BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF033C07

Length=335
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     75.1    8e-17   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     73.6    4e-16   Nicotiana sylvestris
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    3e-14   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  73.6    3e-14   Nicotiana tomentosiformis
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     72.4    1e-13   Solanum tuberosum [potatoes]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.4    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  62.4    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12          70.5    6e-13   Solanum lycopersicum
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12          73.2    1e-12   Solanum lycopersicum
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                71.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g           70.9    3e-12   
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    3e-12   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  71.6    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg           71.6    5e-12   Citrus clementina [clementine]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  71.6    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12          61.2    1e-11   
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                  61.2    3e-11   Arabis alpina [alpine rockcress]
emb|CDP11782.1|  unnamed protein product                              68.9    4e-11   Coffea canephora [robusta coffee]
emb|CDP11780.1|  unnamed protein product                              68.9    4e-11   Coffea canephora [robusta coffee]
emb|CDP17486.1|  unnamed protein product                              64.7    7e-11   Coffea canephora [robusta coffee]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  67.8    1e-10   Cicer arietinum [garbanzo]
ref|XP_003605914.1|  Transparent testa 12 protein                     67.8    1e-10   Medicago truncatula
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12          67.0    2e-10   Glycine max [soybeans]
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.2    4e-10   Cucumis sativus [cucumbers]
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  66.2    4e-10   Elaeis guineensis
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     66.2    4e-10   Elaeis guineensis
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.9    5e-10   Cucumis melo [Oriental melon]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  65.9    5e-10   Elaeis guineensis
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12          65.9    6e-10   Vitis vinifera
emb|CBI28937.3|  unnamed protein product                              65.9    6e-10   Vitis vinifera
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12          65.5    7e-10   Tarenaya hassleriana [spider flower]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.5    8e-10   Prunus mume [ume]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12          65.1    9e-10   Phoenix dactylifera
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.1    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     65.1    9e-10   
ref|XP_007045634.1|  MATE efflux family protein isoform 2             64.7    9e-10   
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12          65.1    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007045633.1|  MATE efflux family protein isoform 1             64.3    2e-09   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg           64.3    2e-09   
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     64.3    2e-09   Prunus mume [ume]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg           64.3    2e-09   Capsella rubella
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                          64.3    2e-09   Glycine soja [wild soybean]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                          63.9    2e-09   Glycine soja [wild soybean]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.9    2e-09   Glycine max [soybeans]
ref|XP_003596992.1|  Transparent testa 12 protein                     63.5    3e-09   Medicago truncatula
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     63.5    4e-09   Elaeis guineensis
emb|CDY24250.1|  BnaC03g42230D                                        62.4    4e-09   Brassica napus [oilseed rape]
emb|CDY69153.1|  BnaAnng29470D                                        62.4    4e-09   Brassica napus [oilseed rape]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    5e-09   
emb|CDY39494.1|  BnaA01g24940D                                        62.8    7e-09   Brassica napus [oilseed rape]
emb|CDY19294.1|  BnaC01g31860D                                        62.4    7e-09   Brassica napus [oilseed rape]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    7e-09   Eucalyptus grandis [rose gum]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    7e-09   Brassica rapa
emb|CDY65669.1|  BnaCnng48120D                                        62.4    8e-09   Brassica napus [oilseed rape]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.4    8e-09   Brassica rapa
emb|CDY38631.1|  BnaA05g19560D                                        62.4    8e-09   Brassica napus [oilseed rape]
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg           62.4    8e-09   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12          61.2    8e-09   
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    9e-09   Camelina sativa [gold-of-pleasure]
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    1e-08   
emb|CDY19295.1|  BnaC01g31850D                                        61.2    1e-08   Brassica napus [oilseed rape]
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    1e-08   Brassica rapa
emb|CDY33129.1|  BnaCnng07000D                                        62.0    1e-08   Brassica napus [oilseed rape]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                     62.0    1e-08   Cucumis sativus [cucumbers]
emb|CDY39493.1|  BnaA01g24950D                                        62.0    1e-08   Brassica napus [oilseed rape]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12          62.0    1e-08   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg           62.0    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     62.0    1e-08   Brassica rapa
ref|XP_002883313.1|  mate efflux family protein                       62.0    1e-08   
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    1e-08   Cicer arietinum [garbanzo]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    1e-08   Cicer arietinum [garbanzo]
gb|KEH39009.1|  MATE efflux family protein                            61.2    2e-08   Medicago truncatula
emb|CDX92916.1|  BnaA03g36380D                                        61.6    2e-08   
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.6    2e-08   Brassica rapa
ref|NP_188806.1|  MATE efflux family protein                          61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                   61.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    2e-08   Elaeis guineensis
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     61.2    2e-08   Cucumis melo [Oriental melon]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g           60.8    3e-08   Phaseolus vulgaris [French bean]
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    3e-08   Cucumis melo [Oriental melon]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.5    4e-08   Prunus mume [ume]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    4e-08   
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    4e-08   Setaria italica
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     60.1    5e-08   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                  53.1    6e-08   Arabis alpina [alpine rockcress]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg           59.7    7e-08   Prunus persica
dbj|BAJ34540.1|  unnamed protein product                              59.3    8e-08   Eutrema halophilum
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     59.3    8e-08   Camelina sativa [gold-of-pleasure]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                     58.9    1e-07   Cucumis sativus [cucumbers]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.9    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.5    2e-07   Cucumis sativus [cucumbers]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                  58.5    2e-07   Arabis alpina [alpine rockcress]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g           58.5    2e-07   
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                          55.1    2e-07   Triticum urartu
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     58.2    2e-07   Cucumis melo [Oriental melon]
emb|CAN69305.1|  hypothetical protein VITISV_021605                   57.4    2e-07   Vitis vinifera
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                 55.8    2e-07   Citrus sinensis [apfelsine]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g           57.8    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.8    3e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g           57.8    3e-07   
tpg|DAA50097.1|  TPA: putative MATE efflux family protein             55.1    3e-07   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    3e-07   Brachypodium distachyon [annual false brome]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    4e-07   Fragaria vesca subsp. vesca
ref|NP_001149176.1|  transparent testa 12 protein                     57.4    4e-07   Zea mays [maize]
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12          57.4    4e-07   Vitis vinifera
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg           57.4    4e-07   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     57.4    5e-07   
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  57.0    5e-07   Vitis vinifera
gb|ACZ55932.1|  MATE transporter 2                                    57.0    6e-07   Zea mays [maize]
gb|ACF85423.1|  unknown                                               57.0    6e-07   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                    57.0    6e-07   Zea mays [maize]
ref|NP_001148084.1|  transparent testa 12 protein                     57.0    6e-07   Zea mays [maize]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  56.6    7e-07   Nicotiana tomentosiformis
emb|CBI28939.3|  unnamed protein product                              56.2    7e-07   Vitis vinifera
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    7e-07   Malus domestica [apple tree]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.6    8e-07   
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    8e-07   Solanum tuberosum [potatoes]
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                 56.2    8e-07   Citrus sinensis [apfelsine]
gb|KJB69294.1|  hypothetical protein B456_011G014800                  56.2    8e-07   Gossypium raimondii
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.2    8e-07   Fragaria vesca subsp. vesca
ref|XP_008455546.1|  PREDICTED: MATE efflux family protein LAL5-like  53.9    9e-07   Cucumis melo [Oriental melon]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g           56.2    9e-07   Populus trichocarpa [western balsam poplar]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein            56.2    9e-07   Gossypium arboreum [tree cotton]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     56.2    9e-07   Pyrus x bretschneideri [bai li]
gb|KJB30571.1|  hypothetical protein B456_005G149900                  56.2    1e-06   Gossypium raimondii
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    1e-06   Citrus sinensis [apfelsine]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    1e-06   Cicer arietinum [garbanzo]
gb|AGT17221.1|  transparent testa 12 protein                          56.2    1e-06   Saccharum hybrid cultivar R570
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    1e-06   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  56.2    1e-06   Solanum tuberosum [potatoes]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12          56.2    1e-06   Vitis vinifera
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.8    1e-06   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  55.8    1e-06   
tpg|DAA50098.1|  TPA: putative MATE efflux family protein             55.8    1e-06   
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg           55.8    1e-06   Citrus clementina [clementine]
gb|EMT13256.1|  hypothetical protein F775_42803                       52.8    1e-06   
gb|KJB69293.1|  hypothetical protein B456_011G014800                  55.5    2e-06   Gossypium raimondii
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.5    2e-06   Elaeis guineensis
gb|EPS67796.1|  hypothetical protein M569_06975                       55.5    2e-06   Genlisea aurea
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.5    2e-06   Pyrus x bretschneideri [bai li]
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                 55.5    2e-06   Citrus sinensis [apfelsine]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.5    2e-06   Solanum lycopersicum
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g           55.5    2e-06   Populus trichocarpa [western balsam poplar]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                 55.5    2e-06   Citrus sinensis [apfelsine]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Populus euphratica
gb|KJB57729.1|  hypothetical protein B456_009G178100                  54.7    2e-06   Gossypium raimondii
tpg|DAA50100.1|  TPA: putative MATE efflux family protein             55.1    2e-06   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...  55.1    2e-06   Zea mays [maize]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.1    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg           55.1    2e-06   Citrus clementina [clementine]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  55.1    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Nicotiana tomentosiformis
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Citrus sinensis [apfelsine]
gb|KGN43524.1|  hypothetical protein Csa_7G043660                     55.1    2e-06   Cucumis sativus [cucumbers]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   Populus euphratica
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein            55.1    2e-06   Gossypium arboreum [tree cotton]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    2e-06   
gb|KGN43522.1|  Mate efflux family protein                            55.1    3e-06   Cucumis sativus [cucumbers]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     55.1    3e-06   Populus euphratica
gb|AAS01962.1|  putative MATE efflux family protein                   55.1    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg           55.1    3e-06   
gb|KJB57728.1|  hypothetical protein B456_009G178100                  55.1    3e-06   Gossypium raimondii
gb|EEC75610.1|  hypothetical protein OsI_12322                        55.1    3e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                     55.1    3e-06   
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    3e-06   
gb|KJB57730.1|  hypothetical protein B456_009G178100                  54.7    3e-06   Gossypium raimondii
dbj|BAF47751.1|  multi antimicrobial extrusion family protein         54.7    3e-06   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    3e-06   Nicotiana sylvestris
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg              54.7    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    3e-06   Setaria italica
gb|ABF97220.1|  MATE efflux family protein, expressed                 54.7    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19998.1|  hypothetical protein F775_52364                       55.1    3e-06   
gb|ABF97209.1|  MATE efflux family protein, expressed                 54.7    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...  54.7    3e-06   Nicotiana sylvestris
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2  54.7    3e-06   
ref|XP_007026054.1|  MATE efflux family protein isoform 1             54.7    3e-06   
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.7    4e-06   Sesamum indicum [beniseed]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g           54.3    4e-06   Phaseolus vulgaris [French bean]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    4e-06   Zea mays [maize]
ref|XP_007026057.1|  MATE efflux family protein                       54.3    4e-06   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  47.4    4e-06   Tarenaya hassleriana [spider flower]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                 54.3    4e-06   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  54.3    4e-06   Citrus sinensis [apfelsine]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                       53.9    5e-06   Jatropha curcas
gb|EEC75606.1|  hypothetical protein OsI_12318                        54.3    5e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     54.3    5e-06   Sesamum indicum [beniseed]
ref|XP_006858200.1|  hypothetical protein AMTR_s00062p00173640        51.2    5e-06   
gb|ABK24492.1|  unknown                                               53.9    5e-06   Picea sitchensis
ref|XP_002518495.1|  multidrug resistance pump, putative              53.9    5e-06   Ricinus communis
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100        53.9    6e-06   Sorghum bicolor [broomcorn]
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                   53.5    6e-06   Eucalyptus grandis [rose gum]
emb|CDM86677.1|  unnamed protein product                              53.9    6e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.5    7e-06   Populus euphratica
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                          53.5    7e-06   Triticum urartu
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.9    7e-06   Prunus mume [ume]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.5    7e-06   Populus euphratica
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    7e-06   Zea mays [maize]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                          53.5    8e-06   
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.5    8e-06   Populus euphratica
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.5    8e-06   Prunus mume [ume]
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.1    9e-06   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    1e-05   Populus euphratica
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.8    1e-05   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     53.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  53.1    1e-05   Populus euphratica
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.4    1e-05   
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12          52.8    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                     52.8    1e-05   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    1e-05   
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    1e-05   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    1e-05   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    1e-05   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.8    2e-05   
emb|CDM85992.1|  unnamed protein product                              52.4    2e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.4    2e-05   Brachypodium distachyon [annual false brome]
emb|CBI23252.3|  unnamed protein product                              51.6    2e-05   Vitis vinifera
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.4    2e-05   
gb|EMT26283.1|  Protein TRANSPARENT TESTA 12                          49.3    2e-05   
gb|AHI48506.1|  multidrug and toxic extrusion transporter             52.4    2e-05   Vaccinium corymbosum [American blueberry]
ref|XP_006389638.1|  MATE efflux family protein                       52.0    2e-05   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.0    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  52.0    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   Vitis vinifera
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     52.0    2e-05   
gb|KDP20759.1|  hypothetical protein JCGZ_21230                       51.2    3e-05   Jatropha curcas
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.6    3e-05   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                       51.6    4e-05   Jatropha curcas
emb|CDY34833.1|  BnaA09g47590D                                        51.2    4e-05   Brassica napus [oilseed rape]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     51.2    5e-05   Populus euphratica
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    5e-05   Camelina sativa [gold-of-pleasure]
gb|EPS61219.1|  hypothetical protein M569_13580                       48.5    5e-05   Genlisea aurea
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g           50.8    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.8    6e-05   
emb|CDM86687.1|  unnamed protein product                              50.8    6e-05   Triticum aestivum [Canadian hard winter wheat]
emb|CDY07256.1|  BnaC04g19150D                                        48.1    6e-05   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12          50.8    6e-05   Brassica rapa
ref|XP_002886501.1|  mate efflux family protein                       50.8    6e-05   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     50.4    7e-05   Camelina sativa [gold-of-pleasure]
ref|NP_564787.1|  MATE efflux family protein                          50.4    7e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82541.1|  At1g61890/F8K4_9                                      50.4    7e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34637.1|  BnaC08g41960D                                        50.4    8e-05   Brassica napus [oilseed rape]
gb|ABR18290.1|  unknown                                               47.4    9e-05   Picea sitchensis
emb|CDY25329.1|  BnaC01g29980D                                        50.1    1e-04   Brassica napus [oilseed rape]
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg           50.1    1e-04   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                       50.1    1e-04   Jatropha curcas
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg           49.7    1e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.7    1e-04   
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.7    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  49.3    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   Camelina sativa [gold-of-pleasure]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                  49.7    2e-04   Arabis alpina [alpine rockcress]
ref|XP_007026056.1|  MATE efflux family protein                       49.7    2e-04   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     49.7    2e-04   Brassica rapa
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  48.9    2e-04   Tarenaya hassleriana [spider flower]
emb|CDY12916.1|  BnaA09g13580D                                        49.7    2e-04   Brassica napus [oilseed rape]
emb|CDY19507.1|  BnaC09g13960D                                        49.3    2e-04   Brassica napus [oilseed rape]
emb|CDM86696.1|  unnamed protein product                              49.3    2e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  48.9    2e-04   
ref|XP_002518493.1|  multidrug resistance pump, putative              49.3    2e-04   Ricinus communis
emb|CDM86692.1|  unnamed protein product                              48.9    2e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.9    3e-04   Brassica rapa
emb|CDY47166.1|  BnaA01g22920D                                        48.9    3e-04   Brassica napus [oilseed rape]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg           48.1    4e-04   Eutrema salsugineum [saltwater cress]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     48.1    5e-04   Brassica rapa
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                          48.1    5e-04   Triticum urartu
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg           48.1    5e-04   Capsella rubella
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    5e-04   Populus euphratica
emb|CDY64933.1|  BnaCnng45550D                                        47.8    6e-04   Brassica napus [oilseed rape]
emb|CDY64820.1|  BnaA08g31640D                                        47.8    6e-04   Brassica napus [oilseed rape]
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.8    6e-04   Tarenaya hassleriana [spider flower]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12          47.8    7e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g           47.4    7e-04   
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.4    7e-04   Nicotiana sylvestris
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  47.4    9e-04   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     47.4    9e-04   
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  47.4    0.001   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score = 75.1 bits (183),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP W +L+LATWIE+KLL YLAAPAV+VYMINY+MSMSTQIFS
Sbjct  46   IPFWSKLRLATWIEMKLLFYLAAPAVMVYMINYIMSMSTQIFS  88


 Score = 38.1 bits (87),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 4/47 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGNP  209
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT  P
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIP  47



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score = 73.6 bits (179),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP W +L+LATWIE+KLL +LAAPAV+VYMINY+MSMSTQIFS
Sbjct  46   IPLWNKLRLATWIEMKLLFHLAAPAVMVYMINYIMSMSTQIFS  88


 Score = 37.0 bits (84),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 4/47 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGNP  209
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT  P
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIP  47



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score = 73.6 bits (179),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P W RL+LATWIE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  46   LPLWSRLRLATWIETKLLFFLAAPAVMVYMINYLMSMSTQIFS  88


 Score = 31.2 bits (69),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 4/47 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGNP  209
            M SS      P  E++GV +  P     +  E+++ELE++L+DT  P
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLP  47



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score = 73.6 bits (179),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P W RL+LATWIE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  46   LPLWSRLRLATWIETKLLFFLAAPAVMVYMINYLMSMSTQIFS  88


 Score = 31.2 bits (69),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 4/47 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGNP  209
            M SS      P  E++GV +  P     +  E+++ELE++L+DT  P
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLP  47



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score = 72.4 bits (176),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP W +L+LATWIE+K L +LAAPAV+VYMINY+MSMSTQIFS
Sbjct  45   IPLWSKLRLATWIEMKFLFFLAAPAVMVYMINYIMSMSTQIFS  87


 Score = 30.4 bits (67),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 3/46 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGNP  209
            M S     Y P  +++    SP   E+   E+SNELE++L+DT  P
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIP  46



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score = 62.4 bits (150),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  QRLK A WIE KLL  LAAPA++VYMINY+MSMSTQIF
Sbjct  49   PFSQRLKPALWIESKLLVVLAAPAIIVYMINYVMSMSTQIF  89


 Score = 39.3 bits (90),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 28/52 (54%), Gaps = 6/52 (12%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGNP  209
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKP  49



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score = 62.4 bits (150),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  QRLK A WIE KLL  LAAPA++VYMINY+MSMSTQIF
Sbjct  49   PFSQRLKPALWIESKLLVVLAAPAIIVYMINYVMSMSTQIF  89


 Score = 39.3 bits (90),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 28/52 (54%), Gaps = 6/52 (12%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGNP  209
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKP  49



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score = 70.5 bits (171),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            I  W +L+LATWIE+KLL +LAAPAV+VYMINY+MSMSTQIFS
Sbjct  45   ITLWSKLRLATWIEMKLLFFLAAPAVMVYMINYIMSMSTQIFS  87


 Score = 29.3 bits (64),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (56%), Gaps = 3/43 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDT  200
            M S     Y P  +++    SP   E+   E+SNELE++L+DT
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDT  43



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +PRW RL+ ATWIE+KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  36   LPRWNRLRQATWIEMKLLFSLAAPAVMVYMINYLMSMSTQIFS  78



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPRMRRAKPAMSWRASSWTLX-------IPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  300
            PP +   +P+     S+  L        +  WQRL+ ATWIE KLL +LAAPAV+VYMIN
Sbjct  26   PPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYMIN  85

Query  301  YLMSMSTQIFS  333
            YLMSMSTQIFS
Sbjct  86   YLMSMSTQIFS  96



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+ ATWIE KLLC LAAPAVVVYMINYLMSMSTQIFS
Sbjct  47   MPYFKRLRRATWIESKLLCRLAAPAVVVYMINYLMSMSTQIFS  89



>ref|XP_009353369.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=133

 Score = 61.6 bits (148),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  QRLK A WIE KLL  LAAPA++VYMINY+MSMSTQ+F
Sbjct  49   PFSQRLKPALWIESKLLVVLAAPAIIVYMINYVMSMSTQMF  89


 Score = 35.8 bits (81),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 1/35 (3%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGNP  209
            Y PLP +    S   HEE +AS ELE +L DTG P
Sbjct  16   YPPLPSTKSFTSKHAHEE-QASGELEQVLCDTGKP  49



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + +P ++R ++ATWIELKLL YLAAPAV+VYMINY+MSMSTQIFS
Sbjct  44   MQMPAFKRYRVATWIELKLLFYLAAPAVIVYMINYVMSMSTQIFS  88



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 7/71 (10%)
 Frame = +1

Query  142  PPRMRRAKPAMSWRASSWTLX-------IPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  300
            PP +   +P+     S+  L        +  WQRL+ ATWIE KLL +LAAPAV+VYMIN
Sbjct  26   PPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRATWIESKLLFHLAAPAVIVYMIN  85

Query  301  YLMSMSTQIFS  333
            YLMSMSTQIFS
Sbjct  86   YLMSMSTQIFS  96



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + +P ++R ++ATWIELKLL YLAAPAV+VYMINY+MSMSTQIFS
Sbjct  44   MQMPAFKRYRVATWIELKLLFYLAAPAVIVYMINYVMSMSTQIFS  88



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score = 61.2 bits (147),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  QRLK A WIE KLL  LAAPA++VYMINY+MSMSTQ+F
Sbjct  49   PFSQRLKPALWIESKLLVVLAAPAIIVYMINYVMSMSTQMF  89


 Score = 34.7 bits (78),  Expect(2) = 1e-11, Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 1/36 (3%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGNP  209
            +Y PLP +    S   HEE  AS ELE +L DT  P
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKP  49



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score = 61.2 bits (147),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  47   PLFLRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  88


 Score = 32.7 bits (73),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 25/47 (53%), Gaps = 4/47 (9%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGNP  209
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETP  47



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  QR + ATWIE+KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  34   PLLQRYRAATWIEMKLLFHLAAPAVIVYMINYLMSMSTQIFS  75



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  QR + ATWIE+KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  34   PLLQRYRAATWIEMKLLFHLAAPAVIVYMINYLMSMSTQIFS  75



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 64.7 bits (156),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  ATWIE+KLL +LAAPAVVVYMINYLMSM TQIFS
Sbjct  45   VPFIKRVVPATWIEIKLLVHLAAPAVVVYMINYLMSMLTQIFS  87


 Score = 28.5 bits (62),  Expect(2) = 7e-11, Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGNPAV  215
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T  P +
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFI  48



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+ LATW+ELKLL YLAAPAV+VY+INY+MSMSTQIFS
Sbjct  43   VPFVKRIPLATWVELKLLFYLAAPAVIVYLINYVMSMSTQIFS  85



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+KLATW+E KLL YLAAP+V+VY+INY+MSMSTQIFS
Sbjct  52   VPFVKRIKLATWVEFKLLFYLAAPSVIVYLINYVMSMSTQIFS  94



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R+  ATWIELKLL +LAAPAV+VY+INYLMSMSTQIFS
Sbjct  38   LPFLNRVGPATWIELKLLFFLAAPAVIVYLINYLMSMSTQIFS  80



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  QR   ATWIE+KLL YLAAPAV VY+INYLMSMSTQIFS
Sbjct  43   LPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMSMSTQIFS  85



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL+LAT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFS
Sbjct  54   VPWARRLRLATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFS  96



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            PR +RL+LAT +E+KLL +LAAP V+VYM+NY+MSMSTQIFS
Sbjct  55   PRARRLQLATIVEMKLLVHLAAPTVIVYMLNYVMSMSTQIFS  96



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMSMSTQIFS
Sbjct  43   LPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMSMSTQIFS  85



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL+LAT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFS
Sbjct  54   VPWARRLRLATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFS  96



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSW--TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  312
            +PP     +P  S +  S      +P  QRL  ATW ELKLL  LA PAV VYMINYLMS
Sbjct  16   NPPLSSERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLFRLAGPAVAVYMINYLMS  75

Query  313  MSTQIFS  333
            MSTQIF+
Sbjct  76   MSTQIFA  82



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSW--TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  312
            +PP     +P  S +  S      +P  QRL  ATW ELKLL  LA PAV VYMINYLMS
Sbjct  52   NPPLSSERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLFRLAGPAVAVYMINYLMS  111

Query  313  MSTQIFS  333
            MSTQIF+
Sbjct  112  MSTQIFA  118



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  +R+  ATWIE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  38   PAMRRVGRATWIESKLLFHLAAPAVIVYMINYLMSMSTQIFS  79



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  +RLKLA WIE KLL YLA+PAV+VYMINY+M+MSTQIF+
Sbjct  54   PFLERLKLALWIESKLLFYLASPAVIVYMINYVMAMSTQIFA  95



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +1

Query  58   RTT*LTPSWIRQTALLTTPCRRAMEWFHPPRMRRAKPAMSWRASSWTLXIPRWQRLKLAT  237
            RT  L PS   Q    ++P    M+  H     R +  ++  + SW       +RL+LAT
Sbjct  11   RTPLLGPSDDDQPLPSSSPMAADMDDPHGSS-GRLESILTDTSLSWA------RRLQLAT  63

Query  238  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
             IE+KLL +LAAPAV+VYM+NY+MSMSTQIFS
Sbjct  64   IIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFS  95



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P +QRL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFQRLRKATMIESKLLFNLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P +QRL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  51   PLFQRLRKATMIESKLLFNLAAPAVIVYMINYLMSMSTQIFS  92



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            ++R +  TWIE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  41   FERFRKGTWIESKLLFHLAAPAVIVYMINYLMSMSTQIFS  80



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFS
Sbjct  45   IPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFS  87



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            ++R +  TWIE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  41   FERFRKGTWIESKLLFHLAAPAVIVYMINYLMSMSTQIFS  80



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+
Sbjct  54   PFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFA  95



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+
Sbjct  53   PFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFA  94



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSWTLX---IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  309
            HPP++  +    +       L     P  QRL+ AT IE KLL  LAAPAV+VYMINYLM
Sbjct  15   HPPQLSPSTTESNNGELETVLSDVETPLLQRLRKATMIESKLLFNLAAPAVIVYMINYLM  74

Query  310  SMSTQIFS  333
            SMSTQIFS
Sbjct  75   SMSTQIFS  82



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL  ATW+ELKLL +LAAPAV+VY+INY+MSMSTQIFS
Sbjct  50   VPFAKRLGPATWVELKLLFHLAAPAVIVYLINYVMSMSTQIFS  92



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFS
Sbjct  51   VPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFS  93



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFS
Sbjct  51   VPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFS  93



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMSTQIFS
Sbjct  40   VPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMSTQIFS  82



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +RL LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFS
Sbjct  54   IPWARRLPLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFS  96



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  196  TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
             L  P + RL+ AT IE KLL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  35   DLETPLFPRLRKATMIESKLLFKLAAPAVVVYMINYLMSMSTQIFS  80



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  39   PLFARLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  80



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  QRLK A WIE KLL  LAAPA++VY+INY+MSMSTQIFS
Sbjct  47   PFSQRLKPALWIESKLLVILAAPAIIVYVINYVMSMSTQIFS  88



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  86



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  86



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+IF+
Sbjct  51   FNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRIFA  90



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  86



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  40   PLFLRLRKATMIETKLLFKLAAPAVVVYMINYLMSMSTQIFS  81



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  86



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  86



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  49   PLFLRLRKATMIESKLLFKLAAPAVVVYMINYLMSMSTQIFS  90



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score = 61.2 bits (147),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFS
Sbjct  58   RVRAASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFS  95


 Score = 25.0 bits (53),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 11/50 (22%)
 Frame = +3

Query  81   MDSSNGAA----YDPLPESDGV-------VSSPPHEESEASNELESILMD  197
            M SS  A     YDPLPES  V          P  +  E S  LES+L D
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSD  50



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P +QRL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFQRLRKATMIESKLLFNLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  QRLK A WIE KLL  LAAPA++VY+INY+MSMSTQIFS
Sbjct  47   PFSQRLKPALWIESKLLVILAAPAIIVYVINYVMSMSTQIFS  88



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P + RL+ AT IE KLL  LAAPAV+VYMINY+MSMSTQIF
Sbjct  45   PLFHRLRKATMIESKLLFKLAAPAVIVYMINYMMSMSTQIF  85



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  39   PLFARLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  80



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  39   PLFARLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  80



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFS
Sbjct  50   RRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFS  88



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFLRLRKATMIETKLLFKLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +RL+LATW ELKLL YLA PAV+VYMI Y+MSM+TQIF
Sbjct  52   ERLRLATWTELKLLFYLAGPAVLVYMIGYVMSMATQIF  89



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  49   PLFLRLRKATMIESKLLFKLAAPAVVVYMINYLMSMSTQIFS  90



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFLRLRKATMIETKLLFKLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 41/64 (64%), Gaps = 2/64 (3%)
 Frame = +1

Query  142  PPRMRRAKPAMSWRASSWTLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMST  321
            PP    +   +    S   +  P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMST
Sbjct  20   PPTTESSNGELETVLSD--VETPLFLRLRKATTIESKLLFNLAAPAVIVYMINYLMSMST  77

Query  322  QIFS  333
            QIFS
Sbjct  78   QIFS  81



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQIFS
Sbjct  36   VPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQIFS  78



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQIFS
Sbjct  40   VPFLRRVGSATWIELRLLFFLAAPAVFVYLINYVMSMSTQIFS  82



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMSTQIFS
Sbjct  40   VPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMSTQIFS  82



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            L  P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  36   LETPLFLRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  80



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            L  P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  36   LETPLFPRLRKATMIESKLLFKLAAPAVIVYMINYLMSMSTQIFS  80



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFLRLRKATIIESKLLFNLAAPAVIVYMINYLMSMSTQIFS  81



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  40   PLFLRLRKATIIESKLLFNLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL+LAT +E+KLL +LA PAV VYM+NY+MSMSTQIFS
Sbjct  53   VPWSRRLRLATIVEMKLLLHLAGPAVTVYMLNYVMSMSTQIFS  95



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  29   LPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            + +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF
Sbjct  48   ISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIF  91



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FS
Sbjct  51   RRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFS  89



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            ++RL+LATWIELKLL  LAAPAV+VY++NYLMS+ST++F+
Sbjct  47   FKRLRLATWIELKLLFRLAAPAVLVYIVNYLMSLSTRLFA  86



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  29   LPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  46   LPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIFS  88



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +R+ LA+ IE+KLL +LAAPAV+VYMINY+MSMSTQIFS
Sbjct  54   IPWARRMWLASLIEMKLLVFLAAPAVMVYMINYVMSMSTQIFS  96



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQIFS
Sbjct  23   VPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQIFS  65



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score = 53.1 bits (126),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P +  L+ AT IE KLL  LAAPAV+VYMIN  MSMSTQIFS
Sbjct  44   PLFLCLRKATIIESKLLFKLAAPAVIVYMINNFMSMSTQIFS  85


 Score = 30.0 bits (66),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 5/46 (11%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGNP  209
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAP  44



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            ++RL+LA+WIELKLL  LAAPAV+VY++NYLMS+ST++F+
Sbjct  47   FKRLRLASWIELKLLFRLAAPAVLVYIVNYLMSLSTRVFA  86



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P   RL+ AT IE KLL  LAAPAV+VYMINY MSMSTQIFS
Sbjct  39   PLSSRLRKATMIESKLLFKLAAPAVIVYMINYFMSMSTQIFS  80



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  QRL+ AT IE KLL  LAAPAV+VYMINYLMSMST+IFS
Sbjct  40   PLVQRLRKATMIESKLLFNLAAPAVIVYMINYLMSMSTRIFS  81



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  29   LPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFS
Sbjct  20   IPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFS  62



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R + ATWIE+KLL YLAAPAV VY+INY MS STQIFS
Sbjct  52   RYRRATWIEIKLLFYLAAPAVFVYIINYTMSTSTQIFS  89



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P + RL+ AT IE KLL  LAAPAVVVYMINY MSMSTQIFS
Sbjct  42   PLFLRLRKATMIESKLLFNLAAPAVVVYMINYFMSMSTQIFS  83



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  +RL+LA+W+ELKLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  33   PYSKRLRLASWVELKLLFQLAAPAVIVYLLNNVISMSTQIF  73



>gb|EMS63521.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=110

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P   R+  A  IEL +L  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  25   PLAGRVWAAGAIELGMLLRLAAPAVVMYMINYLMSMSTQIFS  66



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R   ATWIE+KLL YLAAPAV VY+INY MS STQIFS
Sbjct  51   ERYSRATWIEIKLLFYLAAPAVFVYIINYAMSTSTQIFS  89



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSW--TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  312
            +PP     +   S +  S      +P  QRL  AT  E KLL  LA PAV VYMINYLMS
Sbjct  16   NPPLSSEGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLFRLAGPAVAVYMINYLMS  75

Query  313  MSTQIFS  333
            MSTQIF+
Sbjct  76   MSTQIFA  82



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF
Sbjct  15   FQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIF  53



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  33   PYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFS
Sbjct  58   IPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFS  100



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  34   PYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  74



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  241  IELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  31   IELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  44   VPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFS  86



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+LATWIELKLL  LAAPAV VY++N  MS+ST++F+
Sbjct  41   LPYFKRLRLATWIELKLLFRLAAPAVFVYVVNNTMSVSTRVFA  83



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  52   QRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  90



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 2/67 (3%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSW--TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  312
            +PP     +   S +  S      +P  QRL  AT  E KLL  LA PAV VYMINYLMS
Sbjct  16   NPPLSSEGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLFRLAGPAVAVYMINYLMS  75

Query  313  MSTQIFS  333
            MSTQIF+
Sbjct  76   MSTQIFA  82



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+LATWIEL LL  LAAPAV+VY++N  MS+ST++F+
Sbjct  44   LPSFKRLRLATWIELNLLFRLAAPAVLVYVVNNFMSLSTRVFA  86



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R+  A+ +EL+LL  LAAPAVVVYMINYLMSMSTQIFS
Sbjct  56   RRVLAASAVELRLLARLAAPAVVVYMINYLMSMSTQIFS  94



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +1

Query  139  HPP--RMRRAKPAMSWRASSWTLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  312
            +PP    RR++ +    +      +P  QRL  AT  E KLL  LA PAV VYMINYLMS
Sbjct  16   NPPLSSERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLFRLAGPAVAVYMINYLMS  75

Query  313  MSTQIFS  333
            MSTQIF+
Sbjct  76   MSTQIFA  82



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  44   VPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  86



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  42   VPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  84



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  42   VPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  84



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  42   VPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  84



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFS
Sbjct  36   LPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFS  78



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 9/86 (10%)
 Frame = +1

Query  103  LTTPCRRAMEWFHPPRMRRAKPAMSWRASSWT---------LXIPRWQRLKLATWIELKL  255
            L  P   + +  + P ++   P  S R S  +           +P  QRL  AT  E KL
Sbjct  7    LFNPMESSRDGVNEPMLQSNPPLSSERRSETSRQLESILSDTRLPFCQRLLAATSTESKL  66

Query  256  LCYLAAPAVVVYMINYLMSMSTQIFS  333
            L  LA PAV VYMINYLMSMSTQIF+
Sbjct  67   LFRLAGPAVAVYMINYLMSMSTQIFA  92



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL++ATWIELKLL  LAAPAV VY+IN  MS+ST+IF+
Sbjct  41   LPPFKRLRMATWIELKLLFRLAAPAVSVYVINNSMSLSTRIFA  83



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL++ATWIELKLL  LAAPAV+VY+IN  MS+ST++F+
Sbjct  41   LPPFKRLRMATWIELKLLFRLAAPAVLVYVINNSMSLSTRVFA  83



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF
Sbjct  41   FQRLRTATWLETKTLCRLAAPAVVVYLLNNVITLSTQIF  79



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFS
Sbjct  32   LPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFS  74



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++RL++A+W+ELKLL  LAAPAV VY+IN LMS+ST++F
Sbjct  37   FKRLQIASWLELKLLVRLAAPAVFVYLINNLMSLSTRVF  75



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+
Sbjct  55   LPYFKRLRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIY  96



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++SMSTQI+
Sbjct  39   LPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVISMSTQIY  80



>ref|XP_008455546.1| PREDICTED: MATE efflux family protein LAL5-like [Cucumis melo]
Length=177

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A WIELKLL  LAAPAV VYMIN  MSMST+I+S
Sbjct  39   RIRRAAWIELKLLSKLAAPAVFVYMINNFMSMSTRIYS  76



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  35   PYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  75



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RW +   AT IE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  42   LERWGK---ATCIESKLLFHLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF
Sbjct  41   FQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIF  79



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RW +   AT IE KLL +LAAPAV+VYMINYLMSMSTQIFS
Sbjct  42   LERWGK---ATCIESKLLFHLAAPAVIVYMINYLMSMSTQIFS  81



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF
Sbjct  43   FQRIKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIF  81



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFS
Sbjct  45   VPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFS  87



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  45   LPWGRRMVAASVVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  87



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFS
Sbjct  32   LPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFS  74



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFS
Sbjct  32   LPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFS  74



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 13/87 (15%)
 Frame = +1

Query  91   QTALLTTPCRRAMEWFHPPRMRRAKPAMSWRASSW------TLXIPRWQRLKLATWIELK  252
            Q   L TP   +M+       R +    ++ +SS        L +P  +RL+ ATWIELK
Sbjct  4    QDDQLHTPILESMQ-------RSSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELK  56

Query  253  LLCYLAAPAVVVYMINYLMSMSTQIFS  333
            LL  LAAPAV+VY+IN  MS+ST++F+
Sbjct  57   LLFRLAAPAVLVYLINNAMSLSTRVFA  83



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +  +QRL+ ATW+E K+L  LAAPAVVVY++N ++SMSTQIF
Sbjct  38   LSNFQRLRTATWLETKILYRLAAPAVVVYLLNNVISMSTQIF  79



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  52   RRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  90



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR+K ATWIELK L  LAAPA++VYM+N L+SMSTQIF
Sbjct  44   FQRIKKATWIELKNLFRLAAPAILVYMLNNLVSMSTQIF  82



>gb|EMT13256.1| hypothetical protein F775_42803 [Aegilops tauschii]
Length=100

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            A  IEL +L  LAAPAVVVYMINYLMSMSTQ+ 
Sbjct  29   AAAIELGMLARLAAPAVVVYMINYLMSMSTQVL  61



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+
Sbjct  55   LPYFKRLRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIY  96



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IP  +RL+LAT IE+KLL +LA P+V VYM+NY+MSMST I S
Sbjct  53   IPWARRLRLATIIEMKLLLHLAVPSVTVYMLNYVMSMSTTIIS  95



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  211  RWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            RW+RL+ AT IELK+LC LA PAVV Y++  ++SMSTQIF
Sbjct  29   RWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMSTQIF  68



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++RL++A+W+ELKLL  LAAPAV VY+IN LMS+ST++F
Sbjct  37   FKRLQIASWLELKLLVRLAAPAVFVYLINNLMSLSTRVF  75



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFS
Sbjct  32   LPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFS  74



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  196  TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
             + + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F
Sbjct  43   NMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMF  87



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++RL++A+W+ELKLL  LAAPAV VY+IN LMS+ST++F
Sbjct  37   FKRLQIASWLELKLLVRLAAPAVFVYLINNLMSLSTRVF  75



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  +R++LA+W+ELKLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  33   PYSKRVRLASWVELKLLFQLAAPAVIVYLLNNVISMSTQIF  73



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LAT IE+KLL  LAAPAV VYMIN  MS+ST++F
Sbjct  51   LPFFKRLRLATLIEMKLLFRLAAPAVFVYMINNAMSLSTRVF  92



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  52   RRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  90



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A WIELKLL  LAAPAV VY+IN LMSMST+IFS
Sbjct  39   RIRRAAWIELKLLSKLAAPAVFVYLINNLMSMSTRIFS  76



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  52   RRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQIFS  90



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++RL++A+W+ELKLL  LAAPAV VY+IN LMS+ST++F
Sbjct  37   FKRLQIASWLELKLLVRLAAPAVFVYLINNLMSLSTRVF  75



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFS
Sbjct  33   LPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFS  75



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++RL++A+W+ELKLL  LAAPAV VY+IN LMS+ST++F
Sbjct  37   FKRLQIASWLELKLLVRLAAPAVFVYLINNLMSLSTRVF  75



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A WIELKLL  LAAPAV VY+IN LMSMST+IFS
Sbjct  39   RIRRAAWIELKLLSKLAAPAVFVYLINNLMSMSTRIFS  76



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  196  TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
             + + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F
Sbjct  43   NMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMF  87



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LAT IE+KLL  LAAPAV VYMIN  MS+ST++F
Sbjct  51   LPFFKRLRLATLIEMKLLFRLAAPAVFVYMINNAMSLSTRVF  92



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A WIELKLL  LAAPAV VY+IN LMSMST+IFS
Sbjct  39   RIRRAAWIELKLLSKLAAPAVFVYLINNLMSMSTRIFS  76



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A WIELKLL  LAAPAV VY+IN LMSMST+IFS
Sbjct  39   RIRRAAWIELKLLSKLAAPAVFVYLINNLMSMSTRIFS  76



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  33   PYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT +E++L+  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  63   ATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFS  96



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF
Sbjct  20   FQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIF  58



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LAT IE+KLL  LAAPAV VYMIN  MS+ST++F
Sbjct  51   LPFFKRLRLATLIEMKLLFRLAAPAVFVYMINNAMSLSTRVF  92



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT IEL LL  +AAPAVV+YMINYLMSMSTQIFS
Sbjct  36   ATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFS  69



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT IEL LL  +AAPAVV+YMINYLMSMSTQIFS
Sbjct  36   ATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFS  69



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT IEL LL  +AAPAVV+YMINYLMSMSTQIFS
Sbjct  36   ATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFS  69



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P ++RL+LAT IE+KLL  LAAPAV VYMIN  MS+ST++F
Sbjct  51   LPFFKRLRLATLIEMKLLFRLAAPAVFVYMINNAMSLSTRVF  92



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFS
Sbjct  33   LPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFS  75



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFS
Sbjct  33   LPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFS  75



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFS
Sbjct  49   LPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFS  91



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  35   AGGIELRLLARLAAPAVVMYMINYLMSMSTQIFS  68



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT IEL LL  +AAPAVV+YMINYLMSMSTQIFS
Sbjct  36   ATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFS  69



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFS  37



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  54   VPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFS  96



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFS
Sbjct  36   LPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFS  78



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = +1

Query  103  LTTPCRRAMEWFHPPRMRRAKPAMSWRASSWTLX-------IPRWQRLKLATWIELKLLC  261
            L  P   +M    PP    +  + S R     L        +  ++RL+LA+WIEL+L+ 
Sbjct  7    LNQPILNSMHDHQPPPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIF  66

Query  262  YLAAPAVVVYMINYLMSMSTQIF  330
             LAAPA+ VYMIN  MS+ST++F
Sbjct  67   SLAAPAIFVYMINNAMSLSTRVF  89



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = +1

Query  103  LTTPCRRAMEWFHPPRMRRAKPAMSWRASSWTLX-------IPRWQRLKLATWIELKLLC  261
            L  P   +M    PP    +  + S R     L        +  ++RL+LA+WIEL+L+ 
Sbjct  7    LNQPILNSMHDHQPPPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIF  66

Query  262  YLAAPAVVVYMINYLMSMSTQIF  330
             LAAPA+ VYMIN  MS+ST++F
Sbjct  67   SLAAPAIFVYMINNAMSLSTRVF  89



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            R K ATW+ELKLL  LAAPA++VY++N L++MSTQIF
Sbjct  45   RYKKATWVELKLLTRLAAPAIIVYLLNNLLNMSTQIF  81



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMSTQIFS
Sbjct  41   LPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMSTQIFS  83



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            A  IEL+LL  LAAPAVV YMINYLMSMSTQIFS
Sbjct  30   AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFS  63



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            R++ ATWIEL +L +LAAPAVVVY+ N L+SMSTQIF
Sbjct  51   RIQRATWIELGILFHLAAPAVVVYLFNNLISMSTQIF  87



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score = 47.4 bits (111),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL LA+ +E+K L +LAAPAV VY+IN  MS+ T+IF+
Sbjct  37   LPYFRRLYLASMLEMKFLFHLAAPAVFVYLINNGMSILTRIFA  79


 Score = 29.3 bits (64),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGNP  209
            ++ SP  +ESEA + LES+L DT  P
Sbjct  13   LLDSPKPQESEADHRLESVLSDTHLP  38



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF
Sbjct  43   FQRIKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIF  81



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF
Sbjct  43   FQRIKKATWIELKNLFRLAAPAILVYMLNNLVAMSTQIF  81



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  211  RWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
             + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF
Sbjct  33   SFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIF  72



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  54   VPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFS  96



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R + ATWIELKLL  LAAPAV++Y+IN  MSMST+IFS
Sbjct  42   LPCLKRYRKATWIELKLLFKLAAPAVMMYLINNAMSMSTRIFS  84



>ref|XP_006858200.1| hypothetical protein AMTR_s00062p00173640 [Amborella trichopoda]
 gb|ERN19667.1| hypothetical protein AMTR_s00062p00173640 [Amborella trichopoda]
Length=103

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  220  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            R++ A  +E++LL  LAAPAV VY++NY++SM+TQIFS
Sbjct  34   RVRAAIRVEMRLLGQLAAPAVAVYLLNYILSMATQIFS  71



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +1

Query  232  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            A ++E KLLC LA PAV+VYM+NY+MSM+TQIFS
Sbjct  44   AVFLESKLLCRLALPAVIVYMVNYIMSMATQIFS  77



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +RL+LA+ IELKLL  LAAPAV VYMIN  MS+ST++F+
Sbjct  39   LPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFMSLSTRVFA  81



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  241  IELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFS  71



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +PR++RL  AT IEL  L  LAAPAVVVY++N + SMSTQIF
Sbjct  47   LPRFRRLSRATRIELNTLFRLAAPAVVVYLLNNVTSMSTQIF  88



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  23   PRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RL LA+WIELKLL  LAAPAV VY+IN  +S+ST+IFS
Sbjct  51   FMRLGLASWIELKLLFRLAAPAVFVYLINNSLSLSTRIFS  90



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  23   PRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QR +  TW+ELK L  LAAPAVVVY++N ++SMSTQIF
Sbjct  40   FQRFRTGTWLELKTLFRLAAPAVVVYLLNNVISMSTQIF  78



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RL LA+WIELKLL  LAAPAV VY+IN  +S+ST+IFS
Sbjct  51   FMRLGLASWIELKLLFRLAAPAVFVYLINNSLSLSTRIFS  90



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  241  IELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  31   IELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  23   PRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RL LA+WIELKLL  LAAPAV VY+IN  +S+ST+IFS
Sbjct  51   FMRLGLASWIELKLLFRLAAPAVFVYLINNSLSLSTRIFS  90



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++RL+ ATWIEL LL  LAAPAV+VY++N  MS+ST++F+
Sbjct  44   LPFFKRLRSATWIELNLLFRLAAPAVLVYVVNNSMSLSTRVFA  86



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  139  HPPRMRRAKPAMSWRASSWT-LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSM  315
            H  R    +P  S      + +  PR QR+  AT +ELK+L  LAAPA+VVY++N+L+S+
Sbjct  23   HDKRSFSGEPVSSELEEILSVMEFPRSQRILRATRLELKILSRLAAPAIVVYLLNFLISI  82

Query  316  STQIF  330
            ST +F
Sbjct  83   STHVF  87



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +PR++RL  AT IEL  L  LAAPAVVVY++N + SMSTQIF
Sbjct  47   LPRFRRLSRATRIELNTLFRLAAPAVVVYLLNNVTSMSTQIF  88



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  34   PYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF
Sbjct  40   FQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIF  78



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +RL+ A  IELKLL +LA PA  VYMINY+MSMST++FS
Sbjct  41   KRLQSAIVIELKLLFHLATPAAFVYMINYVMSMSTRVFS  79



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            P  +RL  A  +E +LL +LA PAV+VYMINYLMSMSTQI S
Sbjct  50   PFLRRLGPALLMESRLLFHLAGPAVIVYMINYLMSMSTQIVS  91



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF
Sbjct  40   FQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIF  78



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+
Sbjct  44   VPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFA  86



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQIFS
Sbjct  22   LPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQIFS  64



>emb|CBI23252.3| unnamed protein product [Vitis vinifera]
Length=293

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            L +P  +RL  ATWIELKLL  LAAPA++VY+IN  MS+ST++F+
Sbjct  165  LQLPWLRRLLKATWIELKLLFRLAAPAILVYLINNAMSLSTRVFA  209



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P ++R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+
Sbjct  61   LPSFKRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFA  103



>gb|EMT26283.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=86

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +1

Query  241  IELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +EL+LL  LAAPAVVVYMI+Y++SMS QIFS
Sbjct  29   VELRLLSRLAAPAVVVYMISYVISMSRQIFS  59



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P + RL+LA+WIEL+LL  LA PAV++Y+IN  MS+ST+I+
Sbjct  56   LPLFNRLRLASWIELRLLFRLAGPAVMMYLINNAMSVSTRIY  97



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  214  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            + RL LA+WIELKLL  LAAPAV VY+IN  +S+ST+IFS
Sbjct  46   FMRLGLASWIELKLLFRLAAPAVFVYLINNSLSLSTRIFS  85



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI 
Sbjct  38   LSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQIL  79



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI 
Sbjct  38   LSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQIL  79



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            L +P  +RL  ATWIELKLL  LAAPA++VY+IN  MS+ST++F+
Sbjct  39   LQLPWLRRLLKATWIELKLLFRLAAPAILVYLINNAMSLSTRVFA  83



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI 
Sbjct  38   LSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQIL  79



>gb|KDP20759.1| hypothetical protein JCGZ_21230 [Jatropha curcas]
Length=318

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+ LA+ IELKLL  LA PAV VYMIN  MS+ST+IF+
Sbjct  39   LPYLKRIMLASAIELKLLYRLAGPAVFVYMINNFMSLSTRIFA  81



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  241  IELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            IE KLL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  2    IESKLLFNLAAPAVIVYMINYLMSMSTQIF  31



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            +P  +R+ LA+ IELKLL  LA PAV VYMIN LMS+ST+IF+
Sbjct  39   LPYLKRILLASAIELKLLFPLAGPAVFVYMINNLMSLSTRIFA  81



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +1

Query  124  AMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYMI  297
            A+E    P +  +K  + +R  S      +P ++R+ LA  IE+K L +LAAPA+ VY+I
Sbjct  8    AVENMQQPLLEPSKSDLDFRMESVLTDPHLPYYRRVYLAALIEIKFLFHLAAPAIFVYVI  67

Query  298  NYLMSMSTQIFS  333
            N  MSM T+IF+
Sbjct  68   NNGMSMLTRIFA  79



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  196  TLXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
             + + R +R+  AT++ELK+L  LAAPA+VVY++N+L+S+STQIF
Sbjct  43   NMELSRSRRILRATFLELKILFPLAAPAIVVYLLNFLISISTQIF  87



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLLHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  205  IPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF
Sbjct  16   VPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIF  57



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  199  LXIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            + + R  R+  ATW+ELK+L  LAAPA+VVY++N+ +S+STQ+F
Sbjct  44   MELSRSHRILRATWVELKILFPLAAPAIVVYLLNFFVSISTQMF  87



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +1

Query  226  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  333
            ++ + ++++L+  LAAPAV+VYMINYLMSMSTQIFS
Sbjct  80   RVVSQVDMRLMLRLAAPAVLVYMINYLMSMSTQIFS  115



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  208  PRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI 
Sbjct  29   PLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQIL  69



>emb|CDY07256.1| BnaC04g19150D [Brassica napus]
Length=129

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASS--WTLXIPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H   ++ +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRSFIQSSKSFIDYRLETVLTDRELPYFRRIYLALMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+I++
Sbjct  64   INNGMSILTRIYA  76



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +1

Query  124  AMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYMI  297
            A+E    P +  +K  + +R  S      +P ++R+ LA  IE+K L +LAAPA+ VY+I
Sbjct  8    AVENMQQPLLEPSKSDVDFRMESVLTDPHLPYYRRVYLAALIEIKFLFHLAAPAIFVYVI  67

Query  298  NYLMSMSTQIFS  333
            N  MSM T+IF+
Sbjct  68   NNGMSMLTRIFA  79



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++R+ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +1

Query  124  AMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYMI  297
            A+E    P +  +K  + +R  S      +P ++R+ LA  IE+K L +LAAPA+ VY+I
Sbjct  8    AVENLQQPLLEPSKSDVDFRMESVLTDPHLPYYRRVYLAALIEIKFLFHLAAPALFVYVI  67

Query  298  NYLMSMSTQIFS  333
            N  MSM T+IF+
Sbjct  68   NNGMSMLTRIFA  79



>gb|ABR18290.1| unknown [Picea sitchensis]
Length=107

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  223  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            ++ A ++E KLL  LA PA+VVYM+NY+MSM+TQIF
Sbjct  44   MRAAVFLESKLLWSLALPAIVVYMVNYIMSMATQIF  79



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H   +  AK  + +R  +      +P  +R+ LA  IE+K L YLAAPA++VY+
Sbjct  4    ESLENLHRSFIESAKSFIDYRLETVLTDRELPYLRRIYLAMMIEMKFLFYLAAPAILVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>ref|XP_006391951.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 gb|ESQ29237.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=452

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++++ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFIDYRLETVLTDRELPYYRKIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  330
            QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF
Sbjct  536  QRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIF  573


 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  217  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  327
            QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI
Sbjct  46   QRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQI  82



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASSWTLX--IPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++++ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFIDYRLETVLTDRELPYYRKIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +1

Query  121  RAMEWFHPPRMRRAKPAMSWRASS--WTLXIPRWQRLKLATWIELKLLCYLAAPAVVVYM  294
             ++E  H P +  +K  + +R  +      +P ++++ LA  IE+K L +LAAPA+ VY+
Sbjct  4    ESLENLHRPLIESSKSFIDYRLETVLTDQELPYFRKIYLAMMIEMKFLFHLAAPAIFVYV  63

Query  295  INYLMSMSTQIFS  333
            IN  MS+ T+IF+
Sbjct  64   INNGMSILTRIFA  76



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562698116640