYDMLGIYMQRSTILLLATSIPLMIIYI  151



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 103/128 (80%), Gaps = 7/128 (5%)
 Frame = +3

Query  138  SSPPHEES-------EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S+PP   +       E S +LESIL D  +P  +R+  A+ +EL+LL  LAAPAVVVYMI
Sbjct  23   SAPPPATTSGGGGGHEVSGQLESILSDGSLPWPRRVLAASAVELRLLARLAAPAVVVYMI  82

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMSMSTQIFSGHLG LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+++
Sbjct  83   NYLMSMSTQIFSGHLGTLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAYGALKHDM  142

Query  477  LGIYLQRS  500
            LGIYLQR+
Sbjct  143  LGIYLQRA  150



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+LG+YLQR+
Sbjct  94   LGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGARRYEMLGVYLQRA  147



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS
Sbjct  63   FSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYDMLGVYLQRS  120



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 108/141 (77%), Gaps = 7/141 (5%)
 Frame = +3

Query  90   SNGAAYDPLPESDGVVSSPPHEESEASNE----LESILMDTGIPRWQRLKLATWIELKLL  257
            S G  + P+  S+     P  E S   +     LE++L DT +P ++RL++ATWIELKLL
Sbjct  2    SQGQLHQPILASE---QEPAAEASSNGDRVDFLLETVLSDTQLPPFKRLRMATWIELKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV VY+IN  MS+ST+IF+GHLGNLELAAA+LGN+GIQ+ AYGLMLGMGSAVET
Sbjct  59   FRLAAPAVSVYVINNSMSLSTRIFAGHLGNLELAAATLGNSGIQLLAYGLMLGMGSAVET  118

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQA+GA KY++L IYLQR+
Sbjct  119  LCGQAYGAQKYDMLSIYLQRA  139



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   161 bits (408),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +3

Query  123  SDGVVSSP---PHEESE--ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            SD  +S P   P    +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVV
Sbjct  5    SDNDLSEPMLVPKTSLQQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVV  64

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N +++MSTQIF GHLGNLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA K
Sbjct  65   YLLNNVITMSTQIFCGHLGNLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHK  124

Query  468  YELLGIYLQRS  500
            YE+LGIY+QRS
Sbjct  125  YEMLGIYMQRS  135



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRA  131



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRA  131



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +3

Query  123  SDGVVSSP---PHEESE--ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            SD  +S P   P    +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVV
Sbjct  5    SDNDLSEPMLVPKTSLQQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVV  64

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N +++MSTQIF GHLGNLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA K
Sbjct  65   YLLNNVITMSTQIFCGHLGNLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHK  124

Query  468  YELLGIYLQRS  500
            YE+LGIY+QRS
Sbjct  125  YEMLGIYMQRS  135



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S ELE +L DT +P + RL+LA+WIEL+LL  LA PAV++Y+IN  MS+ST+I+ GHL
Sbjct  42   QPSTELEGVLSDTQLPLFNRLRLASWIELRLLFRLAGPAVMMYLINNAMSVSTRIYCGHL  101

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GNLELAAASLGN GIQ+F YGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  102  GNLELAAASLGNQGIQLFVYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRS  154



>gb|KDP20759.1| hypothetical protein JCGZ_21230 [Jatropha curcas]
Length=318

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 3/140 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDS +    +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL 
Sbjct  1    MDSPD-ELQEPILQSHSQPAAALH--NEVNSMLEKVLNDTELPYLKRIMLASAIELKLLY  57

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMIN  MS+ST+IF+GHLGNL+LAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  58   RLAGPAVFVYMINNFMSLSTRIFAGHLGNLQLAAASLGNSGIQLFAYGLMLGMGSAVETL  117

Query  441  CGQAFGAGKYELLGIYLQRS  500
            CGQAFGA K+E+LG YLQR+
Sbjct  118  CGQAFGARKHEMLGTYLQRA  137



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA SLGN
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGN  69

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            TGIQ+FAYGLMLGMGSA ETLCGQA+GA KY++LG+YLQRS  +LT TG+ L +IY+
Sbjct  70   TGIQVFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYI  126



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 6/149 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KYE+LGIY+QRST LL  TG+ L +IY+
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYI  152



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 6/149 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KYE+LGIY+QRST LL  TG+ L +IY+
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYI  152



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 6/149 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KYE+LGIY+QRST LL  TG+ L +IY+
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYI  152



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = +3

Query  141  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAA++LGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LG+Y+QR
Sbjct  79   TQIFSGHLGNLELAASALGNNGIQVFAYGLMLGMGSAVETLCGQAYGARKFGMLGVYMQR  138

Query  498  StxlltltgvllalIY  545
            ST LL+L G+++ +IY
Sbjct  139  STVLLSLAGIVVTVIY  154



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 104/130 (80%), Gaps = 7/130 (5%)
 Frame = +3

Query  132  VVSSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            ++ S P   +E S+        LE +L DT +P ++RL++ATWIELKLL  LAAPAV+VY
Sbjct  10   IIDSEPEPAAETSSNGDGVDFLLEKVLSDTQLPPFKRLRMATWIELKLLFRLAAPAVLVY  69

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +IN  MS+ST++F+GHLGNLELAAA LGN+G+Q+ AYGLMLGMGSAVETLCGQA+GA KY
Sbjct  70   VINNSMSLSTRVFAGHLGNLELAAAILGNSGVQLLAYGLMLGMGSAVETLCGQAYGAQKY  129

Query  471  ELLGIYLQRS  500
            ++L IYLQR+
Sbjct  130  DMLSIYLQRA  139



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQRS
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRS  134



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRS
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRS  130



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRS  120



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRS  500
            +YLQRS
Sbjct  141  VYLQRS  146



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRS  500
            +YLQRS
Sbjct  141  VYLQRS  146



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = +3

Query  138  SSPP---HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  308
            SSP    H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  M
Sbjct  14   SSPEPELHAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFM  73

Query  309  SMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIY  488
            S+ST++F+GHLGNLELAAA+LGN+GIQ+ AYG MLGMGSAVETLCGQA+GA + E+LGIY
Sbjct  74   SLSTRVFAGHLGNLELAAAALGNSGIQLLAYGFMLGMGSAVETLCGQAYGAHRNEMLGIY  133

Query  489  LQRStxlltltgvllalIYV  548
            LQR+T +LT+T + +  IY+
Sbjct  134  LQRATVVLTITAIPMTAIYL  153



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRA  131



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRS  120



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGN
Sbjct  26   SSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgv  527
            LELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST LL  TG+
Sbjct  86   LELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYV  548
             L +IY+
Sbjct  146  PLMIIYI  152



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRS  120



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T++FSGHLGNLELAA SLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G  +YE+LGIYLQR
Sbjct  75   TRVFSGHLGNLELAAVSLGNSGIQLLAYGLMLGMGSAVETLCGQAYGGRRYEMLGIYLQR  134

Query  498  S  500
            S
Sbjct  135  S  135



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPA++VY+IN  MS+ST++F+GHLGNLELAAA+LG + IQ+ AYGLMLGMGSAVETL
Sbjct  60   RLAAPAILVYLINNAMSLSTRVFAGHLGNLELAAATLGKSSIQL-AYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQA+GA +YE+LG+YLQR+T +LT TG  L +IYV
Sbjct  119  CGQAYGADRYEMLGVYLQRATVVLTATGFPLTVIYV  154



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV V
Sbjct  9    EPILQSRSQPAAVLH--NEVNSRLEKVLNDTELPYLKRILLASAIELKLLFPLAGPAVFV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            YMIN LMS+ST+IF+GHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  67   YMINNLMSLSTRIFAGHLGNLELAAASLGNNGIQLFAYGLMLGMGSAVETLCGQAYGARK  126

Query  468  YELLGIYLQRS  500
            YE+LG YLQR+
Sbjct  127  YEMLGTYLQRA  137



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  88   LGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRS  141



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLGN
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLGN  89

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltltgv  527
            LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY++LG+YLQRST LLT TG+
Sbjct  90   LELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYDMLGVYLQRSTILLTATGI  149

Query  528  llalIYV  548
             + LIYV
Sbjct  150  PITLIYV  156


 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 107/156 (69%), Gaps = 13/156 (8%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPR  212
            E+   +F  +   N + ++ N       P        PP      S+ELE IL +  +  
Sbjct  488  EEKREKFSTYRKINHMANNQNSLLRKHSP--------PP-----VSSELEDILSNMELSY  534

Query  213  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQI  392
             QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF GHLGNLELAAASLGNTGIQ+
Sbjct  535  SQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIFCGHLGNLELAAASLGNTGIQV  594

Query  393  FAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS
Sbjct  595  FAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRS  630



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LELAAASLGNTG+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRS
Sbjct  94   LELAAASLGNTGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRS  144



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
             LELAAASLGNTG+Q FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  73   TLELAAASLGNTGVQTFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  124



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
             PL E+      PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++V
Sbjct  12   QPLVENQ----PPPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N L++MSTQIF G LGNLELA ++L N GIQ+F YG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNLLNMSTQIFCGQLGNLELAGSALANNGIQLFVYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRS  500
            YE+LGIYLQRS
Sbjct  128  YEMLGIYLQRS  138



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +3

Query  150  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
              GHLG LELAAASLGNTG+Q  AYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  67   LCGHLGTLELAAASLGNTGVQTMAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  124



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRS
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRS  130



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRS
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRS  130



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +3

Query  90   SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    LA
Sbjct  6    NKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFRLA  63

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
             PAV+VY++N + SMSTQIF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLCGQ
Sbjct  64   GPAVIVYLLNNVTSMSTQIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLCGQ  123

Query  450  AFGAGKYELLGIYLQRS  500
            A+GA KYE+LGIY+QRS
Sbjct  124  AYGAHKYEMLGIYMQRS  140



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            +D +    + PL       S  P      S+ LE  L D  +  + R++ ATWIEL +L 
Sbjct  9    IDCAENEVHQPLLHYYKSFSPEPC----VSDLLEDTLSDNSLSLFWRIQRATWIELGILF  64

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAVVVY+ N L+SMSTQIF GHLGNLELAAASLGN GIQ FAYGLMLGMGSAVETL
Sbjct  65   HLAAPAVVVYLFNNLISMSTQIFCGHLGNLELAAASLGNNGIQTFAYGLMLGMGSAVETL  124

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQA+GA KY +LGIYLQRST LL  TG+ L +IY+
Sbjct  125  CGQAYGANKYGMLGIYLQRSTILLMATGIPLMIIYI  160



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GSAVETLCGQ++GA ++E+LG +LQR+T +LTLTG+ LA +YV
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYV  162



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+ A ++E+LG+YLQRS
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYXAHRHEMLGVYLQRS  134



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score =   152 bits (385),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LG+Y+QRS
Sbjct  62   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGMYMQRS  114



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRS
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRS  130



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GSAVETLCGQ++GA ++E+LG +LQR+T +LTLTG+ LA +YV
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYV  162



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            GSAVETLCGQ++GA ++E+LG +LQR+T +LTLTG+ LA +YV
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYV  162



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LELAAASLGN G+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRS
Sbjct  94   LELAAASLGNMGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRS  144



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 9/141 (6%)
 Frame = +3

Query  84   DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVET
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRS  500
            LCGQA+GA +YE+LGIY+QRS
Sbjct  116  LCGQAYGAQQYEMLGIYMQRS  136



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
                G   +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  
Sbjct  5    SQDKGPPNEPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFR  60

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPA++VY++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLC
Sbjct  61   LAAPAIIVYLLNNITSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLC  120

Query  444  GQAFGAGKYELLGIYLQRS  500
            GQA+GA KYE+LGIYLQRS
Sbjct  121  GQAYGAHKYEMLGIYLQRS  139



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 101/132 (77%), Gaps = 6/132 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRS  500
            KYE+LGIYLQRS
Sbjct  127  KYEMLGIYLQRS  138



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  119

Query  468  YELLGIYLQRS  500
            YE+LGIYLQRS
Sbjct  120  YEMLGIYLQRS  130



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYMIN  MS+ST++F
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYMINNAMSLSTRVF  93

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
             GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRS
Sbjct  94   CGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYGALRYDMLGVYLQRS  150



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRW-QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W + ++ A ++E KLLC LA PAV+VYM+NY+MSM+TQIFSGH
Sbjct  20   DDKNRLEVILSNADDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGH  79

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStxlltl  518
            LGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++LGIYLQRST LL  
Sbjct  80   LGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAYGAKNYDMLGIYLQRSTVLLMA  139

Query  519  tgvllalIYV  548
              + L LIYV
Sbjct  140  AAIPLTLIYV  149



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 101/132 (77%), Gaps = 6/132 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRS  500
            KYE+LGIYLQRS
Sbjct  127  KYEMLGIYLQRS  138



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 1/131 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  123

Query  468  YELLGIYLQRS  500
            YE+LGIYLQRS
Sbjct  124  YEMLGIYLQRS  134



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY++N ++SMST I 
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYLLNNVVSMSTLIL  62

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
             GHLGNL+LA+ASL N GIQ+FA+GL+LGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  63   CGHLGNLQLASASLSNNGIQLFAFGLLLGMGSAVETLCGQAYGAQKYEMLGIYLQRS  119



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 6/149 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S      +ELE  L +T    +QRL+ ATW+E K LC LAAPAV
Sbjct  4    SSDNDLSEPMLVPKTSSLQQIVRSELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++++STQIF GHLGNLELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVITLSTQIFCGHLGNLELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStxlltltgvllalIYV  548
             KYE+LGIY+Q ST LL  TG+ L +IY+
Sbjct  124  HKYEMLGIYMQISTTLLVATGIPLTIIYI  152



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +3

Query  123  SDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            ++ ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN 
Sbjct  10   NNPLLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINN  69

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ T+IF+GHLG+LELAA+SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE++G
Sbjct  70   GMSILTRIFAGHLGSLELAASSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMMG  129

Query  483  IYLQRS  500
            +YLQRS
Sbjct  130  VYLQRS  135



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
             LELAAASLGN G+Q FA+GLMLGMGSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  75   TLELAAASLGNCGVQTFAFGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRS  126



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 118/158 (75%), Gaps = 3/158 (2%)
 Frame = +3

Query  81   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  254
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  255  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVE  434
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA SL N+G+Q+F YGLMLGMGSAVE
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVSLANSGVQLFVYGLMLGMGSAVE  119

Query  435  TLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            TLCGQ++GA ++E+LG +LQR+T +LTLTG+ LA +YV
Sbjct  120  TLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYV  157



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  72

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  73   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  132

Query  492  QRS  500
            QR+
Sbjct  133  QRA  135



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 94/113 (83%), Gaps = 5/113 (4%)
 Frame = +3

Query  165  ASNELESILMDTGIPR-WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            AS +LES+L  +     W     A  IEL+LL  LAAPAVV YMINYLMSMSTQIFSGHL
Sbjct  11   ASAQLESVLTSSSSSFPWA----AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFSGHL  66

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GNLELAAASLGNTG+QIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  67   GNLELAAASLGNTGVQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  119



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  73

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  74   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  133

Query  492  QRS  500
            QR+
Sbjct  134  QRA  136



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 5/139 (4%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVETLC
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVETLC  118

Query  444  GQAFGAGKYELLGIYLQRS  500
            GQA+GA +YE+LGIY+QRS
Sbjct  119  GQAYGAQQYEMLGIYMQRS  137



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  100

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRS  500
            GSAVETLCGQA+GA KY++LGIYLQRS
Sbjct  101  GSAVETLCGQAYGAQKYDMLGIYLQRS  127



>ref|XP_010093281.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB53806.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=534

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+S N   ++P+  +    S    E    S+ELE  L ++ +  ++R + AT +ELK L 
Sbjct  1    MESINNDLHEPILATKEASSILSPEA--ISSELEETLSNSDLSYFRRFQAATCLELKTLY  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY++N + SMSTQI  GHLGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  59   RLAAPAVIVYLLNNVTSMSTQILCGHLGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            CGQA+GA KYELLG+YLQRST LL  TGV L LIY+
Sbjct  119  CGQAYGAHKYELLGVYLQRSTILLMATGVPLTLIYI  154



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            SSP     E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMS
Sbjct  9    SSP----EEISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMS  64

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIF GH+GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LGIY+QR
Sbjct  65   TQIFCGHVGNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGIYMQR  124

Query  498  S  500
            S
Sbjct  125  S  125



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 6/161 (4%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESE-----ASNELESILMDTGIPRWQRLKLATWIE  245
            M +SNG   D   + D       HE         S+ELE IL +  + R +R+  AT++E
Sbjct  1    MGTSNGCRID-YADLDESYQPILHERRSFSGETVSSELEEILSNMELSRSRRILRATFLE  59

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            LK+L  LAAPA+VVY++N+L+S+STQIF GHLGNL+LA ASLG TGIQ+F +G+MLGMGS
Sbjct  60   LKILFPLAAPAIVVYLLNFLISISTQIFCGHLGNLQLAGASLGTTGIQVFIFGIMLGMGS  119

Query  426  AVETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            AVETLCGQA+GA KYE+LGIY+QRST LLTL+G++L  IY+
Sbjct  120  AVETLCGQAYGAHKYEMLGIYMQRSTILLTLSGLVLMFIYI  160



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAEAA---ASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  117



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL D  +   +RL  AT +E++LL  LAAPAVVVYM+N L+S+ TQ+FSGHLGN
Sbjct  14   SRRLESILADLTMSWPRRLWSATTVEMQLLFPLAAPAVVVYMLNNLLSLGTQVFSGHLGN  73

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS
Sbjct  74   LELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRS  124



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +3

Query  138  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            + S+STQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LG
Sbjct  68   VTSVSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLG  127

Query  483  IYLQRS  500
            IYLQRS
Sbjct  128  IYLQRS  133



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 5/159 (3%)
 Frame = +3

Query  72   NSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            +S ++ +    Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK
Sbjct  7    DSRIEYAEDEPYEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELK  61

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            +L  LAAPA+VVY++N+L+S+ST +F GHLGNL+LAAASLGNTG+Q F YG++ GMGSAV
Sbjct  62   ILSRLAAPAIVVYLLNFLISISTHVFCGHLGNLQLAAASLGNTGVQGFVYGIVFGMGSAV  121

Query  432  ETLCGQAFGAGKYELLGIYLQRStxlltltgvllalIYV  548
            ETLCGQA+GA +YE+LGIY+QRST LLTL+G++L  IY+
Sbjct  122  ETLCGQAYGARRYEMLGIYMQRSTILLTLSGLVLMFIYI  160



>ref|XP_009614258.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=432

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRS  500
            YE LGIYLQRS
Sbjct  128  YESLGIYLQRS  138



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 4/137 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StxlltltgvllalIYV  548
            ST +L LTG+ + ++YV
Sbjct  133  STVVLALTGLPMTVLYV  149



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score =   158 bits (399),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 74/90 (82%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLM
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLM  63

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            LGMGSAVETLCGQA+GA K+++LGIY+QRS
Sbjct  64   LGMGSAVETLCGQAYGANKFDMLGIYMQRS  93



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 4/137 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StxlltltgvllalIYV  548
            ST +L LTG+ + ++YV
Sbjct  133  STVVLALTGLPMTVLYV  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720