BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF032M24

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    227   7e-70   Sesamum indicum [beniseed]
gb|ABI84250.1|  thiamine biosynthetic enzyme                            218   3e-68   Arachis hypogaea [goober]
emb|CDO99712.1|  unnamed protein product                                223   3e-68   Coffea canephora [robusta coffee]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                223   4e-68   Erythranthe guttata [common monkey flower]
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    220   4e-67   Sesamum indicum [beniseed]
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   217   3e-66   Citrus sinensis [apfelsine]
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             218   3e-66   Citrus clementina [clementine]
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             218   4e-66   Phaseolus vulgaris [French bean]
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          218   4e-66   Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             218   5e-66   Citrus clementina [clementine]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   218   5e-66   Citrus sinensis [apfelsine]
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             217   7e-66   Gossypium arboreum [tree cotton]
gb|ACV52582.1|  thiazole biosynthetic enzyme                            210   1e-65   Nicotiana benthamiana
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    216   2e-65   Citrus sinensis [apfelsine]
gb|KJB67127.1|  hypothetical protein B456_010G176000                    213   2e-64   Gossypium raimondii
gb|KJB57702.1|  hypothetical protein B456_009G176400                    211   2e-64   Gossypium raimondii
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    212   7e-64   Vitis vinifera
gb|AFM35683.1|  thiamin biosynthetic protein                            212   8e-64   Vitis pseudoreticulata
gb|KJB57700.1|  hypothetical protein B456_009G176400                    212   8e-64   Gossypium raimondii
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    212   9e-64   Cucumis sativus [cucumbers]
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             211   9e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    211   1e-63   Populus euphratica
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    211   1e-63   Solanum lycopersicum
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    211   1e-63   Nicotiana sylvestris
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      211   1e-63   Nicotiana tabacum [American tobacco]
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    211   1e-63   Cucumis melo [Oriental melon]
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    211   1e-63   Vitis vinifera
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    211   2e-63   Nicotiana tomentosiformis
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       211   3e-63   
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             210   4e-63   Gossypium arboreum [tree cotton]
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    210   4e-63   Prunus mume [ume]
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    209   1e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    207   2e-62   Cicer arietinum [garbanzo]
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    207   4e-62   Fragaria vesca subsp. vesca
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             207   7e-62   Prunus persica
gb|KEH43920.1|  thiazole biosynthetic enzyme                            206   9e-62   Medicago truncatula
gb|EPS63253.1|  hypothetical protein M569_11533                         206   1e-61   Genlisea aurea
gb|AFK44470.1|  unknown                                                 206   1e-61   Medicago truncatula
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                205   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             205   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    205   3e-61   Fragaria vesca subsp. vesca
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    204   7e-61   Glycine max [soybeans]
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    204   1e-60   Glycine max [soybeans]
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    204   1e-60   Solanum tuberosum [potatoes]
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    203   2e-60   Populus euphratica
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    203   2e-60   
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       203   2e-60   
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    203   2e-60   
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    201   5e-60   
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    202   6e-60   
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    202   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    201   1e-59   Populus euphratica
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             201   2e-59   Populus trichocarpa [western balsam poplar]
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         199   4e-59   Jatropha curcas
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    199   4e-59   Tarenaya hassleriana [spider flower]
gb|AFK49080.1|  unknown                                                 194   5e-59   Medicago truncatula
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    199   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            199   6e-59   Picrorhiza kurrooa
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             199   8e-59   Gossypium arboreum [tree cotton]
gb|ADG27845.1|  thiazole biosynthetic enzyme                            199   9e-59   Gossypium hirsutum [American cotton]
emb|CDY42479.1|  BnaA10g08550D                                          196   9e-59   Brassica napus [oilseed rape]
gb|KJB13600.1|  hypothetical protein B456_002G083700                    198   1e-58   Gossypium raimondii
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    197   2e-58   Brachypodium distachyon [annual false brome]
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     201   2e-58   Eucalyptus grandis [rose gum]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    197   3e-58   Ricinus communis
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    197   3e-58   Alnus glutinosa
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    196   6e-58   Brassica rapa
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             194   8e-58   Genlisea aurea
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             196   8e-58   Arabidopsis lyrata subsp. lyrata
gb|AFK49632.1|  unknown                                                 196   9e-58   Lotus japonicus
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    196   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    195   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       194   4e-57   Medicago truncatula
emb|CDY52570.1|  BnaC03g71780D                                          194   5e-57   Brassica napus [oilseed rape]
ref|XP_001767548.1|  predicted protein                                  194   7e-57   
ref|XP_001755171.1|  predicted protein                                  194   7e-57   
emb|CDY43024.1|  BnaA03g11710D                                          193   8e-57   Brassica napus [oilseed rape]
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          193   9e-57   Amborella trichopoda
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    193   1e-56   Brassica rapa
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             193   1e-56   Eutrema salsugineum [saltwater cress]
emb|CDY47441.1|  BnaC09g31160D                                          193   1e-56   Brassica napus [oilseed rape]
gb|ACF85034.1|  unknown                                                 191   2e-56   Zea mays [maize]
ref|XP_001767495.1|  predicted protein                                  192   2e-56   
gb|AFK46185.1|  unknown                                                 192   2e-56   Medicago truncatula
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        192   2e-56   Glycine max [soybeans]
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    192   2e-56   Cicer arietinum [garbanzo]
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         192   3e-56   Triticum urartu
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    191   5e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   5e-56   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            191   5e-56   Glycine max [soybeans]
gb|AGT17015.1|  thiazole biosynthetic enzyme                            191   6e-56   Saccharum hybrid cultivar R570
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    191   6e-56   Theobroma cacao [chocolate]
ref|XP_001753819.1|  predicted protein                                  191   6e-56   
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   6e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001753698.1|  predicted protein                                  191   7e-56   
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                191   9e-56   Saccharum hybrid cultivar R570
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             191   1e-55   Capsella rubella
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                191   1e-55   Saccharum hybrid cultivar R570
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                191   1e-55   Saccharum hybrid cultivar R570
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    191   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    190   1e-55   Cicer arietinum [garbanzo]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          190   2e-55   Sorghum bicolor [broomcorn]
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                190   2e-55   Saccharum hybrid cultivar R570
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    194   2e-55   
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    189   2e-55   Setaria italica
gb|AHA84206.1|  thiamin biosynthetic enzyme                             189   3e-55   Phaseolus vulgaris [French bean]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             189   3e-55   Phaseolus vulgaris [French bean]
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    189   5e-55   Setaria italica
ref|NP_200288.1|  thiazole biosynthetic enzyme                          189   6e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28754.1|  BnaA02g09460D                                          188   8e-55   Brassica napus [oilseed rape]
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    188   1e-54   
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            188   1e-54   Glycine max [soybeans]
gb|ABK22862.1|  unknown                                                 187   2e-54   Picea sitchensis
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        187   2e-54   
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    187   2e-54   
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 186   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          187   3e-54   Sorghum bicolor [broomcorn]
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    186   3e-54   Arabis alpina [alpine rockcress]
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             187   4e-54   Selaginella moellendorffii
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    186   4e-54   Zea mays [maize]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            186   4e-54   Saccharum hybrid cultivar GT28
gb|ABK23376.1|  unknown                                                 187   5e-54   Picea sitchensis
gb|ACF87708.1|  unknown                                                 186   5e-54   Zea mays [maize]
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    186   7e-54   Oryza brachyantha
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    186   7e-54   Brassica rapa
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    186   8e-54   
gb|AFK48432.1|  unknown                                                 186   8e-54   Lotus japonicus
emb|CBI23176.3|  unnamed protein product                                185   1e-53   Vitis vinifera
gb|AAV92535.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             186   1e-53   
ref|NP_001059841.1|  Os07g0529600                                       185   1e-53   
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 185   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|AAV92539.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|AAV92538.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           185   1e-53   Oryza sativa Indica Group [Indian rice]
gb|AAV92531.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|AAV92529.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|EAZ04139.1|  hypothetical protein OsI_26282                          185   1e-53   Oryza sativa Indica Group [Indian rice]
gb|AAV92537.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|AAV92554.1|  thiazole biosynthetic enzyme                            185   1e-53   Pseudotsuga menziesii var. menziesii
gb|AAV92552.1|  thiazole biosynthetic enzyme                            185   2e-53   Pseudotsuga menziesii var. menziesii
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    185   2e-53   Phoenix dactylifera
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    183   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    185   2e-53   Elaeis guineensis
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    184   3e-53   Phoenix dactylifera
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         172   1e-48   
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    172   1e-48   Cicer arietinum [garbanzo]
emb|CDM85402.1|  unnamed protein product                                169   2e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       168   3e-47   Coccomyxa subellipsoidea C-169
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             167   5e-47   Mortierella verticillata NRRL 6337
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                165   4e-46   Erythranthe guttata [common monkey flower]
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             164   1e-45   Mucor circinelloides f. circinelloides 1006PhL
gb|AEO13833.1|  thiazole biosynthetic protein                           158   1e-45   Camellia sinensis [black tea]
gb|ABK95834.1|  unknown                                                 162   1e-45   Populus trichocarpa [western balsam poplar]
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            162   2e-45   Mucor ambiguus
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             160   2e-44   Rhizopus delemar RA 99-880
emb|CEI86767.1|  Putative Thiamine thiazole synthase                    156   3e-44   Rhizopus microsporus
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    159   3e-44   Rhizopus microsporus
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    159   5e-44   Rhizopus microsporus
emb|CDY41008.1|  BnaA02g27980D                                          158   5e-44   Brassica napus [oilseed rape]
gb|KDO30626.1|  hypothetical protein SPRG_04526                         159   7e-44   Saprolegnia parasitica CBS 223.65
emb|CDP05793.1|  unnamed protein product                                157   1e-43   Coffea canephora [robusta coffee]
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       159   1e-43   Aphanomyces astaci
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    156   2e-43   Rhizopus microsporus
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       157   4e-43   Saprolegnia diclina VS20
emb|CEP18429.1|  hypothetical protein                                   157   4e-43   Parasitella parasitica
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    157   4e-43   Aphanomyces invadans
emb|CBI23938.3|  unnamed protein product                                154   5e-43   Vitis vinifera
ref|XP_002784437.1|  conserved hypothetical protein                     154   4e-42   Perkinsus marinus ATCC 50983
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             154   5e-42   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005834399.1|  putative THI4, thiamine                            154   9e-42   Guillardia theta CCMP2712
emb|CAH25337.1|  thiazole biosynthetic enzyme                           153   1e-41   Guillardia theta
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             152   8e-41   
gb|ABR01228.1|  thiazole biosynthetic enzyme                            151   8e-41   Chlorella vulgaris
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   152   9e-41   Citrus sinensis [apfelsine]
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              150   1e-40   Chlorella variabilis
ref|XP_008336996.1|  PREDICTED: thiamine thiazole synthase, chlor...    145   2e-40   
gb|KIY92671.1|  thiamine biosynthetic enzyme                            149   9e-40   Monoraphidium neglectum
ref|XP_001386426.1|  hypothetical protein PICST_50942                   148   2e-39   Scheffersomyces stipitis CBS 6054
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      147   2e-39   
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              147   3e-39   Spathaspora passalidarum NRRL Y-27907
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       146   4e-39   
gb|KIY99977.1|  thiamine biosynthetic enzyme                            147   5e-39   Monoraphidium neglectum
emb|CAA57779.1|  nmt2                                                   145   6e-39   Schizosaccharomyces pombe
ref|NP_596642.1|  thiazole biosynthetic enzyme                          145   1e-38   Schizosaccharomyces pombe
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              146   1e-38   Volvox carteri f. nagariensis
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              146   1e-38   Volvox carteri f. nagariensis
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             144   3e-38   Metarhizium robertsii ARSEF 23
gb|EMG50374.1|  hypothetical protein G210_4595                          144   3e-38   Candida maltosa Xu316
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  144   3e-38   Metarhizium majus ARSEF 297
gb|EDK40113.2|  conserved hypothetical protein                          144   4e-38   Meyerozyma guilliermondii ATCC 6260
ref|XP_001483482.1|  conserved hypothetical protein                     144   5e-38   Meyerozyma guilliermondii ATCC 6260
ref|XP_004199741.1|  Piso0_002284                                       144   5e-38   
ref|XP_004198891.1|  Piso0_002284                                       144   5e-38   
gb|KIW79545.1|  thiamine thiazole synthase                              144   5e-38   Fonsecaea pedrosoi CBS 271.37
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    144   6e-38   Aspergillus oryzae
gb|KHC63824.1|  thiazole biosynthesis enzyme                            144   7e-38   Candida albicans P75010
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      143   8e-38   Phaeoacremonium minimum UCRPA7
gb|EFW21941.1|  thiazole biosynthetic enzyme                            143   9e-38   Coccidioides posadasii str. Silveira
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           144   9e-38   Chlamydomonas reinhardtii
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    143   1e-37   
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    143   1e-37   Coccidioides posadasii C735 delta SOWgp
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       143   1e-37   Aspergillus oryzae RIB40
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  143   1e-37   Metarhizium guizhouense ARSEF 977
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    143   1e-37   Candida tropicalis MYA-3404
gb|AAL86771.2|  THI4 enzyme                                             143   1e-37   Candida albicans
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             143   2e-37   Metarhizium acridum CQMa 102
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    143   2e-37   Candida albicans WO-1
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    143   2e-37   Candida dubliniensis CD36
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   143   2e-37   Candida albicans SC5314
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       142   2e-37   Aspergillus clavatus NRRL 1
gb|KGR10168.1|  thiazole biosynthesis enzyme                            142   3e-37   Candida albicans P57072
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       142   3e-37   Aspergillus niger CBS 513.88
emb|CCK70574.1|  hypothetical protein KNAG_0E03150                      141   3e-37   Kazachstania naganishii CBS 8797
ref|XP_461084.2|  DEHA2F16654p                                          141   4e-37   Debaryomyces hansenii CBS767
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        142   4e-37   Cladophialophora psammophila CBS 110553
gb|KDN61355.1|  putative Thi4 family protein                            142   4e-37   Colletotrichum sublineola
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            142   4e-37   Candida albicans P94015
gb|EQB43457.1|  hypothetical protein CGLO_17887                         141   4e-37   Colletotrichum gloeosporioides Cg-14
gb|EPX71211.1|  thiazole biosynthetic enzyme                            141   4e-37   Schizosaccharomyces octosporus yFS286
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       141   4e-37   Schizosaccharomyces japonicus yFS275
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                141   4e-37   Aspergillus ruber CBS 135680
gb|KHC37210.1|  thiazole biosynthesis enzyme                            142   4e-37   Candida albicans P76067
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 141   4e-37   Aspergillus flavus NRRL3357
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       141   5e-37   Cordyceps militaris CM01
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       141   5e-37   
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             141   5e-37   Neurospora tetrasperma FGSC 2508
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        141   5e-37   Paracoccidioides brasiliensis Pb18
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             141   5e-37   Paracoccidioides brasiliensis Pb03
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    141   5e-37   Aspergillus nidulans FGSC A4
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           141   6e-37   Aspergillus kawachii IFO 4308
gb|KIW92677.1|  thiamine thiazole synthase                              141   6e-37   Cladophialophora bantiana CBS 173.52
ref|NP_982405.1|  AAL137Wp                                              141   7e-37   Eremothecium gossypii ATCC 10895
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             140   8e-37   Exserohilum turcica Et28A
gb|KFX46359.1|  Thiamine thiazole synthase                              140   9e-37   Talaromyces marneffei PM1
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       140   9e-37   Talaromyces marneffei ATCC 18224
ref|XP_750725.1|  thiazole biosynthesis enzyme                          140   9e-37   Aspergillus fumigatus Af293
gb|AGO09853.1|  AaceriAAL137Wp                                          140   1e-36   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_007835960.1|  Thiamine thiazole synthase                         140   1e-36   Pestalotiopsis fici W106-1
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  140   1e-36   Epichloe typhina
gb|KEY78369.1|  thiazole biosynthesis enzyme                            140   1e-36   Aspergillus fumigatus var. RP-2014
ref|XP_003044703.1|  predicted protein                                  140   1e-36   [Nectria] haematococca mpVI 77-13-4
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    140   1e-36   Aspergillus terreus NIH2624
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  140   1e-36   Ustilaginoidea virens
gb|EEH38204.2|  thiazole biosynthesis enzyme                            141   1e-36   Paracoccidioides lutzii Pb01
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                       140   1e-36   Wickerhamomyces ciferrii
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           140   1e-36   Talaromyces cellulolyticus
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  140   1e-36   Metarhizium album ARSEF 1941
gb|KGQ06713.1|  Thiamine thiazole synthase                              139   2e-36   Beauveria bassiana D1-5
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         139   2e-36   Beauveria bassiana ARSEF 2860
gb|EFQ30532.1|  Thi4 family protein                                     139   2e-36   Colletotrichum graminicola M1.001
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       139   2e-36   Aspergillus fischeri NRRL 181
gb|ENH83973.1|  thiazole biosynthetic enzyme                            139   2e-36   
gb|KIX99472.1|  thiamine thiazole synthase                              139   3e-36   Fonsecaea multimorphosa CBS 102226
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        139   3e-36   Capronia coronata CBS 617.96
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            138   3e-36   Aphanomyces astaci
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        139   3e-36   Exophiala dermatitidis NIH/UT8656
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              139   3e-36   Beauveria bassiana
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       139   3e-36   Talaromyces stipitatus ATCC 10500
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              139   3e-36   Bipolaris sorokiniana ND90Pr
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       139   3e-36   Microsporum canis CBS 113480
gb|EPY53594.1|  thiazole biosynthetic enzyme                            139   3e-36   Schizosaccharomyces cryophilus OY26
ref|XP_499918.1|  YALI0A09768p                                          139   3e-36   Yarrowia lipolytica CLIB122
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              139   4e-36   Bipolaris oryzae ATCC 44560
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            139   4e-36   Leptosphaeria maculans JN3
gb|KIW29175.1|  thiamine thiazole synthase                              139   4e-36   Cladophialophora immunda
ref|XP_002551959.1|  KLTH0B03916p                                       139   4e-36   Lachancea thermotolerans CBS 6340
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        139   4e-36   Candida orthopsilosis Co 90-125
gb|EHN02289.1|  Thi4p                                                   139   4e-36   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        139   4e-36   Fusarium avenaceum
emb|CCF45087.1|  thiazole biosynthetic enzyme                           138   5e-36   Colletotrichum higginsianum
gb|ACN39013.1|  thiazole synthase                                       138   5e-36   Epichloe festucae
gb|KEQ59396.1|  Thi4-domain-containing protein                          138   5e-36   Aureobasidium melanogenum CBS 110374
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             139   6e-36   Trichophyton interdigitale MR816
gb|EGD98433.1|  Thi4 family protein                                     139   6e-36   Trichophyton tonsurans CBS 112818
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  138   6e-36   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_003013828.1|  hypothetical protein ARB_07940                     139   6e-36   Trichophyton benhamiae CBS 112371
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      138   6e-36   
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  138   6e-36   Epichloe festucae var. lolii
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        138   7e-36   
ref|XP_003235740.1|  Thi4 family protein                                138   7e-36   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             138   7e-36   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       138   7e-36   
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      139   8e-36   
gb|KIV92747.1|  thiamine thiazole synthase                              138   1e-35   
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              137   1e-35   
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    137   1e-35   
gb|KIW21130.1|  thiamine thiazole synthase                              138   1e-35   
ref|XP_003297921.1|  hypothetical protein PTT_08482                     137   1e-35   
gb|KIX08964.1|  thiamine thiazole synthase                              137   1e-35   
gb|EGA62236.1|  Thi4p                                                   136   1e-35   
gb|KFY84898.1|  hypothetical protein V500_08902                         137   1e-35   
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   137   1e-35   
gb|KFZ11494.1|  hypothetical protein V502_07520                         137   1e-35   
ref|NP_011660.1|  thiamine thiazole synthase                            137   2e-35   
pdb|3FPZ|A  Chain A, Saccharomyces Cerevisiae Thi4p Is A Suicide ...    137   2e-35   
gb|AJR77233.1|  Thi4p                                                   137   2e-35   
gb|EDN61733.1|  thiamine metabolism-related protein                     137   2e-35   
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               137   2e-35   
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              137   2e-35   
ref|XP_002564812.1|  Pc22g07960                                         137   2e-35   
gb|KFY94986.1|  hypothetical protein V498_03597                         137   2e-35   
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    137   2e-35   
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   137   2e-35   
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             137   2e-35   
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           137   2e-35   
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       137   2e-35   
gb|KFZ09843.1|  hypothetical protein V501_05470                         137   2e-35   
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            137   2e-35   
gb|KFY08103.1|  hypothetical protein V492_06538                         137   2e-35   
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    137   2e-35   
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    137   2e-35   
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    137   2e-35   
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    137   2e-35   
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 137   2e-35   
gb|EWG49587.1|  thiamine biosynthetic enzyme                            137   2e-35   
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             137   2e-35   
ref|XP_001904665.1|  hypothetical protein                               135   2e-35   
gb|KFY70117.1|  hypothetical protein V499_09439                         137   2e-35   
gb|EPE04284.1|  thiazole biosynthetic enzyme                            137   2e-35   
gb|KFX98431.1|  hypothetical protein O988_04337                         137   2e-35   
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  136   3e-35   
gb|KIV86533.1|  thiamine thiazole synthase                              137   3e-35   
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              136   3e-35   
gb|KFY24905.1|  hypothetical protein V493_04960                         136   3e-35   
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                136   3e-35   
ref|XP_003005955.1|  STI35 protein                                      135   3e-35   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             136   4e-35   
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            136   4e-35   
gb|KFY43107.1|  hypothetical protein V494_02101                         136   4e-35   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           136   4e-35   
gb|KFY20175.1|  hypothetical protein V491_03934                         136   4e-35   
gb|EWH18379.1|  Thi4p                                                   136   5e-35   
ref|XP_001526313.1|  hypothetical protein LELG_02871                    136   5e-35   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            137   5e-35   
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        136   5e-35   
gb|EXK40264.1|  thiamine biosynthetic enzyme                            136   6e-35   
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       135   6e-35   
gb|EPS32049.1|  hypothetical protein PDE_07008                          135   7e-35   
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       135   7e-35   
gb|EFW98890.1|  thiazole biosynthetic enzyme                            135   7e-35   
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 135   7e-35   
ref|XP_002498498.1|  ZYRO0G11726p                                       135   7e-35   
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   135   7e-35   
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    135   8e-35   
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   135   8e-35   
emb|CAY79903.1|  Thi4p                                                  135   8e-35   
emb|CDG58547.1|  Thi4 protein                                           135   8e-35   
emb|CDG58548.1|  Thi4-1 protein                                         135   9e-35   
emb|CDG58549.1|  Thi4-2 protein                                         135   9e-35   
gb|EWG49586.1|  thiamine biosynthetic enzyme                            137   9e-35   
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       135   1e-34   
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        135   1e-34   
gb|KIW39395.1|  thiamine thiazole synthase                              135   1e-34   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   135   1e-34   
gb|EGA78748.1|  Thi4p                                                   135   1e-34   
emb|CDO93401.1|  unnamed protein product                                135   1e-34   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    135   1e-34   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    135   1e-34   
gb|AJP38917.1|  Thi4p                                                   135   1e-34   
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    135   1e-34   
gb|EEH05819.1|  thiazole biosynthetic enzyme                            135   1e-34   
gb|EER41684.1|  thiazole biosynthetic enzyme                            135   1e-34   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       134   2e-34   
gb|KEZ45124.1|  Thiamine thiazole synthase                              134   2e-34   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     132   2e-34   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            134   2e-34   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       134   2e-34   
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    134   2e-34   
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    134   2e-34   
ref|XP_009648318.1|  STI35 protein                                      134   2e-34   
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             134   2e-34   
gb|ACB70465.1|  thiazole biosynthetic enzyme                            134   2e-34   
ref|XP_004179275.1|  hypothetical protein TBLA_0B09390                  134   3e-34   
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            134   3e-34   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                  134   3e-34   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             134   3e-34   
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       134   3e-34   
ref|XP_449395.1|  hypothetical protein                                  134   3e-34   
ref|XP_003647237.1|  hypothetical protein Ecym_6012                     134   3e-34   
ref|XP_004181884.1|  hypothetical protein TBLA_0H00760                  134   3e-34   
emb|CDG58546.1|  Thi4 protein                                           134   4e-34   
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                133   4e-34   
gb|KIH92073.1|  thiamine biosynthetic enzyme                            134   5e-34   
gb|KEQ82031.1|  Thi4-domain-containing protein                          133   5e-34   
gb|ESW99744.1|  Thiamine thiazole synthase                              132   5e-34   
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    133   6e-34   
gb|AGT99181.1|  thiazole biosynthetic enzyme                            133   6e-34   
gb|KIW54196.1|  thiamine thiazole synthase                              132   8e-34   
gb|EUC66166.1|  thiamine thiazole synthase                              132   8e-34   
gb|EGA86663.1|  Thi4p                                                   132   8e-34   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        132   8e-34   
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            132   9e-34   
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  132   1e-33   
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    133   1e-33   
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        132   1e-33   
ref|XP_451008.1|  hypothetical protein                                  132   1e-33   
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    132   1e-33   
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   132   2e-33   
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         132   2e-33   
emb|CEP62770.1|  LALA0S06e03400g1_1                                     132   2e-33   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    131   3e-33   
gb|KFY50717.1|  hypothetical protein V496_09214                         136   3e-33   
gb|KIW68442.1|  thiamine thiazole synthase                              131   3e-33   
gb|KFY37341.1|  hypothetical protein V495_07232                         136   3e-33   
gb|KFX95262.1|  hypothetical protein V490_03958                         136   4e-33   
emb|CDH15474.1|  probable Thiamine thiazole synthase                    130   4e-33   
emb|CDF87469.1|  BN860_07074g1_1                                        130   4e-33   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    131   4e-33   
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              130   6e-33   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                           130   9e-33   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   130   1e-32   
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             129   1e-32   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       129   2e-32   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  129   2e-32   
gb|KGK37032.1|  hypothetical protein JL09_g3847                         129   2e-32   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              129   2e-32   
gb|ACN36998.1|  unknown                                                 126   2e-32   
gb|EIF46156.1|  thiazole biosynthetic enzyme                            129   2e-32   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        129   2e-32   
ref|XP_003669189.1|  hypothetical protein NDAI_0C02860                  129   3e-32   
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                  129   3e-32   
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 129   3e-32   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             128   5e-32   
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       127   8e-32   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            128   1e-31   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       127   1e-31   
gb|EJT96874.1|  thiazole biosynthetic enzyme                            127   1e-31   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    126   2e-31   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    126   2e-31   
gb|KFA66874.1|  hypothetical protein S40285_02303                       126   2e-31   
ref|XP_009269436.1|  Thiamine thiazole synthase                         126   2e-31   
gb|KIJ50951.1|  hypothetical protein M422DRAFT_101777                   122   3e-31   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             125   4e-31   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              125   4e-31   
gb|EMS18749.1|  thiamine biosynthetic enzyme                            126   5e-31   
gb|KEY67925.1|  hypothetical protein S7711_02133                        124   7e-31   
dbj|GAK64104.1|  thi4-domain-containing protein                         125   8e-31   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    124   1e-30   
ref|XP_006957782.1|  Thi4-domain-containing protein                     124   1e-30   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   124   1e-30   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      124   1e-30   
gb|EST05805.1|  flavin-binding monooxygenase-like                       124   1e-30   
gb|ETS60793.1|  hypothetical protein PaG_04705                          124   1e-30   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   124   1e-30   
gb|AFG52195.1|  hypothetical protein UMN_CL97Contig1_06                 117   1e-30   
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            128   2e-30   
ref|XP_003683090.1|  hypothetical protein TDEL_0H00200                  124   2e-30   
gb|AEW09378.1|  hypothetical protein UMN_CL97Contig1_06                 116   3e-30   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      122   7e-30   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  122   1e-29   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  121   1e-29   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       121   1e-29   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   121   1e-29   
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       121   1e-29   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 120   2e-29   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   120   3e-29   
ref|XP_008037799.1|  Thi4-domain-containing protein                     120   4e-29   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             121   4e-29   
ref|XP_007304939.1|  Thi4-domain-containing protein                     120   4e-29   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   120   4e-29   
ref|XP_007866883.1|  Thi4-domain-containing protein                     120   5e-29   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    119   5e-29   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  119   7e-29   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             119   7e-29   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  119   8e-29   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  119   9e-29   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   119   1e-28   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               119   1e-28   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    119   1e-28   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       119   1e-28   
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                  118   1e-28   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             118   1e-28   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 118   2e-28   
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      118   2e-28   
emb|CCM00650.1|  predicted protein                                      118   2e-28   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    117   3e-28   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   117   3e-28   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    117   4e-28   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                    117   4e-28   
emb|CCV00434.1|  unnamed protein product                                117   5e-28   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  117   7e-28   
ref|XP_007364009.1|  Thi4-domain-containing protein                     117   7e-28   
ref|XP_007768494.1|  Thi4-domain-containing protein                     116   9e-28   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  116   1e-27   
gb|KIY62047.1|  thiazole biosynthetic enzyme                            115   1e-27   
gb|KIY43384.1|  Thi4-domain-containing protein                          115   1e-27   
ref|XP_001754158.1|  predicted protein                                  114   2e-27   
gb|ACZ34282.1|  thiazole synthase                                       115   4e-27   
ref|XP_001731131.1|  hypothetical protein MGL_1314                      114   6e-27   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       111   6e-26   
gb|ELU45290.1|  thiazole biosynthetic enzyme                            109   7e-24   
emb|CDK26023.1|  unnamed protein product                                103   2e-23   
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                  100   2e-22   
ref|XP_007277744.1|  thiazole biosynthetic enzyme                       100   3e-22   
ref|XP_003344754.1|  hypothetical protein SMAC_06409                  99.4    1e-21   
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                87.0    2e-17   
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic        87.4    5e-17   
ref|WP_013681434.1|  ribulose-1,5-biphosphate synthetase              82.8    6e-16   
ref|WP_018193037.1|  MULTISPECIES: hypothetical protein               80.1    6e-15   



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 2/139 (1%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            FFD  KSSF+G+P+ +   Q ++A+ H NLSV+ S  PY+LD+FKF PIKESIV+REMTR
Sbjct  17   FFDN-KSSFHGSPIPTRAAQPIRATPH-NLSVTMSSAPYNLDNFKFHPIKESIVSREMTR  74

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSA
Sbjct  75   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSA  134

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELE+EY+
Sbjct  135  MVVRKPAHRFLDELEIEYD  153



>gb|ABI84250.1| thiamine biosynthetic enzyme [Arachis hypogaea]
Length=201

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHH--NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            S+F+GTPV +SRV  +K+       +S+S +  PY L SFKFQPIKESIVAREMTRRYMT
Sbjct  18   SAFHGTPVATSRVTPIKSQQQQSQTISMSMATPPYDLQSFKFQPIKESIVAREMTRRYMT  77

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDVIVVGAGSAGLSCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVR
Sbjct  78   DMITYADTDVIVVGAGSAGLSCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVR  137

Query  493  KPAQVFLDELEVEYE  537
            KPA  FLDELEV Y+
Sbjct  138  KPAHRFLDELEVAYD  152



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = +1

Query  124  FDAAKSSFNGTPVVSSRVQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            F   KSSF+G+P++S RVQ VK+S  + ++++SAS   Y+ D+FKFQPI+ESIV+REMTR
Sbjct  16   FLETKSSFHGSPILS-RVQPVKSSPQNFSVTMSASTPQYNFDAFKFQPIQESIVSREMTR  74

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSA
Sbjct  75   RYMTDMITYADTDVVVVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSA  134

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELEVEY+
Sbjct  135  MVVRKPAHKFLDELEVEYD  153



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            FFD  KS+F+G  VV +R      S+  NL+V+ + TPY+LD FKFQPIKESIVAREMTR
Sbjct  17   FFDN-KSTFHGAAVVPTRAAQPIKSTPKNLAVAMASTPYNLDDFKFQPIKESIVAREMTR  75

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP++ +AIIEQSVSPGGGAWLGGQLFSA
Sbjct  76   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDINIAIIEQSVSPGGGAWLGGQLFSA  135

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELE+EY+
Sbjct  136  MVVRKPAHKFLDELEIEYD  154



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 124/140 (89%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHT-PYSLDSFKFQPIKESIVAREMT  297
            FFD  KSSF+G+P+ +  VQ +K S+  +L+++ S   PY+LD+FKFQPIKESIV+REMT
Sbjct  17   FFDN-KSSFHGSPLSTRAVQPIK-SAPQSLAITMSAAAPYNLDNFKFQPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDELEVEY+
Sbjct  135  AMVVRKPAHKFLDELEVEYD  154



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS--RVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVARE  291
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQL
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQL  136

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL ++Y+
Sbjct  137  FSAMVVRKPAHIFLDELGIDYD  158



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 121/136 (89%), Gaps = 2/136 (1%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSH-HNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYM  309
            KSSF+G+P+++SRV  +++SS     ++S S TP Y  +SF F PIKESIV+REMTRRYM
Sbjct  24   KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYM  83

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            TDM+TYADTDVIVVGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVV
Sbjct  84   TDMVTYADTDVIVVGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVV  143

Query  490  RKPAQVFLDELEVEYE  537
            RKPAQ+FLDEL VEY+
Sbjct  144  RKPAQIFLDELGVEYD  159



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 118/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            FFD   +SF+G PV  SR+   K+SS    +S+S +  PY L SFKFQPIKESIV+REMT
Sbjct  17   FFDHKPTSFHGKPVSQSRLTPTKSSSKQPTISMSLTPPPYDLQSFKFQPIKESIVSREMT  76

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP V VAIIEQSVSPGGGAWLGGQLFS
Sbjct  77   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPAVSVAIIEQSVSPGGGAWLGGQLFS  136

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FLDEL V+Y+
Sbjct  137  AMVVRKPAHLFLDELGVDYD  156



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS--RVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVARE  291
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQL
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQL  136

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL ++Y+
Sbjct  137  FSAMVVRKPAHIFLDELGIDYD  158



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS--RVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVARE  291
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQL
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQL  136

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL ++Y+
Sbjct  137  FSAMVVRKPAHIFLDELGIDYD  158



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS--RVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVARE  291
             FD   SSF+G P+  S  R+Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+RE
Sbjct  20   LFD---SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE  76

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQL
Sbjct  77   MTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQL  136

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL ++Y+
Sbjct  137  FSAMVVRKPAHIFLDELGIDYD  158



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+  SR   +K+SSH N ++S S TP Y L SFKFQPIKES V+REMT
Sbjct  19   FLDHNKSSFSGTPI-PSRFTPIKSSSH-NSAISMSLTPPYDLQSFKFQPIKESYVSREMT  76

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM D+ITYADTDVI+VGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  77   RRYMMDIITYADTDVIIVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFS  136

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL ++Y+
Sbjct  137  AMVVRKPAHRFLDELGIQYD  156



>gb|ACV52582.1| thiazole biosynthetic enzyme [Nicotiana benthamiana]
Length=160

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 121/143 (85%), Gaps = 4/143 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHH---NLSVSASHTPYSLDSFKFQPIKESIVAR  288
            F D  KSSF+G P+ S +RV+ VK +  +   ++S  +S  PY L++F F PIKESIV+R
Sbjct  13   FLDTHKSSFSGVPLFSQARVKPVKYAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSR  72

Query  289  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQ  468
            EMTRRYMTDMITYADTDV++VGAGSAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQ
Sbjct  73   EMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQ  132

Query  469  LFSAMVVRKPAQVFLDELEVEYE  537
            LFSAMVVRKPA +FL+EL ++Y+
Sbjct  133  LFSAMVVRKPAHLFLNELGIDYD  155



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSH-HNLSVSASHTP-YSLDSFKFQPIKESIVAREM  294
            F D  KSSF+G+P+++SRV  +++SS     ++S S TP Y  +SF F PIKESIV+REM
Sbjct  20   FLDH-KSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREM  78

Query  295  TRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLF  474
            TRRYMTDM+TYADTDVIVVGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLF
Sbjct  79   TRRYMTDMVTYADTDVIVVGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLF  138

Query  475  SAMVVRKPAQVFLDELEVEYE  537
            SAMVVRKPAQ FLDEL VEY+
Sbjct  139  SAMVVRKPAQRFLDELGVEYD  159



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GT +  SR   +K+SSH N ++S S TP Y L SF+FQPIKES V+REMT
Sbjct  19   FLDHNKSSFSGTQI-PSRFTPIKSSSH-NSAISMSLTPPYDLQSFEFQPIKESYVSREMT  76

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDVI+VGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  77   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFS  136

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL ++Y+
Sbjct  137  AMVVRKPAHRFLDELGIQYD  156



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ +SR   +K+SS    ++S S TP Y L SFKFQPIKES VAREMT
Sbjct  19   FLDH-KSSFHGTPL-ASRFTPIKSSSQ-TATISMSLTPPYDLQSFKFQPIKESYVAREMT  75

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDVI+VGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  76   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFS  135

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL ++Y+
Sbjct  136  AMVVRKPAHRFLDELGIQYD  155



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   212 bits (539),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = +1

Query  124  FDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            FD  KSSF+G P+ + +R+  VK S+  NL+V+A+  PY L SFKF+PIKESIV+REMTR
Sbjct  17   FDPHKSSFHGVPIATQARLSPVK-STPVNLAVTAAAMPYDLRSFKFEPIKESIVSREMTR  75

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYM DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFS+
Sbjct  76   RYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSS  135

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDEL +EY+
Sbjct  136  MVVRKPAHRFLDELGLEYD  154



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 122/140 (87%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVS-ASHTPYSLDSFKFQPIKESIVAREMT  297
            FFD  KSSF+G+P+ S RV  +K S H + ++S +S +PY L SFKF+PIKESIVAREMT
Sbjct  19   FFDN-KSSFHGSPI-SYRVLPIKVS-HQSPTISMSSASPYDLQSFKFEPIKESIVAREMT  75

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDV++VGAGSAGLSCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  76   RRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFS  135

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL +EY+
Sbjct  136  AMVVRKPAHHFLDELGIEYD  155



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ +SR   +K+SS    ++S S TP Y L SFKFQPIKES VAREMT
Sbjct  19   FLDH-KSSFHGTPL-ASRFTPIKSSSQ-TATISMSLTPPYDLQSFKFQPIKESYVAREMT  75

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDVI+VGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  76   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFS  135

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL ++Y+
Sbjct  136  AMVVRKPAHRFLDELGIQYD  155



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   212 bits (539),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHNLSVSAS--HTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            SSF+GTP+ S     +K+++  +L++SAS    PY L+ FKF PI+ESIV+REMTRRYMT
Sbjct  21   SSFHGTPLASPSSLRLKSTAATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMT  80

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDV++VGAGSAGLSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVR
Sbjct  81   DMITYADTDVVIVGAGSAGLSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVR  140

Query  493  KPAQVFLDELEVEYE  537
            KPA +FLDE+ VEY+
Sbjct  141  KPAHLFLDEVGVEYD  155



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS-RVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ ++ R   +K++S   +++S +   Y L SFKFQPIKESIV+REMT
Sbjct  17   FLDH-KSSFHGTPITTTGRFTPIKSTSPA-ITMSLTQPSYDLQSFKFQPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDM+TYADTDV+VVGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMVTYADTDVVVVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA  FLDELE+EY+
Sbjct  135  AMIVRKPAHRFLDELEIEYD  154



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS-RVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ ++ R   +K++S   +++S +   Y L SFKFQPIKESIV+REMT
Sbjct  17   FLDH-KSSFHGTPITTTGRFTPIKSTSSA-ITMSLAQPSYDLQSFKFQPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDM+TYADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA  FLDELE+EY+
Sbjct  135  AMIVRKPAHRFLDELEIEYD  154



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 5/143 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVSAS---HTPYSLDSFKFQPIKESIVAR  288
            F D  KSSF G P+ S +R++ VK S+  N+SVS S     PY L SF F PIKESIVAR
Sbjct  15   FIDTHKSSFYGVPISSQTRLKIVK-STPQNMSVSMSADASPPYDLGSFSFNPIKESIVAR  73

Query  289  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQ  468
            EMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SKNPNV+VAI+EQSVSPGGGAWLGGQ
Sbjct  74   EMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVQVAILEQSVSPGGGAWLGGQ  133

Query  469  LFSAMVVRKPAQVFLDELEVEYE  537
            LFSAMVVRKPA +FL+EL ++Y+
Sbjct  134  LFSAMVVRKPAHLFLNELGIDYD  156



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 6/144 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVS----ASHTPYSLDSFKFQPIKESIVA  285
            F D  KSSF+G P+ S +R++ VK S+  N+++S    +S  PY L++F F PIKESIV+
Sbjct  18   FLDTHKSSFSGVPLFSQARLKPVK-SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVS  76

Query  286  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGG  465
            REMTRRYMTDMITYADTDV++VGAGSAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGG
Sbjct  77   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGG  136

Query  466  QLFSAMVVRKPAQVFLDELEVEYE  537
            QLFSAMVVRKPA +FL+EL ++Y+
Sbjct  137  QLFSAMVVRKPAHLFLNELGIDYD  160



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 123/144 (85%), Gaps = 6/144 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVS----ASHTPYSLDSFKFQPIKESIVA  285
            F D  KSSF+G P+ S +R++ VK S+  N+++S    +S  PY L++F F PIKESIV+
Sbjct  18   FLDTHKSSFSGVPLFSQARLKPVK-SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVS  76

Query  286  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGG  465
            REMTRRYMTDMITYADTDV++VGAGSAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGG
Sbjct  77   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGG  136

Query  466  QLFSAMVVRKPAQVFLDELEVEYE  537
            QLFSAMVVRKPA +FL+EL ++Y+
Sbjct  137  QLFSAMVVRKPAHLFLNELGIDYD  160



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVK--ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            SSF+GTP+ S     +K  A++   +S SAS  PY L+ FKF PI+ESIV+REMTRRYMT
Sbjct  21   SSFHGTPLASPPSLRLKSPAATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMT  80

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDVI+VGAGSAGLSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVR
Sbjct  81   DMITYADTDVIIVGAGSAGLSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVR  140

Query  493  KPAQVFLDELEVEYE  537
            KPA +FLDE+ VEY+
Sbjct  141  KPAHLFLDEVGVEYD  155



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   211 bits (538),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 121/140 (86%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASH-TPYSLDSFKFQPIKESIVAREMT  297
            FFD  KSSF+G+P+ S RV  +K S H + ++S S  +PY L SFKF+PIKESIVAREMT
Sbjct  19   FFDN-KSSFHGSPI-SYRVLPIKVS-HQSPTISMSSVSPYDLQSFKFEPIKESIVAREMT  75

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDV++VGAGSAGLSCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  76   RRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFS  135

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL +EY+
Sbjct  136  AMVVRKPAHHFLDELGIEYD  155



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   211 bits (536),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 6/144 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS-RVQAVKASSHHNLSVS----ASHTPYSLDSFKFQPIKESIVA  285
            F D  KSSF+G P+ S  R++ VK S+  N+++S    +S  PY L++F F PIKESIV+
Sbjct  19   FLDTHKSSFSGIPLFSQVRLKPVK-SAQQNMTISMSADSSPPPYDLNAFTFNPIKESIVS  77

Query  286  REMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGG  465
            REMTRRYMTDMITYADTDV++VGAGSAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGG
Sbjct  78   REMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGG  137

Query  466  QLFSAMVVRKPAQVFLDELEVEYE  537
            QLFSAMVVRKPA +FL+EL ++Y+
Sbjct  138  QLFSAMVVRKPAHLFLNELGIDYD  161



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHN-LSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ +SR   +++SS  + +S+S +  PY L SF FQPIKES VAREMT
Sbjct  50   FLDH-KSSFHGTPI-ASRFTPIRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVAREMT  107

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDVI+VGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  108  RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFS  167

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FLDEL ++Y+
Sbjct  168  AMVVRKPAHIFLDELGIQYD  187



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
            F D  KSSF+GTP+ +SR   +K+SS  + ++S S TP Y L SFKFQPI+ES VAREMT
Sbjct  19   FLDH-KSSFHGTPL-ASRFTPIKSSSQIS-TISMSLTPPYDLQSFKFQPIQESYVAREMT  75

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMITYADTDVI+VGAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFS
Sbjct  76   RRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFS  135

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FLDEL ++Y+
Sbjct  136  AMVVRKPAHRFLDELGIQYD  155



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   210 bits (534),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 120/140 (86%), Gaps = 9/140 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKA---SSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMT  297
            SSF+GTPVV  R+Q  KA   S++H LSVS S    TP Y L +FKF PIKESIV+REMT
Sbjct  25   SSFHGTPVV--RLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMT  82

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  83   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFS  142

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FL+EL + Y+
Sbjct  143  AMVVRKPAHLFLNELGIAYD  162



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 120/135 (89%), Gaps = 3/135 (2%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMT  312
            +SS +G P+  +R+Q ++ SS  +LS+S S TP Y L SFKF+PI+ESIV+REMTRRYM 
Sbjct  24   RSSIHGVPL-PTRLQPIR-SSPQSLSISMSSTPPYDLQSFKFEPIRESIVSREMTRRYMM  81

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGG+WLGGQLFSAMVVR
Sbjct  82   DMITYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGSWLGGQLFSAMVVR  141

Query  493  KPAQVFLDELEVEYE  537
            KPAQ+FLDEL +EY+
Sbjct  142  KPAQLFLDELGIEYD  156



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 2/135 (1%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHNLSVSASHT--PYSLDSFKFQPIKESIVAREMTRRYMT  312
            S FNG  + +     +K++SH+  SVS S    PY L SFKFQPIKESIV+REMTRRYMT
Sbjct  17   SFFNGRSIATRTSHLIKSTSHNYSSVSMSLNTPPYDLQSFKFQPIKESIVSREMTRRYMT  76

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDV++VGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVR
Sbjct  77   DMITYADTDVVIVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVR  136

Query  493  KPAQVFLDELEVEYE  537
            KPA +FLDE+ V+Y+
Sbjct  137  KPAHLFLDEIGVDYD  151



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 8/140 (6%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKA--SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMT  297
            +SSF+G PV  +RVQ +KA  S+ H LSVS     S + Y L +FKF+PIKESIV+REMT
Sbjct  24   ESSFHGVPV--ARVQPLKAATSNGHGLSVSMSAGGSTSAYDLTNFKFEPIKESIVSREMT  81

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  82   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFS  141

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA  FL+EL ++Y+
Sbjct  142  AMVVRKPAHHFLNELGIDYD  161



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   207 bits (526),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 9/140 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKA---SSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMT  297
            SSF+GT VV  R+Q  KA   S++H LSVS S    TP Y L +FKF PIKESIV+REMT
Sbjct  25   SSFHGTSVV--RLQPAKAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMT  82

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  83   RRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFS  142

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FL+EL + Y+
Sbjct  143  AMVVRKPAHLFLNELGIAYD  162



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +1

Query  136  KSSF-NGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            KSSF NG P+ ++R   +  S+   +++S +  PY +++FKF PIKESIV+REMTRRYMT
Sbjct  18   KSSFFNGRPI-ATRTSTIIKSTPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMT  76

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVR  492
            DMITYADTDV++VGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVR
Sbjct  77   DMITYADTDVVIVGAGSAGLSCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVR  136

Query  493  KPAQVFLDELEVEYE  537
            KPA +FLDE+ VEY+
Sbjct  137  KPAHLFLDEIGVEYD  151



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = +1

Query  130  AAKSSFNGTPV-VSSRVQAVKASSHHNLSVSASHT-PYSLDSFKFQPIKESIVAREMTRR  303
            A KSSF+G PV   + V  V +    +++V+A+   PY+LD+FKF PIKESIV+REMTRR
Sbjct  9    APKSSFHGLPVNTRAAVHPVTSLPARSVTVAAAAALPYNLDAFKFNPIKESIVSREMTRR  68

Query  304  YMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM  483
            YMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V VA++EQSVSPGGGAWLGGQLFSAM
Sbjct  69   YMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVNVALVEQSVSPGGGAWLGGQLFSAM  128

Query  484  VVRKPAQVFLDELEVEYE  537
            VVRKPA  FLDELEV+Y+
Sbjct  129  VVRKPAHRFLDELEVDYD  146



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDM  318
            S FNG P+ ++R   +  S+   +++S +  PY +++FKF PIKESIV+REMTRRYMTDM
Sbjct  20   SFFNGRPI-ATRTSTIIKSTPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMTDM  78

Query  319  ITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKP  498
            ITYADTDV++VGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKP
Sbjct  79   ITYADTDVVIVGAGSAGLSCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVRKP  138

Query  499  AQVFLDELEVEYE  537
            A +FLDE+ VEY+
Sbjct  139  AHLFLDEIGVEYD  151



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 7/146 (5%)
 Frame = +1

Query  121  FFDAAKSSFNGTPV---VSSRVQAVKASSHHNLSVSASHTP----YSLDSFKFQPIKESI  279
            FFD  K+SFNG P+   V  R QA +++  +   +S S       Y L+ F+F PIKESI
Sbjct  14   FFDTHKTSFNGQPISPAVRRRRQATRSAKPNGSPISMSSASSPPGYDLNQFRFAPIKESI  73

Query  280  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWL  459
            V+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWL
Sbjct  74   VSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWL  133

Query  460  GGQLFSAMVVRKPAQVFLDELEVEYE  537
            GGQLFSAMVVRKPA +FLDEL +EY+
Sbjct  134  GGQLFSAMVVRKPAHLFLDELGLEYD  159



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            F D  KSSF+GTP+ ++       S+   +S+S +   Y L SFKFQPIKESIV+REMTR
Sbjct  17   FLDN-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSYDLQSFKFQPIKESIVSREMTR  75

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDM+TYADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSA
Sbjct  76   RYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSA  135

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA  FLDELE+EY+
Sbjct  136  MIVRKPAHRFLDELEIEYD  154



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 118/138 (86%), Gaps = 7/138 (5%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHN-----LSVSASHTPYSLDSFKFQPIKESIVAREMTRR  303
            SSF+G P+  +RVQ +KA+S  N     +S+SAS   Y L +FKF+PIKESIV+REMTRR
Sbjct  27   SSFHGAPL--ARVQPLKAASSSNGHGLSVSMSASTNAYDLSNFKFEPIKESIVSREMTRR  84

Query  304  YMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM  483
            YMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAM
Sbjct  85   YMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAM  144

Query  484  VVRKPAQVFLDELEVEYE  537
            VVRKPA  FL EL ++Y+
Sbjct  145  VVRKPAHHFLSELGIDYD  162



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   204 bits (519),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 4/137 (3%)
 Frame = +1

Query  139  SSFNGTPVV-SSRV---QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRY  306
            S FNG PV  SSRV     + +S    +S+S +  PY L SFKFQPIKESIV+REMTRRY
Sbjct  16   SFFNGKPVTYSSRVAPTTKLSSSKQGTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRY  75

Query  307  MTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
            MTDMITYADTDV++VGAGSAGLSCAYE+SKNP V VAI+EQSVSPGGGAWLGGQLFSAMV
Sbjct  76   MTDMITYADTDVVIVGAGSAGLSCAYELSKNPAVSVAIVEQSVSPGGGAWLGGQLFSAMV  135

Query  487  VRKPAQVFLDELEVEYE  537
            VRKPA +FLDEL V Y+
Sbjct  136  VRKPAHLFLDELGVAYD  152



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +1

Query  139  SSFNGTPVV-SSRVQAVK---ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRY  306
            S F+G PV  SSRV       +S    +S+S +  PY L SFKFQPIKESIV+REMTRRY
Sbjct  16   SFFHGKPVTYSSRVAPTTKLFSSKQGTISMSLTQPPYDLQSFKFQPIKESIVSREMTRRY  75

Query  307  MTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
            MTDMITYADTDV++VGAGSAGLSCAYEISKNP V VAIIEQSVSPGGGAWLGGQLFSAMV
Sbjct  76   MTDMITYADTDVVIVGAGSAGLSCAYEISKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMV  135

Query  487  VRKPAQVFLDELEVEYE  537
            VRKPA +FLDEL V Y+
Sbjct  136  VRKPAHLFLDELGVAYD  152



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 8/146 (5%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVSAS------HTPYSLDSFKFQPIKESI  279
            F D  KSSF G P+ S +R++ VK S+  N++VS S        PY L SF F PIKESI
Sbjct  15   FIDTHKSSFYGVPISSQARLKIVK-STPQNMAVSMSADASPPPPPYDLGSFSFNPIKESI  73

Query  280  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWL  459
            VAREMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SKNP+V+VAI+EQSVSPGGGAWL
Sbjct  74   VAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPDVQVAILEQSVSPGGGAWL  133

Query  460  GGQLFSAMVVRKPAQVFLDELEVEYE  537
            GGQLFSAMVVRKPA +FL+EL ++Y+
Sbjct  134  GGQLFSAMVVRKPAHLFLNELGIDYD  159



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +1

Query  124  FDAAKSSFNGTPVV--SSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            FD + SSF+GTP+   + R+Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMT
Sbjct  21   FDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMT  79

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMIT+ADTDV++VGAGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFS
Sbjct  80   RRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFS  139

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FLDEL VEY+
Sbjct  140  AMVVRKPAHLFLDELGVEYD  159



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 8/139 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTR  300
            SSF+G P+V  R+Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTR
Sbjct  25   SSFHGAPMV--RLQPAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTR  82

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  142

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FL+EL ++Y+
Sbjct  143  MVVRKPAHLFLNELGIDYD  161



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 7/137 (5%)
 Frame = +1

Query  139  SSFNGTPVVSS----RVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRY  306
            SSF+GTP+       R+Q  KA    ++S +A   PY L +F+F+PIKESIV+REMTRRY
Sbjct  21   SSFHGTPLAPPPPCLRLQPAKAGFSVSMSAAA---PYDLKNFRFEPIKESIVSREMTRRY  77

Query  307  MTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
            M DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMV
Sbjct  78   MMDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMV  137

Query  487  VRKPAQVFLDELEVEYE  537
            VRKPA +FLDEL +EY+
Sbjct  138  VRKPAHIFLDELGIEYD  154



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 8/139 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTR  300
            SSF+G P+V  R+Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTR
Sbjct  25   SSFHGAPMV--RLQLAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTR  82

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  142

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FL+EL ++Y+
Sbjct  143  MVVRKPAHLFLNELGIDYD  161



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 8/139 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTR  300
            SSF+G P+V  R+Q  KA+  S+  LSVS S    +  Y+L +FKF PIKESIV+REMTR
Sbjct  25   SSFHGAPMV--RLQPAKAAPASNGGLSVSMSANGLNPSYNLSAFKFDPIKESIVSREMTR  82

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  142

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FL+EL ++Y+
Sbjct  143  MVVRKPAHLFLNELGIDYD  161



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   202 bits (513),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 8/139 (6%)
 Frame = +1

Query  145  FNGTPVV----SSRVQAVKASSHHN-LSVSASHT---PYSLDSFKFQPIKESIVAREMTR  300
            F+GTP+     S R+ A ++S+H + +S+SA+     PY L++F+F PIKESIV+REMTR
Sbjct  21   FHGTPLAPAAQSLRLPAPRSSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMTR  80

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYM DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  81   RYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  140

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELE+EY+
Sbjct  141  MVVRKPAHRFLDELEIEYD  159



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 118/139 (85%), Gaps = 8/139 (6%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTR  300
            SSF+G P+V  R+Q  KA+  S+  LSVS S    +  Y L +FKF PIKESIV+REMTR
Sbjct  25   SSFHGAPIV--RLQPAKAAPASNGGLSVSMSSNGLNPSYDLSAFKFDPIKESIVSREMTR  82

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  83   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  142

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FL+EL ++Y+
Sbjct  143  MVVRKPAHLFLNELGIDYD  161



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            F D  KSSF+GTP+ ++       S+   +S+S +       SFKFQPIKESIV+REMTR
Sbjct  17   FLDT-KSSFHGTPITTTTRFTPIKSTSPAISMSLTQPSCDFQSFKFQPIKESIVSREMTR  75

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDM+TYADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSA
Sbjct  76   RYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSA  135

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA  FLDELE+EY+
Sbjct  136  MIVRKPAHRFLDELEIEYD  154



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +1

Query  124  FDAAKSSFNGTPVV--SSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
            FD + SSF+GTP+   + R+Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMT
Sbjct  21   FDTS-SSFHGTPISKPTLRMQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMT  79

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYM DMIT+ADTDV++VGAGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFS
Sbjct  80   RRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFS  139

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AMVVRKPA +FL+EL +EY+
Sbjct  140  AMVVRKPAHLFLNELGIEYD  159



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 126/149 (85%), Gaps = 14/149 (9%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS----RVQAVKASSHHNLSVSASHTP------YSLDSFKFQPIK  270
             FD+  S+F GTPV ++    R+Q  K S+  ++S+SA +TP      Y+L+SF+F PIK
Sbjct  14   LFDS--SAFYGTPVAAAPPSLRMQPTK-SNGVSISMSA-NTPSSSVPQYNLNSFRFDPIK  69

Query  271  ESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGG  450
            ESIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE+SKNP+V+VAI+EQSVSPGGG
Sbjct  70   ESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSVKVAIVEQSVSPGGG  129

Query  451  AWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AWLGGQLFSAM+VRKPA +FLDEL++EY+
Sbjct  130  AWLGGQLFSAMIVRKPAHLFLDELDIEYD  158



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 117/146 (80%), Gaps = 10/146 (7%)
 Frame = +1

Query  121  FFDAAKSSFNGTPV------VSSRVQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESI  279
             FD   SSF+G+ V      V  R +AV  +      S  +S  PY L++F+F PIKESI
Sbjct  18   LFD---SSFHGSAVAVPPVSVGLRSRAVAGNGFSVRASAESSSPPYDLNNFRFSPIKESI  74

Query  280  VAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWL  459
            V+REMTRRYMTDMITYA+TDV++VGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWL
Sbjct  75   VSREMTRRYMTDMITYAETDVVIVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWL  134

Query  460  GGQLFSAMVVRKPAQVFLDELEVEYE  537
            GGQLFSAMVVRKPA +FLDEL++EY+
Sbjct  135  GGQLFSAMVVRKPAHMFLDELDIEYD  160



>gb|AFK49080.1| unknown [Medicago truncatula]
Length=195

 Score =   194 bits (493),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L++FKF PIKESIVAREMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYD  154



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVSA-SHTP-YSLDSFKFQPIKESIVAREMTRRYM  309
            +SSF+G  + ++ ++++      +LSV+A S  P Y LDSF+F+PIKES+V+REMTRRYM
Sbjct  24   RSSFSGFRLPATALRSLPGRGRPSLSVTAASAAPRYDLDSFRFEPIKESVVSREMTRRYM  83

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            TDMITYADTDV+V+GAGSAGLSCAYEISK+P+VRVAI+EQSVSPGGGAWLGGQLFSAMVV
Sbjct  84   TDMITYADTDVVVIGAGSAGLSCAYEISKDPSVRVAIVEQSVSPGGGAWLGGQLFSAMVV  143

Query  490  RKPAQVFLDELEVEYE  537
            RKPA +FLDEL V Y+
Sbjct  144  RKPAHLFLDELGVAYD  159



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 116/142 (82%), Gaps = 5/142 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVS-SRVQAVKASSHHNLSVSASH-TP-YSLDSFKFQPIKESIVARE  291
            F D  KSS  G+P+ S + +Q VK SS  NLSV+ S  TP Y LD+  F PIKESIV+RE
Sbjct  17   FLDT-KSSIYGSPLSSRATIQRVK-SSPQNLSVTMSAATPAYDLDNLTFAPIKESIVSRE  74

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYM DMITYADTDV+VVGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLG QL
Sbjct  75   MTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGSQL  134

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA  FLDELE+ Y+
Sbjct  135  FSAMVVRKPAPKFLDELEIAYD  156



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRY  306
            +SSF+G P+          SSH N S+S   AS  PY  ++F+F PIKESIV+REMTRRY
Sbjct  23   ESSFHGVPIKPLSFHFKTKSSHCNASISMSAASPPPYDFNNFRFDPIKESIVSREMTRRY  82

Query  307  MTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
            M DMI YADTDV+VVGAGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMV
Sbjct  83   MMDMIIYADTDVVVVGAGSAGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMV  142

Query  487  VRKPAQVFLDELEVEYE  537
            VRKPA  FLDEL +EY+
Sbjct  143  VRKPAHRFLDELAIEYD  159



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   199 bits (505),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRY  306
            +SSF+G P+          SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRY
Sbjct  23   ESSFHGVPIKPLSFHFKTKSSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRY  82

Query  307  MTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
            M DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMV
Sbjct  83   MMDMITYADTDVVVVGAGSAGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMV  142

Query  487  VRKPAQVFLDELEVEYE  537
            VRKPA  FLDEL +EY+
Sbjct  143  VRKPAHRFLDELAIEYD  159



>emb|CDY42479.1| BnaA10g08550D [Brassica napus]
Length=258

 Score =   196 bits (497),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  135  AMIVRKPAHLFLDEIGVPYD  154



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 111/136 (82%), Gaps = 3/136 (2%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYM  309
            SSF+G P+          SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRYM
Sbjct  24   SSFHGVPIKPLSFHFKTKSSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYM  83

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
             DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVV
Sbjct  84   MDMITYADTDVVVVGAGSAGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVV  143

Query  490  RKPAQVFLDELEVEYE  537
            RKPA  FLDEL +EY+
Sbjct  144  RKPAHRFLDELAIEYD  159



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+SAS  PY L++FKF PIKESIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+
Sbjct  43   SISASTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEL  102

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+
Sbjct  103  SKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNIEYD  151



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 8/139 (6%)
 Frame = +1

Query  145  FNGTPVV----SSRVQAVKASSHHN-LSVSASHT---PYSLDSFKFQPIKESIVAREMTR  300
            F+GTP+     S R+ A ++S+H + +S+SA+     PY L++F+F PIKESIV+REMTR
Sbjct  151  FHGTPLAPAAQSLRLPAPRSSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMTR  210

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYM DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  211  RYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSA  270

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELE+EY+
Sbjct  271  MVVRKPAHRFLDELEIEYD  289



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 119/136 (88%), Gaps = 3/136 (2%)
 Frame = +1

Query  139  SSFNGTPVV--SSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYM  309
            S+F GTPV   S R+Q    ++  ++S+SAS TP Y+L+SFKF PIKESIV+REMTRRYM
Sbjct  28   SAFYGTPVAAPSLRMQPTSKTNAVSVSMSASSTPSYNLNSFKFDPIKESIVSREMTRRYM  87

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            TDMI+YADTDV++VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVV
Sbjct  88   TDMISYADTDVVIVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVV  147

Query  490  RKPAQVFLDELEVEYE  537
            RKPA  FLDE+ +EY+
Sbjct  148  RKPAHRFLDEVGIEYD  163



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS--RVQAVKASSHHNLSVS-ASHTPYSLDSFKFQPIKESIVARE  291
             F+ + SSF GTP+  S  RVQ  KA +  ++S+S A   PY L +F F PIKESIV+RE
Sbjct  14   LFENSASSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSRE  73

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYM DMITYADTDV+VVGAGS+GL C YE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  74   MTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQL  132

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FS MVVRKPA +FLDEL +EY+
Sbjct  133  FSGMVVRKPAHLFLDELGIEYD  154



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  135  AMIVRKPAHLFLDEIGVPYD  154



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L+SFKF PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP+VR
Sbjct  2    PYDLNSFKFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVR  61

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V+Y+
Sbjct  62   VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVDYD  103



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ +   +K  S   +SV A+   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSGSVVSVRATTAGYDLNAFTFDPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  135  AMIVRKPAHLFLDEIGVAYD  154



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 117/136 (86%), Gaps = 4/136 (3%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHN---LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYM  309
            SSF+G P+ S+R  ++K+++  N   +S+S +   Y L++FKF P KESIV+REMTRRYM
Sbjct  22   SSFHGKPI-STRTTSIKSTTQQNTTTISMSLNSPAYDLEAFKFAPTKESIVSREMTRRYM  80

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            TDMITYADTDV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVV
Sbjct  81   TDMITYADTDVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVV  140

Query  490  RKPAQVFLDELEVEYE  537
            R+PA +FL+E+ V+Y+
Sbjct  141  REPAHLFLNEIGVDYD  156



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   SSF+G+ + ++ +         ++SV AS   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSASVSVRASTAGYDLNAFTFDPIKESIVSREMTR  74

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  75   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  134

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  135  MIVRKPAHLFLDEIGVAYD  153



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   SSF+G+ + ++ +         ++SV AS   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKPRSVSVSVRASTAGYDLNAFTFDPIKESIVSREMTR  74

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  75   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  134

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  135  MIVRKPAHLFLDEIGVAYD  153



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L++FKF PIKESIVAREMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYD  154



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 5/140 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + +S V   +K  S   +SV A+   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSFSTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  133

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  134  AMIVRKPAHLFLDEIGVPYD  153



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  223  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNP  402
            S   Y L+++KF+PIKESIVAREMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  55   SDAKYDLNNYKFEPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  114

Query  403  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV YE
Sbjct  115  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYE  159



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   194 bits (492),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 7/123 (6%)
 Frame = +1

Query  169  SRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIV  348
            +RV  V AS +       S   Y L+++KF PIKESIVAREMTRRYMTDMIT+ADTDV+V
Sbjct  46   TRVPVVSASLY-------SDAKYDLNNYKFDPIKESIVAREMTRRYMTDMITHADTDVVV  98

Query  349  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  528
            VGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV
Sbjct  99   VGAGSAGLSCAYELSKNPNVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEV  158

Query  529  EYE  537
             YE
Sbjct  159  PYE  161



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 5/140 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + +S V   +K  S   +SV A+   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  133

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  134  AMIVRKPAHLFLDEIGVPYD  153



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   193 bits (491),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 3/138 (2%)
 Frame = +1

Query  124  FDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRR  303
              ++ S  +G P+   R+  +K SS  + S  +    Y L  FKF+PIKESIV+REMTRR
Sbjct  22   LTSSSSVIHGVPL---RLNYLKCSSSLSASSLSVSAKYDLKDFKFEPIKESIVSREMTRR  78

Query  304  YMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM  483
            YM DMITYADTDV+VVGAGSAGLSCAYE+SKNPNVRVAI+EQSVSPGGGAWLGGQLFSAM
Sbjct  79   YMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNVRVAIVEQSVSPGGGAWLGGQLFSAM  138

Query  484  VVRKPAQVFLDELEVEYE  537
            VVRKPA +FLDEL V+Y+
Sbjct  139  VVRKPAHLFLDELGVDYD  156



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 5/140 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + +S V   +K  S   +SV A+   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISASPVSVGLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMT  73

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  74   RRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  133

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  134  AMIVRKPAHLFLDEIGVPYD  153



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   SSF+G+ + ++ +         +LSV A+ + Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISVGLKPRSASLSVRAT-SGYDLNAFTFDPIKESIVSREMTR  73

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  74   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  133

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  134  MIVRKPAHLFLDEIGVAYD  152



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 4/140 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ V   +K  S   +SV AS   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSSISAAPVSVGLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMT  74

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMIT A+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  75   RRYMTDMITSAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  134

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  135  AMIVRKPAHLFLDEIGVPYD  154



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +1

Query  208  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            +S+S+S+ PY L SF+F PIKESIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCAYE
Sbjct  1    MSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYE  60

Query  388  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  61   LSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  110



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  223  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNP  402
            S   Y L+++KF+PIKESIVAREMTRRYMT+MIT+ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  42   SDAKYDLNNYKFEPIKESIVAREMTRRYMTEMITHADTDVVVVGAGSAGLSCAYELSKNP  101

Query  403  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV YE
Sbjct  102  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYE  146



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L++FKF PIKESIVAREMTRRYMTDM T+ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMATHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYD  154



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 112/139 (81%), Gaps = 8/139 (6%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            F  ++  SF+ TP +  R  A +AS      +SAS  PY   SF+F PI+ESIV+REMTR
Sbjct  19   FNKSSSPSFHATPTL--RPLAPRAS------MSASAPPYDFGSFRFDPIRESIVSREMTR  70

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYM DM+T+ADTDV++VGAGSAGLSCAYE+SKNP++ +AI+EQSVSPGGGAWLGGQLFSA
Sbjct  71   RYMIDMVTHADTDVVIVGAGSAGLSCAYELSKNPSINIAIVEQSVSPGGGAWLGGQLFSA  130

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FLDEL VEY+
Sbjct  131  MVVRKPAHLFLDELNVEYD  149



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   192 bits (488),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 104/111 (94%), Gaps = 2/111 (2%)
 Frame = +1

Query  211  SVSASHTP--YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            SV+A+++P  Y L+SFKF PIKESIV+REMTRRYMTDM+T+ADTDV++VGAGSAGL+CAY
Sbjct  43   SVAAANSPPPYDLNSFKFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLTCAY  102

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            E+SKNPNV +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+
Sbjct  103  ELSKNPNVNIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYD  153



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   192 bits (487),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 113/139 (81%), Gaps = 6/139 (4%)
 Frame = +1

Query  136  KSSFNGTPV-----VSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            K+SF+G  +       S V   +A +  N S+S+S  PY L++FKF PIKESIV+REMTR
Sbjct  10   KTSFSGVRLPAAARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTR  68

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGG WLG QLFSA
Sbjct  69   RYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGRWLGAQLFSA  128

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FLDEL +EY+
Sbjct  129  MVVRKPAHLFLDELNIEYD  147



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYD  156



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYD  156



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   191 bits (486),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 8/139 (6%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            F  ++  SF+ TP +  R  A +AS      +SAS  PY   SF+F PI+ESIV+REMTR
Sbjct  19   FNKSSSPSFHATPTL--RPLAPRAS------MSASAPPYDFGSFRFDPIRESIVSREMTR  70

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYM DM+T+ADTDV++VGAGSAGLSCAYE+SKNP++ +AI+EQSVSPGGGAWLGGQLFSA
Sbjct  71   RYMIDMVTHADTDVVIVGAGSAGLSCAYELSKNPSINIAIVEQSVSPGGGAWLGGQLFSA  130

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FLDEL +EY+
Sbjct  131  MVVRKPAHLFLDELNLEYD  149



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  160  VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            VVS+      A+     S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTD
Sbjct  30   VVSTGAPRTAAAGPICASISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89

Query  340  VIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDE  519
            V+VVGAGSAGLSCAYE+SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE
Sbjct  90   VVVVGAGSAGLSCAYELSKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDE  149

Query  520  LEVEYE  537
            L V Y+
Sbjct  150  LGVAYD  155



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 4/138 (3%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVSASHT----PYSLDSFKFQPIKESIVAREMTRR  303
            +SSF+G P+          SS  N SVS S      PY L++F+F PIKESIV+REMTRR
Sbjct  23   ESSFHGVPITPLSFHLKAKSSPRNASVSMSAASSPPPYDLNNFRFDPIKESIVSREMTRR  82

Query  304  YMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM  483
            YM DMIT+ADTDV+VVGAGSAGLSCAYE+SKNP+V+VAI+EQSVSPGGGAWLGGQLFSAM
Sbjct  83   YMMDMITHADTDVVVVGAGSAGLSCAYELSKNPSVQVAIVEQSVSPGGGAWLGGQLFSAM  142

Query  484  VVRKPAQVFLDELEVEYE  537
            VVRKPA  FLDEL +EY+
Sbjct  143  VVRKPAHRFLDELGIEYD  160



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  223  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNP  402
            S   Y L+++KF PIKESIVAREMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  403  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV YE
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPYE  160



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMITYADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYD  156



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  223  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNP  402
            S   Y L+++KF PIKESIVAREMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  403  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV YE
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPYE  160



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   191 bits (485),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  155



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   SSF+G+ + ++ +     S   ++SV A+   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SSFHGSSISAAPISIGLKSRSVSVSVRAT-AGYDLNAFTFDPIKESIVSREMTR  73

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMIT+A+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  74   RYMTDMITFAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  133

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  134  MIVRKPAHLFLDEIGVAYD  152



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  155



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  155



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSV-SASHTP-YSLDSFKFQPIKESIVAREMTRRYM  309
            +SSF+G  + ++ + +   S    LSV SA   P Y L SF F+PI+ESIV+REMTRRYM
Sbjct  25   RSSFSGLRLAATPLPSHSGSGKAALSVTSALAAPKYDLGSFSFKPIQESIVSREMTRRYM  84

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            TDMI+YADTDV+V+GAGSAGLSCAYEISK+P+VRVAI+EQSVSPGGGAWLGGQLFSAMVV
Sbjct  85   TDMISYADTDVVVIGAGSAGLSCAYEISKDPSVRVAIVEQSVSPGGGAWLGGQLFSAMVV  144

Query  490  RKPAQVFLDELEVEYE  537
            RKPA +FLDEL V Y+
Sbjct  145  RKPAHLFLDELGVPYD  160



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L+SFKF PIKESIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE+SKNP+++
Sbjct  53   PYDLNSFKFNPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSIK  112

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+E+ VEY+
Sbjct  113  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNEIGVEYD  154



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  226  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPN  405
            + PY L SFKF PIKESIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  50   NPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPT  109

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VRVAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  110  VRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  153



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  155



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 4/139 (3%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   SSF+G+ + +     +K  S  ++SV AS   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SSFHGSSISAPISIGLKPRSG-SVSVRASTAGYDLNAFTFDPIKESIVSREMTR  73

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  74   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  133

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  134  MIVRKPAHLFLDEIGVAYD  152


 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLSCAY
Sbjct  240  SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  299

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+
Sbjct  300  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYD  350



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +1

Query  208  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            +  S S+ PY L SFKF PIKESIV+REMTRRYMTDMIT+ADTDV+VVGAGSAGLSCAYE
Sbjct  41   IRASISNPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYE  100

Query  388  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +SK+P+V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  101  LSKDPSVSVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = +1

Query  211  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  388  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +EY+
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLEYD  151



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = +1

Query  211  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+T+ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  388  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +EY+
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLEYD  151



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  205  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  384
            ++S + S+ PY L SF+F PIKESIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCAY
Sbjct  41   SISSTPSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  100

Query  385  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            E+SK+P++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL + Y+
Sbjct  101  ELSKDPSISIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGIAYD  151



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 7/140 (5%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQ-AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ +   +K  S    SV A+   Y L++F F PIKESIV+REMT
Sbjct  18   LFD---SSFHGSAISAAPISIGLKPRS---FSVRATTAGYDLNAFTFDPIKESIVSREMT  71

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLS AYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  72   RRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  131

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  132  AMIVRKPAHLFLDEIGVAYD  151



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 5/139 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   S F+G+ + S+   +V      +LSV A+   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SYFHGSSISSAAPVSVGLKPR-SLSVRAT-AGYDLNAFTFDPIKESIVSREMTR  72

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSA
Sbjct  73   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSA  132

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  133  MIVRKPAHLFLDEIGVAYD  151



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  211  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI  390
            S+S+ + PY L SF+F PIKESIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCAYE+
Sbjct  46   SISSPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  105

Query  391  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V Y+
Sbjct  106  SKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYD  154



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  217  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK  396
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+T+ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  397  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NP+V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+
Sbjct  107  NPSVNIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGLEYD  153



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L+SFKF+PI+ESIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  171



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  217  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK  396
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+T+ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  397  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            NP+V +AI+EQS+SPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+
Sbjct  107  NPSVNIAIVEQSISPGGGAWLGGQLFSAMVVRKPAHLFLDELGLEYD  153



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGT--PVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVARE  291
            F D   SSF+G   P   S   A    S      +++  P Y L+S +F+PIKESIV+RE
Sbjct  17   FLDHRHSSFHGLSPPSHVSAAAARSPGSSSLSISASTADPRYDLNSIRFEPIKESIVSRE  76

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYADTDV+V+GAGSAGLSCAYE+SK+P+VRVAI+EQSVSPGGGAWLGGQL
Sbjct  77   MTRRYMTDMITYADTDVVVIGAGSAGLSCAYELSKDPSVRVAIVEQSVSPGGGAWLGGQL  136

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL + Y+
Sbjct  137  FSAMVVRKPAHLFLDELGIXYD  158



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  226  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPN  405
            + PY L SF+F PIKES+V+REMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SK+P+
Sbjct  49   NPPYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  108

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  152



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 112/140 (80%), Gaps = 8/140 (6%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMT  297
             FD   SSF+G+ + ++ V      S  + SVS   T  Y L++F F PIKESIV+REMT
Sbjct  15   LFD---SSFHGSSISAAPVSL----SLKSRSVSVRATAGYDLNAFTFDPIKESIVSREMT  67

Query  298  RRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFS  477
            RRYMTDMITYA+TDV+VVGAGSAGLS AYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFS
Sbjct  68   RRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFS  127

Query  478  AMVVRKPAQVFLDELEVEYE  537
            AM+VRKPA +FLDE+ V Y+
Sbjct  128  AMIVRKPAHLFLDEIGVAYD  147



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 3/113 (3%)
 Frame = +1

Query  208  LSVSASHTP---YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSC  378
            +S S S +P   Y L+ F F PIKES+VAREMTRRYMTDMITYADTDV++VGAGSAGLSC
Sbjct  45   ISCSNSISPSARYDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSC  104

Query  379  AYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AYE+SKNPNV VA++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+
Sbjct  105  AYELSKNPNVSVAVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGVPYD  157



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  226  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPN  405
            + PY L SF+F PIKESIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  157



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  160  VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            VVS+      A+     S S+S+ PY L SF+F PIKES+V+REMTRRYMTDMIT+ADTD
Sbjct  30   VVSTGAPRTAAAGPICASFSSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTD  89

Query  340  VIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDE  519
            V++VGAGSAGLSCAYE+SK+P V +AI+EQSVSPGGGAWLGGQLFSA+VVRKPA +FLDE
Sbjct  90   VVIVGAGSAGLSCAYELSKDPTVSIAIVEQSVSPGGGAWLGGQLFSAVVVRKPAHLFLDE  149

Query  520  LEVEYE  537
            L V Y+
Sbjct  150  LGVAYD  155



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L+SFKF+PI+ESIVAREMTRRYM DMIT+ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  171



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = +1

Query  211  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            S+S+S TP Y L SF+F PIKESIV+REMTRRYMTDMIT+ADTDV++VGAGSAGLSCAYE
Sbjct  46   SISSSPTPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYE  105

Query  388  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V Y+
Sbjct  106  LSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYD  155



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P++ 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSIS  108

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   186 bits (471),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (81%), Gaps = 5/139 (4%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
             FD   S F+G+ + S+   +V      +LSV A+   Y L++F F PIKESIV+REMTR
Sbjct  18   LFD---SYFHGSSISSAAPVSVGLKPR-SLSVRAT-AGYDLNAFTFDPIKESIVSREMTR  72

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAII QSVSPGGGAWLGGQLFSA
Sbjct  73   RYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIAQSVSPGGGAWLGGQLFSA  132

Query  481  MVVRKPAQVFLDELEVEYE  537
            M+VRKPA +FLDE+ V Y+
Sbjct  133  MIVRKPAHLFLDEIGVAYD  151



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  226  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPN  405
            + PY L SF+F PIKESIV+REMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  157



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   186 bits (472),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF PIKESIV+REM RRYMTDM+T+ADTDV++VGAGSAGL+CAYE+SKNPNV+V
Sbjct  63   YDLGSFKFAPIKESIVSREMARRYMTDMVTFADTDVVIVGAGSAGLTCAYELSKNPNVQV  122

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL V+Y+
Sbjct  123  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGVDYD  163



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +1

Query  250  FKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQ  429
            FKF+PIKESIVAREMTRRYM DMITYADTDV++VGAGSAGLSCAYE+SKNP++RVAIIEQ
Sbjct  42   FKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSIRVAIIEQ  101

Query  430  SVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+
Sbjct  102  SVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIEYD  137



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L+ F F PIKES+VAREMTRRYMTDMITYADTDV++VGAGSAGLSCAYE+SKNPNV V
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVSV  116

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            A++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+
Sbjct  117  AVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGVPYD  157



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  52   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  111

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  112  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  153



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  232  PYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVR  411
            PY L++ +F PIKESIV+REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  412  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYD  150



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L SFKF+PI+ESIVAREMTRRYM DMIT+A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLHSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYD  146



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 112/145 (77%), Gaps = 7/145 (5%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASH-----TP-YSLDSFKFQPIKESIV  282
            F D   SSF+G  +  SRV    A+     S S S      TP Y L+S +F PIKESIV
Sbjct  17   FLDHHHSSFHGLSL-PSRVSTAAAAGRSPSSASLSISASAATPKYDLNSIRFDPIKESIV  75

Query  283  AREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLG  462
            +REMTRRYMTDMITYADTDV+VVGAGSAGLSCAYE+SK+P+V VAI+EQSVSPGGGAWLG
Sbjct  76   SREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVNVAIVEQSVSPGGGAWLG  135

Query  463  GQLFSAMVVRKPAQVFLDELEVEYE  537
            GQLFSAMVVRKPA +FL+EL + Y+
Sbjct  136  GQLFSAMVVRKPAHLFLNELGIPYD  160



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L++F F PIKESIV+REMTRRYMTDMITYA+TDV+VVGAGSAGLS AYEISKNPNV+V
Sbjct  7    YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQV  66

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+
Sbjct  67   AIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYD  107



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 105/128 (82%), Gaps = 5/128 (4%)
 Frame = +1

Query  169  SRVQAVKASSHHN-----LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYAD  333
            SRV A  A    N     +S SA+   Y L+S +F PIKESIV+REMTRRYMTDMIT+AD
Sbjct  34   SRVSAAAAGRSPNSRSLFISASAATPKYDLNSIRFDPIKESIVSREMTRRYMTDMITHAD  93

Query  334  TDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFL  513
            TDV+V+GAGSAGLSCAYE+SK+ +V+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL
Sbjct  94   TDVVVIGAGSAGLSCAYELSKDASVQVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFL  153

Query  514  DELEVEYE  537
            DEL V Y+
Sbjct  154  DELGVPYD  161



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 117/141 (83%), Gaps = 3/141 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTP--YSLDSFKFQPIKESIVAREM  294
            F D   SSF+G  ++ SRV A ++ S  +LS+SAS     Y L+S +F PIKESIV+REM
Sbjct  17   FVDHYHSSFSGL-ILPSRVSATRSHSSPSLSISASAAAPRYDLNSIRFNPIKESIVSREM  75

Query  295  TRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLF  474
            TRRYMTDMIT+ADTDV+V+GAGSAGLSCAYE+SK+P+V VAI+EQSVSPGGGAWLGGQLF
Sbjct  76   TRRYMTDMITHADTDVVVIGAGSAGLSCAYELSKDPSVCVAIVEQSVSPGGGAWLGGQLF  135

Query  475  SAMVVRKPAQVFLDELEVEYE  537
            SAMVVRKPA +FLDEL + Y+
Sbjct  136  SAMVVRKPAHLFLDELGIPYD  156



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 6/139 (4%)
 Frame = +1

Query  136  KSSFNGTPV-----VSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            K+SF+G  +       S V   +A +  N S+S+S  PY L++FKF PIKESIV+REMTR
Sbjct  10   KTSFSGVRLPAAARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTR  68

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGA LGGQLFSA
Sbjct  69   RYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAGLGGQLFSA  128

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA +FLDEL +EY+
Sbjct  129  MVVRKPAHLFLDELNIEYD  147



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +1

Query  139  SSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDM  318
            S FNG  + +     +K++SH+N S+S S   ++L SFKF+PI+ESIV+RE++R Y+T+M
Sbjct  56   SFFNGRTIATHTSHIIKSTSHNNSSISMSLNTHNLHSFKFKPIEESIVSREISRCYITNM  115

Query  319  ITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKP  498
            +TY  TDV+++G  S+GLSCAY +SKNPN+ +AIIEQSVSPGGGAWL GQL SAMVVRKP
Sbjct  116  VTY--TDVVILGDSSSGLSCAYGLSKNPNIGIAIIEQSVSPGGGAWLDGQLLSAMVVRKP  173

Query  499  AQVFLDELEVEYE  537
              +FLDE+EV+Y+
Sbjct  174  VDLFLDEIEVDYD  186



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = +1

Query  136  KSSFNGTPV-VSSRVQAVKASSHHNL---SVSASHTPYSLDSFKFQPIKESIVAREMTRR  303
            K+SF G  +  ++R  +  A+        S+S+   PY L SFKF P+KES+ +REM RR
Sbjct  13   KTSFPGVCIPAATRTPSCAATRRTGAICNSISSCTPPYDLSSFKFSPMKESVASREMIRR  72

Query  304  YMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM  483
            YMTDMI   +TDVI++G GSAGLSCAYE+SK+P+V +AII++SVSPGG  WLG QLFSAM
Sbjct  73   YMTDMIADVNTDVIIIGTGSAGLSCAYELSKDPSVNIAIIQRSVSPGGSGWLGSQLFSAM  132

Query  484  VVRKPAQVFLDELEVEYE  537
            VVRKPA +FLDEL +EY+
Sbjct  133  VVRKPAHLFLDELNIEYD  150



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +1

Query  187  KASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSA  366
            +A+  H L+ + S TP+  D+FKF+PI E  V+R MT RY  D+  YA+TDVI+VGAGSA
Sbjct  7    RAADAHRLNQAFSETPF--DNFKFEPITEHQVSRAMTSRYFKDLDEYAETDVIIVGAGSA  64

Query  367  GLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            GLSCAYE+SK PNV+VAIIEQ V+PGGGAWLGGQLFSAMVVRKPA   LDELEV YE
Sbjct  65   GLSCAYELSKYPNVKVAIIEQGVAPGGGAWLGGQLFSAMVVRKPAHTILDELEVPYE  121



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            Y L++ KF PIKE+ V+REMTRRYMTDM+ +A+TDV+V+GAGSAGLSCA+E+SKNPN++V
Sbjct  31   YDLNNLKFNPIKEADVSREMTRRYMTDMLDHAETDVVVIGAGSAGLSCAWELSKNPNIQV  90

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             +IEQSVSPGGGAWLGGQLFSAM+VRKP Q FL E+ V ++
Sbjct  91   TVIEQSVSPGGGAWLGGQLFSAMIVRKPGQHFLAEVGVPFD  131



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 98/139 (71%), Gaps = 32/139 (23%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTR  300
            FFD  KSSF+G+PV      + +A++H                    PIK         +
Sbjct  18   FFDTNKSSFHGSPV------STRAAAH--------------------PIKSG------PQ  45

Query  301  RYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSA  480
            RYMTDMITYADTDV+VVGAGSAGLSCAYE+SKNP++ +AIIEQSVSPGGGAWLGGQLFSA
Sbjct  46   RYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDINIAIIEQSVSPGGGAWLGGQLFSA  105

Query  481  MVVRKPAQVFLDELEVEYE  537
            MVVRKPA  FLDELE+EY+
Sbjct  106  MVVRKPAHKFLDELEIEYD  124



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 4/118 (3%)
 Frame = +1

Query  196  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGS  363
            S H L  ++ + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  13   SGHRLGGASEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  72

Query  364  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ YE
Sbjct  73   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYE  130



>gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis]
Length=132

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +1

Query  121  FFDAAKSSFNGTPVVSS-RVQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREM  294
            F D  +SSF+G P+ S  R+Q +K++ H+ ++S+SAS  PY L SF F+PIKESIV+REM
Sbjct  20   FLDTHQSSFHGVPLSSPIRLQPIKSTPHNLSISMSASSPPYDLRSFTFEPIKESIVSREM  79

Query  295  TRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPG  444
            TRRYM DMITYADTDV+VVGAGSAGLSCAYE+SKNP+++VAIIEQSVSPG
Sbjct  80   TRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPSIQVAIIEQSVSPG  129



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = +1

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDM+TYADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQL  60

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAM+VRKPA  FLDELE+EY+
Sbjct  61   FSAMIVRKPAHRFLDELEIEYD  82



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 4/118 (3%)
 Frame = +1

Query  196  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGS  363
            S H L  +  + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  15   SGHRLGGANEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  74

Query  364  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ YE
Sbjct  75   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYE  132



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAII  423
            D +KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AII
Sbjct  28   DGYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAII  87

Query  424  EQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            EQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ Y+
Sbjct  88   EQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYD  125



>emb|CEI86767.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=189

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  29   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  88

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQ+V+PGGG WLGGQLFSAMVVRKPA  FLDEL + YE
Sbjct  89   IEQNVAPGGGCWLGGQLFSAMVVRKPADKFLDELGIPYE  127



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAII  423
            D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AII
Sbjct  30   DNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAII  89

Query  424  EQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            EQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++ YE
Sbjct  90   EQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYE  127



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  29   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  88

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++ YE
Sbjct  89   IEQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYE  127



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYMTDMITYA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQL  60

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAM+VRKPA +FLDE+ V Y+
Sbjct  61   FSAMIVRKPAHLFLDEIGVPYD  82



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +1

Query  217  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK  396
            +A  TP+  D + F P+KE+ V+REMT RYM DM  YAD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDYADSDVIIAGAGSAGLCAAYELSK  99

Query  397  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             PNVRVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+
Sbjct  100  YPNVRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYD  146



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +1

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYM DMITYADTDV++VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQL  60

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FSAMVVRKPA +FLDEL V+Y+
Sbjct  61   FSAMVVRKPAHLFLDELGVDYD  82



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 2/107 (2%)
 Frame = +1

Query  217  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK  396
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  41   AARTTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  98

Query  397  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+
Sbjct  99   HPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYD  145



>emb|CEG76808.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=261

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  238  SLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  417
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  418  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IIEQ+V+PGGG WLGGQLFSAM+VRKPA  FLDEL++ Y+
Sbjct  88   IIEQNVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYD  127



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%), Gaps = 2/107 (2%)
 Frame = +1

Query  217  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK  396
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  99

Query  397  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+
Sbjct  100  YPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYD  146



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+ ++++AI
Sbjct  31   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDASLKIAI  90

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ Y+
Sbjct  91   IEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYD  129



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
             D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK+PN+RVAI
Sbjct  47   FDGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSKHPNIRVAI  106

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+
Sbjct  107  IEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYD  145



>emb|CBI23938.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  292  MTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  471
            MTRRYM DMITYADTDV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQL  60

Query  472  FSAMVVRKPAQVFLDELEVEYE  537
            FS+MVVRKPA  FLDEL +EY+
Sbjct  61   FSSMVVRKPAHRFLDELGLEYD  82



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  235  YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRV  414
            YS +  +F PI+ES V+REMT RYM D+  +ADTDV++ GAGSAGLS AYE+SKNPNV+V
Sbjct  27   YSPEFSRFAPIRESEVSREMTTRYMKDLYDFADTDVVITGAGSAGLSAAYELSKNPNVKV  86

Query  415  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            A+I+Q V+PGGGAWLGGQLFS+MVVRKPA +FL+E+ VEY+
Sbjct  87   ALIDQGVAPGGGAWLGGQLFSSMVVRKPAHLFLNEVGVEYD  127



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +1

Query  193  SSHHNLSVSASHTP----YSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAG  360
            +S H L     + P       + +KF PI+ES V+REM  RYM DM+ YA++DV++VG G
Sbjct  12   ASGHRLGGPNEYKPDMKYEDFNGYKFAPIRESQVSREMVTRYMNDMLYYAESDVVIVGCG  71

Query  361  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            SA LSCA+E+SK+ ++++AIIEQSVSPGGG WLGGQLFSAMVVRKPAQ FLDEL+V Y+
Sbjct  72   SANLSCAWELSKDSSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPAQKFLDELDVPYD  130



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 8/119 (7%)
 Frame = +1

Query  184  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGS  363
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  27   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  79

Query  364  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV YE
Sbjct  80   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEVPYE  138



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 93/119 (78%), Gaps = 8/119 (7%)
 Frame = +1

Query  184  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGS  363
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  30   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  82

Query  364  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV YE
Sbjct  83   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEVPYE  141



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 8/99 (8%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
            LD+FKF  IKESIV+RE TRRYMTDMIT+ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQSVSPGG         S  VVRKPA +FLDEL ++Y+
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGIDYD  166



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +1

Query  229  TPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNV  408
            TP+  D FKF+ I+ES ++R MT RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  46   TPF--DGFKFESIRESQISRAMTSRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDI  103

Query  409  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   LDELEV Y+
Sbjct  104  RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLLDELEVAYD  146



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 83/99 (84%), Gaps = 8/99 (8%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  420
            LD+FKF  IKESIV+RE TRRYMTDMIT+ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IEQSVSPGG         S  VVRKPA +FLDEL ++Y+
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGIDYD  166



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 85/103 (83%), Gaps = 2/103 (2%)
 Frame = +1

Query  229  TPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKNPNV  408
            TP+  D FKF+ I+ES ++R MT+RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  3    TPF--DGFKFESIRESQISRAMTQRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDL  60

Query  409  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   +DELEV Y+
Sbjct  61   RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLMDELEVPYD  103



>ref|XP_008336996.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=160

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 12/116 (10%)
 Frame = +1

Query  193  SSHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAG  360
            +S+  LSVS S    ++ Y L +FKF PIKESIV+REMTR YMTDMITYADT +++VGAG
Sbjct  24   ASNGGLSVSTSANGLNSSYDLSAFKFDPIKESIVSREMTRHYMTDMITYADTGIVLVGAG  83

Query  361  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAM--------VVRKPAQ  504
            SAGLSCAYE+SKNP+V+VAI EQSVS GGGAWL G L SAM          R+PA+
Sbjct  84   SAGLSCAYELSKNPDVQVAITEQSVSLGGGAWLSGHLLSAMDSDPKPHTTSRRPAR  139



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   149 bits (376),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +1

Query  229  TPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPN  405
            TP+  D ++F PI+E+ V+R MT RY  D+ +YA+ DVI+ GAGSAGL+CAYE+SK  P+
Sbjct  54   TPF--DDYRFAPIREATVSRAMTSRYFKDLDSYAEADVIIAGAGSAGLACAYELSKLAPD  111

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             R+AIIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V YE
Sbjct  112  ARIAIIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAVPYE  155



>ref|XP_001386426.1| hypothetical protein PICST_50942 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN68397.1| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=351

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            ++FKF PI+ES V+R MT+RY  D+  Y ++DV++VGAGSAGLS AY ++KN PN+++AI
Sbjct  43   ENFKFAPIRESTVSRAMTKRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPNLKIAI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDELE++Y+
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELEIQYD  141



>ref|XP_007794010.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
 gb|EMR66906.1| putative thiazole biosynthetic enzyme protein [Eutypa lata UCREL1]
Length=326

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 94/130 (72%), Gaps = 5/130 (4%)
 Frame = +1

Query  151  GTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYA  330
            G PV + ++    A+   NL+V  S      + F F+PI+ES VAR M RRY TD+ TYA
Sbjct  19   GVPVSNGKIHQANANGGKNLAVGDS----KWEEFSFEPIRESQVARAMVRRYFTDLDTYA  74

Query  331  DTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQV  507
            ++D+++VGAGS GLS AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA  
Sbjct  75   ESDIVIVGAGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADK  134

Query  508  FLDELEVEYE  537
            FL EL V +E
Sbjct  135  FLTELGVPFE  144



>ref|XP_007376158.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW31380.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
Length=353

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+  Y ++DV++VGAGSAGLS AY ++KN P++++AI
Sbjct  44   DKFKFAPIRESTVSRAMTRRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPDLKIAI  103

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL++ Y+
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPANIFLDELDIAYD  142



>ref|XP_007591792.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
 gb|EXF84591.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
Length=326

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            DSFKF PI+ES V+R MTRRY +D+ TYA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DSFKFAPIRESQVSRAMTRRYFSDLDTYAESDVVIVGAGSCGLSTAYVLAKTRPDLKIAI  106

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E  V+PGGGAWLGGQLFSAMV+RKPAQVFLDE+ V YE
Sbjct  107  VEAGVAPGGGAWLGGQLFSAMVMRKPAQVFLDEVGVPYE  145



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +1

Query  241  LDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVA  417
             D ++F PI+E+ V+R MT RY  D+ TYA+ DV++ GAGSAGL+CAYE+SK  P+ ++A
Sbjct  65   FDDYRFAPIREATVSRAMTSRYFKDLDTYAEADVVIAGAGSAGLACAYELSKLAPDAKIA  124

Query  418  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V YE
Sbjct  125  IIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAVPYE  164



>emb|CAA57779.1| nmt2 [Schizosaccharomyces pombe]
Length=301

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +1

Query  211  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  388  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V YE
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYE  145



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = +1

Query  211  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYE  387
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  388  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V YE
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYE  145



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  166  SSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVI  345
             S+  A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV+
Sbjct  37   GSQSAAADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVV  94

Query  346  VVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDEL  522
            +VGAGSAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDEL
Sbjct  95   IVGAGSAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDEL  154

Query  523  EVEYE  537
            EV YE
Sbjct  155  EVPYE  159



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  166  SSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVI  345
             S+  A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV+
Sbjct  38   GSQSAAADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVV  95

Query  346  VVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDEL  522
            +VGAGSAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDEL
Sbjct  96   IVGAGSAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDEL  155

Query  523  EVEYE  537
            EV YE
Sbjct  156  EVPYE  160



>ref|XP_007821738.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EXV04465.1| Thi4 family protein [Metarhizium robertsii]
 gb|KFG84393.1| thiazole biosynthetic enzyme variant 1 [Metarhizium anisopliae]
 gb|KID68776.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID80311.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
brunneum ARSEF 3297]
Length=323

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  154  TPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYAD  333
            TP  SS++ AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+ TYA+
Sbjct  18   TPTSSSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAE  74

Query  334  TDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVF  510
            +D++++GAGS GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  F
Sbjct  75   SDIVIIGAGSCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAF  134

Query  511  LDELEVEYE  537
            L E+ V YE
Sbjct  135  LREIGVPYE  143



>gb|EMG50374.1| hypothetical protein G210_4595 [Candida maltosa Xu316]
Length=329

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            ++FKF PI+ES VAREM RRY  D+  YA++DV+V+G GSAG S AY ++KN P++++AI
Sbjct  42   ENFKFAPIRESQVAREMGRRYFQDLDKYAESDVVVIGGGSAGFSAAYTLAKNRPDLKIAI  101

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD+L +EYE
Sbjct  102  IEASVSPGGGCWLGGQLFSAMVLRKPADLFLDDLGLEYE  140



>gb|KID99833.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
majus ARSEF 297]
Length=323

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  154  TPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYAD  333
            TP  SS++ AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+ TYA+
Sbjct  18   TPTSSSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFQDLDTYAE  74

Query  334  TDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVF  510
            +D++++GAGS GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  F
Sbjct  75   SDIVIIGAGSCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAF  134

Query  511  LDELEVEYE  537
            L E+ V YE
Sbjct  135  LREIGVPYE  143



>gb|EDK40113.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL + YE
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNIAYE  142



>ref|XP_001483482.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL + YE
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNIAYE  142



>ref|XP_004199741.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE81622.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = +1

Query  205  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLS  375
            NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++DV+++GAGSAGLS
Sbjct  27   NLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESDVVIIGAGSAGLS  86

Query  376  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ EL ++YE
Sbjct  87   AAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQELGIDYE  141



>ref|XP_004198891.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE82554.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = +1

Query  205  NLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLS  375
            NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++DV+++GAGSAGLS
Sbjct  27   NLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESDVVIIGAGSAGLS  86

Query  376  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ EL ++YE
Sbjct  87   AAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQELGIDYE  141



>gb|KIW79545.1| thiamine thiazole synthase [Fonsecaea pedrosoi CBS 271.37]
Length=329

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 12/144 (8%)
 Frame = +1

Query  124  FDAAKSSFNGTP-----VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAR  288
            FDA    +NGT       V +   A+KA+  HN  +      +  D+FKF PI+ES V+R
Sbjct  11   FDA----YNGTKELKQGAVGTTKVALKAAGEHNNLLEQFGDKW--DAFKFAPIRESQVSR  64

Query  289  EMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGG  465
             MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AIIE SVSPGGG WLGG
Sbjct  65   AMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGG  124

Query  466  QLFSAMVVRKPAQVFLDELEVEYE  537
            QLFSAMV+RKPA+ FL+++ V YE
Sbjct  125  QLFSAMVLRKPAEAFLNDIGVPYE  148



>gb|AAF25444.1|AF217503_1 putative thiazole synthase [Aspergillus oryzae]
 gb|ADM43597.1| ThiA protein [Cloning vector pSK485]
 gb|EIT72848.1| protein involved in thiamine biosynthesis and DNA damage tolerance 
[Aspergillus oryzae 3.042]
 gb|KDE83469.1| hypothetical protein AO1008_10087 [Aspergillus oryzae 100-8]
Length=327

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 94/136 (69%), Gaps = 5/136 (4%)
 Frame = +1

Query  133  AKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            A +   G  VVS  V    AS    L     H     D FKF PI+ES V+R MTRRY  
Sbjct  13   AATGLKGKVVVSETVPVEGASQTKLLD----HFGGKWDEFKFAPIRESQVSRAMTRRYFE  68

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  YA++DV++VGAGS GLS AY ++K  P++++AI+E SVSPGGGAWLGGQLFSAMV+
Sbjct  69   DLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVM  128

Query  490  RKPAQVFLDELEVEYE  537
            R+PA+VFL+EL V YE
Sbjct  129  RRPAEVFLNELGVPYE  144



>gb|KHC63824.1| thiazole biosynthesis enzyme [Candida albicans P75010]
Length=354

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            + FKF PI+ESIV+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESIVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYE  141



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+F F PI+ES V+R MTRRY +D+ TYA++D++++GAGS GLS AY + K  P++++AI
Sbjct  45   DTFTFNPIRESQVSRAMTRRYFSDLDTYAESDIVIIGAGSCGLSAAYTLGKARPDLKIAI  104

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE  VSPGGGAWLGGQLFSAMV+RKPA+VFLD++ V YE
Sbjct  105  IEAGVSPGGGAWLGGQLFSAMVMRKPAEVFLDDIGVPYE  143



>gb|EFW21941.1| thiazole biosynthetic enzyme [Coccidioides posadasii str. Silveira]
Length=328

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V YE
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGVPYE  144



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 3/104 (3%)
 Frame = +1

Query  229  TPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPN  405
            TPY  D +KF PI+E+ V R MTRRY  DM  +A++DV++VGAGSAGL+CA+E+ +  P+
Sbjct  59   TPY--DDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFELGRIAPH  116

Query  406  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            ++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA   LD L+V YE
Sbjct  117  LKVALMEQSVAPGGGAWLGGQLFSAMVVRKPAHEMLDALQVPYE  160



>ref|XP_001247344.1| thiazole biosynthetic enzyme, mitochondrial precursor [Coccidioides 
immitis RS]
 gb|KJF60209.1| thiamine thiazole synthase [Coccidioides immitis RS]
 gb|KJF60210.1| thiamine thiazole synthase, variant [Coccidioides immitis RS]
Length=328

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V YE
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGVPYE  144



>ref|XP_003066032.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
 gb|EER23887.1| thiazole biosynthetic enzyme, mitochondrial precursor, putative 
[Coccidioides posadasii C735 delta SOWgp]
Length=328

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DSFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE +VSPGGGAWLGGQLFSAMV+RKPA  FLDE+ V YE
Sbjct  106  IEAAVSPGGGAWLGGQLFSAMVLRKPADKFLDEIGVPYE  144



>ref|XP_001819323.1| thiazole biosynthetic enzyme [Aspergillus oryzae RIB40]
 sp|Q9UUZ9.2|THI4_ASPOR RecName: Full=Thiamine thiazole synthase; AltName: Full=Pyrithiamine 
resistance protein; AltName: Full=Thiazole biosynthetic 
enzyme [Aspergillus oryzae RIB40]
 dbj|BAE57321.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=327

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  160  VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            VV S    V+ +S   L     H     D FKF PI+ES V+R MTRRY  D+  YA++D
Sbjct  21   VVVSETAPVEGASQTKL---LDHFGGKWDEFKFAPIRESQVSRAMTRRYFEDLDKYAESD  77

Query  340  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  516
            V++VGAGS GLS AY ++K  P++++AI+E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+
Sbjct  78   VVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLN  137

Query  517  ELEVEYE  537
            EL V YE
Sbjct  138  ELGVPYE  144



>gb|KID90425.1| thiazole biosynthetic enzyme variant 1 [Metarhizium guizhouense 
ARSEF 977]
Length=323

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  154  TPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYAD  333
            TP   S++ AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+ TYA+
Sbjct  18   TPTSGSKL-AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAE  74

Query  334  TDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVF  510
            +D++++GAGS GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  F
Sbjct  75   SDIVIIGAGSCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAF  134

Query  511  LDELEVEYE  537
            L E+ V YE
Sbjct  135  LREIGVPYE  143



>ref|XP_002548228.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
 gb|EER33707.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
Length=329

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMI  321
            +FN   + + + Q VK +S    +V   H+    + F F PI+ES VAR M +RY  D+ 
Sbjct  14   TFN---IRAKKAQTVKLTSE---AVDGKHSFADWEKFNFAPIRESQVARAMGKRYFADLD  67

Query  322  TYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKP  498
             YA++D++VVG GSAG S AY ++KN P++++AIIE SVSPGGG WLGGQLFSAMVVRKP
Sbjct  68   KYAESDIVVVGGGSAGFSAAYVMAKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVVRKP  127

Query  499  AQVFLDELEVEYE  537
              +FLD+L +EYE
Sbjct  128  GDLFLDDLGLEYE  140



>gb|AAL86771.2| THI4 enzyme [Candida albicans]
Length=354

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMT  312
            SFN  P   S  QA+      NL   A +   S    + FKF PI+ES V+R MTRRY  
Sbjct  14   SFNLNP--KSTQQAI------NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFA  65

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  +A++D++++GAGSAGLS AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+
Sbjct  66   DLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVL  125

Query  490  RKPAQVFLDELEVEYE  537
            RKPA +FLD++ ++YE
Sbjct  126  RKPAHLFLDDMGLDYE  141



>ref|XP_007807526.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
 gb|EFY92948.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
Length=350

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  154  TPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYAD  333
            TP  SS++ AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA+
Sbjct  45   TPTSSSKL-AVKAGSNNTQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDAYAE  101

Query  334  TDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVF  510
            +D++++GAGS GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  F
Sbjct  102  SDIVIIGAGSCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAF  161

Query  511  LDELEVEYE  537
            L E+ V YE
Sbjct  162  LREIGVPYE  170



>sp|C4YNP4.1|THI4_CANAW RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans WO-1]
 gb|EEQ44553.1| hypothetical protein CAWG_02825 [Candida albicans WO-1]
Length=354

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMT  312
            SFN  P   S  QA+      NL   A +   S    + FKF PI+ES V+R MTRRY  
Sbjct  14   SFNLNP--KSTQQAI------NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFA  65

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  +A++D++++GAGSAGLS AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+
Sbjct  66   DLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVL  125

Query  490  RKPAQVFLDELEVEYE  537
            RKPA +FLD++ ++YE
Sbjct  126  RKPAHLFLDDMGLDYE  141



>ref|XP_002419419.1| thiamine biosynthesis enzyme, putative; thiazole biosynthetic 
enzyme, putative [Candida dubliniensis CD36]
 emb|CAX43013.1| thiamine biosynthesis enzyme, putative [Candida dubliniensis 
CD36]
Length=354

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 98/133 (74%), Gaps = 6/133 (5%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMI  321
            SF+  P  + +V  +K S   N  VS ++     D FKF PI+ES V+R MTRRY  D+ 
Sbjct  14   SFSLNPKFTQQVINLK-SDAKNGKVSFAN----WDEFKFAPIRESTVSRAMTRRYFADLD  68

Query  322  TYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKP  498
             +A++D++++GAGSAGLS AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKP
Sbjct  69   KFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKP  128

Query  499  AQVFLDELEVEYE  537
            A +FL+++ ++YE
Sbjct  129  AHLFLNDMGLDYE  141



>ref|XP_723197.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 ref|XP_723050.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 sp|Q5ANB7.1|THI4_CANAL RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans SC5314]
 gb|EAL04334.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|EAL04489.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|KGQ92431.1| thiazole biosynthesis enzyme [Candida albicans P37005]
 gb|KGQ98336.1| thiazole biosynthesis enzyme [Candida albicans GC75]
 gb|KGR12895.1| thiazole biosynthesis enzyme [Candida albicans P78048]
 gb|KGR17623.1| thiazole biosynthesis enzyme [Candida albicans P37037]
 gb|KGT69944.1| thiazole biosynthesis enzyme [Candida albicans 12C]
 gb|KGU10362.1| thiazole biosynthesis enzyme [Candida albicans P87]
 gb|KGU10939.1| thiazole biosynthesis enzyme [Candida albicans 19F]
 gb|KGU11477.1| thiazole biosynthesis enzyme [Candida albicans L26]
 gb|KGU27365.1| thiazole biosynthesis enzyme [Candida albicans P34048]
 gb|KGU30750.1| thiazole biosynthesis enzyme [Candida albicans P57055]
 gb|KGU31334.1| thiazole biosynthesis enzyme [Candida albicans P75063]
 gb|KHC42654.1| thiazole biosynthesis enzyme [Candida albicans Ca6]
 gb|KHC52341.1| thiazole biosynthesis enzyme [Candida albicans P60002]
 gb|KHC55715.1| thiazole biosynthesis enzyme [Candida albicans P37039]
 gb|KHC70243.1| thiazole biosynthesis enzyme [Candida albicans P75016]
 gb|KHC78685.1| thiazole biosynthesis enzyme [Candida albicans P78042]
 gb|KHC79055.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
 gb|KHC87279.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
Length=354

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 96/136 (71%), Gaps = 12/136 (9%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMT  312
            SFN  P   S  QA+      NL   A +   S    + FKF PI+ES V+R MTRRY  
Sbjct  14   SFNLNP--KSTQQAI------NLKSDAKNGKVSFADWNEFKFAPIRESTVSRAMTRRYFA  65

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  +A++D++++GAGSAGLS AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+
Sbjct  66   DLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVL  125

Query  490  RKPAQVFLDELEVEYE  537
            RKPA +FLD++ ++YE
Sbjct  126  RKPAHLFLDDMGLDYE  141



>ref|XP_001267966.1| thiazole biosynthesis enzyme [Aspergillus clavatus NRRL 1]
 gb|EAW06540.1| thiazole biosynthesis enzyme [Aspergillus clavatus NRRL 1]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 94/137 (69%), Gaps = 5/137 (4%)
 Frame = +1

Query  130  AAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYM  309
            A  +   G  VV   V A   S  H L     H     D FKF PI+ES V+R MTRRY 
Sbjct  13   APTAGLKGKVVVPETVPASGTSQTHLLD----HFGGKWDDFKFAPIRESQVSRAMTRRYF  68

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
             D+  YA++D+++VGAGS GLS AY ++K  P++++AI+E SVSPGGGAWLGGQLFSAM+
Sbjct  69   QDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMI  128

Query  487  VRKPAQVFLDELEVEYE  537
            +R+PA++FL+E+ V YE
Sbjct  129  LRRPAELFLNEIGVPYE  145



>gb|KGR10168.1| thiazole biosynthesis enzyme [Candida albicans P57072]
 gb|KHC36840.1| thiazole biosynthesis enzyme [Candida albicans P76055]
Length=354

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 96/133 (72%), Gaps = 6/133 (5%)
 Frame = +1

Query  142  SFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMI  321
            SFN  P  + +   +K S   N  VS +      + FKF PI+ES V+R MTRRY  D+ 
Sbjct  14   SFNLNPKSTQQAINLK-SDTKNGKVSFA----DWNEFKFAPIRESTVSRAMTRRYFADLD  68

Query  322  TYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKP  498
             +A++D++++GAGSAGLS AY + KN P++++AIIE SVSPGGG WLGGQLFSAMV+RKP
Sbjct  69   KFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKP  128

Query  499  AQVFLDELEVEYE  537
            A +FLD++ ++YE
Sbjct  129  AHLFLDDMGLDYE  141



>ref|XP_001394167.1| thiazole biosynthetic enzyme [Aspergillus niger CBS 513.88]
 ref|XP_003188811.1| thiazole biosynthetic enzyme [Aspergillus niger CBS 513.88]
 emb|CAK45897.1| unnamed protein product [Aspergillus niger]
 gb|EHA19391.1| hypothetical protein ASPNIDRAFT_199098 [Aspergillus niger ATCC 
1015]
Length=331

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  160  VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            VV      V  SS   L     H     D+FKF PI+ES V+R MTRRY  D+  YA++D
Sbjct  21   VVVPEAAPVTGSSQTQL---LDHFAGKWDNFKFAPIRESQVSRAMTRRYFQDLDKYAESD  77

Query  340  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  516
            +++VGAGS GLS AY ++K  P++++AIIE +VSPGGGAWLGGQLFSAMV+R+PA+VFL+
Sbjct  78   IVIVGAGSCGLSTAYVLAKARPDLKIAIIEANVSPGGGAWLGGQLFSAMVMRRPAEVFLN  137

Query  517  ELEVEYE  537
            EL V YE
Sbjct  138  ELGVPYE  144



>emb|CCK70574.1| hypothetical protein KNAG_0E03150 [Kazachstania naganishii CBS 
8797]
Length=324

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +1

Query  175  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVG  354
            +Q    + HH+LS       +S   F+F PI+ES V+R MTRRY  DM  +A +DV+++G
Sbjct  13   LQLNAGTIHHSLSDVVKTEDWS--DFEFTPIRESTVSRAMTRRYFQDMDKFAVSDVVIIG  70

Query  355  AGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  531
            AGS+GLS AY I+KN P++++AIIE +V+PGGGAWLGGQLFSAM++RKPA +FL++L ++
Sbjct  71   AGSSGLSAAYVIAKNRPDLKIAIIESNVAPGGGAWLGGQLFSAMIMRKPAHLFLNDLGIQ  130

Query  532  YE  537
            YE
Sbjct  131  YE  132



>ref|XP_461084.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
 emb|CAG89466.2| DEHA2F16654p [Debaryomyces hansenii CBS767]
Length=321

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D FKF PI+ES V+R MT RY  D+  YA++DV+++GAGSAGLS AY ++KN P +++AI
Sbjct  42   DKFKFTPIRESTVSRAMTSRYFADLDKYAESDVVIIGAGSAGLSAAYILAKNRPELKIAI  101

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE  VSPGGG WLGGQLFSAM++RKPA +FL+EL +EYE
Sbjct  102  IEAGVSPGGGCWLGGQLFSAMILRKPAHLFLEELGLEYE  140



>ref|XP_007745751.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ69899.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
Length=331

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = +1

Query  166  SSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVI  345
            + +V    A+ H+N S+    +    D FKF PI+ES V+R MTRRY  D+  YA++DV+
Sbjct  27   AKKVALTAANEHYNNSLLEQFSG-KWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVV  85

Query  346  VVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDEL  522
            +VGAGS GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++
Sbjct  86   IVGAGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDI  145

Query  523  EVEYE  537
             V YE
Sbjct  146  GVPYE  150



>gb|KDN61355.1| putative Thi4 family protein [Colletotrichum sublineola]
Length=342

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 8/127 (6%)
 Frame = +1

Query  181  AVKASSHHNLSVSASHTPYSL-------DSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            A K +   +  V+A+ TP  +       DSF F PI+ES V+R MTRRY  D+  YA++D
Sbjct  19   AGKTTKPADGHVAAAGTPAKVEDFFGKWDSFTFSPIRESQVSRAMTRRYFADLDAYAESD  78

Query  340  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  516
            +++VGAGS GLS AY ++K  P++R+AI+E  V+PGGGAWLGGQLFSAMV+RKPA+VFLD
Sbjct  79   IVIVGAGSCGLSAAYVLAKARPDLRIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEVFLD  138

Query  517  ELEVEYE  537
            E+ V YE
Sbjct  139  EVGVPYE  145



>gb|KGQ88127.1| thiazole biosynthesis enzyme [Candida albicans P94015]
Length=354

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYE  141



>gb|EQB43457.1| hypothetical protein CGLO_17887 [Colletotrichum gloeosporioides 
Cg-14]
Length=325

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+F F PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DTFTFAPIRESQVSRAMTRRYFADLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E  VSPGGGAWLGGQLFSAMV+RKPA VFLDEL V Y+
Sbjct  106  VEAGVSPGGGAWLGGQLFSAMVMRKPADVFLDELGVAYD  144



>gb|EPX71211.1| thiazole biosynthetic enzyme [Schizosaccharomyces octosporus 
yFS286]
Length=327

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 98/136 (72%), Gaps = 4/136 (3%)
 Frame = +1

Query  136  KSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDS-FKFQPIKESIVAREMTRRYMT  312
            ++ FN  P+   +  A+  +  + L+ S  +  Y LD+ F F PI+ES V+R MTRRY  
Sbjct  11   QNLFNADPLKVDKEDALVKTEQNALTKSFPN--YQLDNEFTFSPIRESTVSRAMTRRYFA  68

Query  313  DMITYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  YA++D+++VGAGSAGL+ AY + ++ P++++AIIE SV+PGGGAWLGGQLFSAMVV
Sbjct  69   DLDKYAESDIVIVGAGSAGLTAAYYLGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVV  128

Query  490  RKPAQVFLDELEVEYE  537
            RKPA  FL E+ V YE
Sbjct  129  RKPADAFLREIGVPYE  144



>ref|XP_002172093.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
 gb|EEB05800.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
Length=326

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  420
            + FKF PI+ESIVAR M +RY  D+ TYA++D+++VGAGSAGL+CAY I ++ P++++AI
Sbjct  41   EDFKFAPIRESIVARAMIKRYWKDLETYAESDIVIVGAGSAGLTCAYYIGTRRPDLKIAI  100

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE  V+PGGGAWLGGQL SAMVVRKPA  FL+E+ V YE
Sbjct  101  IEAGVAPGGGAWLGGQLMSAMVVRKPADAFLNEIGVPYE  139



>gb|EYE95075.1| Thi4 family thiamine biosynthetic enzyme [Aspergillus ruber CBS 
135680]
Length=334

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+  YA+TD+++VGAGS GLS AY ++K  P++++AI
Sbjct  49   DEFKFAPIRESQVSRAMTRRYFQDLDKYAETDILIVGAGSCGLSTAYVLAKARPDLKIAI  108

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E SVSPGGGAWLGGQLFSAMV+R+PA +FL+EL V YE
Sbjct  109  VEASVSPGGGAWLGGQLFSAMVMRRPANIFLEELGVPYE  147



>gb|KHC37210.1| thiazole biosynthesis enzyme [Candida albicans P76067]
Length=354

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYE  141



>ref|XP_002375225.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
 gb|EED56443.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
Length=327

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V YE
Sbjct  106  VEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYE  144



>ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
 gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
Length=330

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 10/131 (8%)
 Frame = +1

Query  175  VQAVKASSHHN-LSVSASHTPY--------SLDSFKFQPIKESIVAREMTRRYMTDMITY  327
            V   KA+S HN ++V A+ +            DSFKF PI+ES V+R MTRRY  D+ TY
Sbjct  15   VPVTKAASGHNAVAVPAADSTRLAIDDMLGQWDSFKFAPIRESQVSRAMTRRYFEDLDTY  74

Query  328  ADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ  504
            A++D++++GAGS GLS AY + K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA 
Sbjct  75   AESDIVIIGAGSCGLSAAYVLGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPAD  134

Query  505  VFLDELEVEYE  537
             FL E+ V YE
Sbjct  135  AFLREVGVPYE  145



>ref|XP_002797266.1| thiazole biosynthesis enzyme [Paracoccidioides sp. 'lutzii' Pb01]
Length=332

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L + YE
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGIPYE  144



>ref|XP_009853231.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55392.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ69381.1| CyPBP37 protein [Neurospora tetrasperma FGSC 2509]
Length=344

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLSCAY +S   P++R+ I
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSCAYVLSTLRPDLRITI  109

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V YE
Sbjct  110  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYE  148



>ref|XP_010759569.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
 gb|EEH47624.1| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb18]
Length=332

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L + YE
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGIPYE  144



>gb|EEH19379.2| thiazole biosynthetic enzyme, mitochondrial [Paracoccidioides 
brasiliensis Pb03]
Length=332

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  46   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L + YE
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGIPYE  144



>ref|XP_661532.1| THI4_ASPOR Thiazole biosynthetic enzyme, mitochondrial precursor 
[Aspergillus nidulans FGSC A4]
 sp|G5EAZ2.1|THI4_EMENI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Aspergillus nidulans FGSC A4]
 dbj|BAD04053.1| putative thiazole synthase [Aspergillus nidulans]
 gb|EAA59237.1| THI4_ASPOR Thiazole biosynthetic enzyme, mitochondrial precursor 
[Aspergillus nidulans FGSC A4]
 tpe|CBF75074.1| TPA: Putative thiazole synthaseTHI4_ASPOR Thiazole biosynthetic 
enzyme, mitochondrial ; [Source:UniProtKB/TrEMBL;Acc:Q76B84] 
[Aspergillus nidulans FGSC A4]
Length=331

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  46   DNFKFAPIRESQVSRAMTRRYFQDLDRYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAI  105

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+R+PA++FL+EL V YE
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVMRRPAELFLNELGVPYE  144



>dbj|GAA84055.1| thiazole biosynthesis enzyme [Aspergillus kawachii IFO 4308]
Length=331

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  160  VVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTD  339
            VV      V  SS   L     H     D+FKF PI+ES V+R MTRRY  D+  YA++D
Sbjct  21   VVVPEAAPVTGSSQTQL---LDHFAGKWDNFKFAPIRESQVSRAMTRRYFQDLDKYAESD  77

Query  340  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  516
            +++VGAGS GLS AY ++K  P++++AI+E +VSPGGGAWLGGQLFSAMV+R+PA+VFL+
Sbjct  78   IVIVGAGSCGLSTAYVLAKARPDLKIAIVEANVSPGGGAWLGGQLFSAMVMRRPAEVFLN  137

Query  517  ELEVEYE  537
            EL V YE
Sbjct  138  ELGVPYE  144



>gb|KIW92677.1| thiamine thiazole synthase [Cladophialophora bantiana CBS 173.52]
Length=331

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  181  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAG  360
            A+ A++ H+ +          D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  31   ALTAANEHDNNSLLEQFGGKWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  90

Query  361  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            S GLS AY ++K  P++++A+IE SVSPGGG WLGGQLFSAMV+RKPA+ FL++++V YE
Sbjct  91   SCGLSTAYTLAKARPDLKIAVIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIDVPYE  150



>ref|NP_982405.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 sp|Q75F65.1|THI4_ASHGO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Ashbya gossypii ATCC 10895]
 gb|AAS50229.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 gb|AEY94514.1| FAAL137Wp [Ashbya gossypii FDAG1]
Length=331

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 98/136 (72%), Gaps = 5/136 (4%)
 Frame = +1

Query  133  AKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMT  312
            AK S   T V   R++A  +++ H LS       +S   F+F PI+E+ V+R MT RY  
Sbjct  9    AKMSQTLTNVQELRLRA--STTRHALSDIVREKDWS--DFQFAPIREATVSRAMTTRYFE  64

Query  313  DMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVV  489
            D+  YA +DV++VGAGS+GLS AY ++KN P++R+AIIE +V+PGGGAWLGGQLFSAM++
Sbjct  65   DLYRYAVSDVVIVGAGSSGLSAAYVLAKNRPDLRIAIIEANVAPGGGAWLGGQLFSAMIM  124

Query  490  RKPAQVFLDELEVEYE  537
            RKP  +FLDELE+ YE
Sbjct  125  RKPTHLFLDELEIPYE  140



>ref|XP_008026201.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
 gb|EOA86208.1| hypothetical protein SETTUDRAFT_177413 [Setosphaeria turcica 
Et28A]
Length=335

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  181  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAG  360
            AVKA++    + + +   ++ DSF F PI+ES V+R MTRRY  D+ TYA++DV++VGAG
Sbjct  30   AVKAAASGQ-AKTVAELEHNWDSFAFAPIRESQVSRAMTRRYFADLDTYAESDVVIVGAG  88

Query  361  SAGLSCAYEI-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            S GLS A+ + +K P++++AIIE  V+PGGGAWLGGQLFSAMV+RKPA++FL+E+ V YE
Sbjct  89   SCGLSTAFTLATKRPDLKIAIIESGVAPGGGAWLGGQLFSAMVMRKPAELFLNEVGVPYE  148



>gb|KFX46359.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
 gb|KFX46360.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
Length=320

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DNFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE +VSPGGGAWLGGQLFSAM++RKPA+VFL++L V YE
Sbjct  110  IEANVSPGGGAWLGGQLFSAMIMRKPAEVFLNDLGVPYE  148



>ref|XP_002146762.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 ref|XP_002146763.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|EEA26215.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|EEA26216.1| thiazole biosynthesis enzyme [Talaromyces marneffei ATCC 18224]
 gb|KFX44083.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
 gb|KFX44084.1| Thiamine thiazole synthase [Talaromyces marneffei PM1]
Length=334

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D+FKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DNFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE +VSPGGGAWLGGQLFSAM++RKPA+VFL++L V YE
Sbjct  110  IEANVSPGGGAWLGGQLFSAMIMRKPAEVFLNDLGVPYE  148



>ref|XP_750725.1| thiazole biosynthesis enzyme [Aspergillus fumigatus Af293]
 sp|Q4WMX7.1|THI4_ASPFU RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Aspergillus fumigatus Af293]
 gb|EAL88687.1| thiazole biosynthesis enzyme [Aspergillus fumigatus Af293]
 gb|EDP49405.1| thiazole biosynthesis enzyme [Aspergillus fumigatus A1163]
Length=332

 Score =   140 bits (354),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 93/137 (68%), Gaps = 5/137 (4%)
 Frame = +1

Query  130  AAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYM  309
            A   S     +V   V A   S  H L     H     D FKF PI+ES V+R MTRRY 
Sbjct  13   APSPSLKAKVLVPETVPASGTSQTHLLD----HFGGKWDDFKFAPIRESQVSRAMTRRYF  68

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
             D+  YA++D+++VGAGS GLS AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAMV
Sbjct  69   QDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMV  128

Query  487  VRKPAQVFLDELEVEYE  537
            +R+PA+VFL+E+ V +E
Sbjct  129  LRRPAEVFLNEIGVPFE  145



>gb|AGO09853.1| AaceriAAL137Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=321

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = +1

Query  190  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAG  369
            +S+ H LS       +S   F+F PI+E+ V+R MT RY  D+  YA +DV++VGAGS+G
Sbjct  16   SSTRHALSDVVREKDWS--DFEFTPIREATVSRAMTTRYFDDLYKYAVSDVVIVGAGSSG  73

Query  370  LSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            LS AY I+KN P++R+AI+E +V+PGGGAWLGGQLFSAM++RKP  +FLDELE+ YE
Sbjct  74   LSAAYVIAKNRPDLRIAIVEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYE  130



>ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
 gb|ETS79335.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
Length=326

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 93/132 (70%), Gaps = 9/132 (7%)
 Frame = +1

Query  148  NGTPVVSSRVQAVKASSHHNLSVSASHTPYS-LDSFKFQPIKESIVAREMTRRYMTDMIT  324
             G P+  S+V       H N+ V+      S  + F FQPI+ES +AREM RRY  D+  
Sbjct  19   GGVPMADSKV-------HSNMEVATGAAVGSKWEDFTFQPIRESQIAREMARRYFADLDK  71

Query  325  YADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  501
            YA++D++++GAGS GLS AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA
Sbjct  72   YAESDIVIIGAGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPA  131

Query  502  QVFLDELEVEYE  537
              FL+E+ V ++
Sbjct  132  DAFLEEIGVPFD  143



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K+ P++++ I
Sbjct  42   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICI  101

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  102  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  140



>gb|KEY78369.1| thiazole biosynthesis enzyme [Aspergillus fumigatus var. RP-2014]
Length=332

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 93/137 (68%), Gaps = 5/137 (4%)
 Frame = +1

Query  130  AAKSSFNGTPVVSSRVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYM  309
            A   S     +V   V A   S  H L     H     D FKF PI+ES V+R MTRRY 
Sbjct  13   APSPSLKAKVLVPETVPASGTSQTHLLD----HFGGKWDDFKFAPIRESQVSRAMTRRYF  68

Query  310  TDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMV  486
             D+  YA++D+++VGAGS GLS AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAMV
Sbjct  69   QDLDKYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMV  128

Query  487  VRKPAQVFLDELEVEYE  537
            +R+PA+VFL+E+ V +E
Sbjct  129  LRRPAEVFLNEIGVPFE  145



>ref|XP_003044703.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 sp|C7Z8P6.1|THI4_NECH7 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Nectria haematococca mpVI 77-13-4]
 gb|EEU38990.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=322

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  196  SHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLS  375
            S +N + +        D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS
Sbjct  28   SKNNTTATIEEMEGKWDDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLS  87

Query  376  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
             AY + K  P++R+AIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  88   AAYILGKKRPDLRIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYE  142



>ref|XP_001214996.1| hypothetical protein ATEG_05818 [Aspergillus terreus NIH2624]
 gb|EAU33579.1| hypothetical protein ATEG_05818 [Aspergillus terreus NIH2624]
Length=333

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  226  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NP  402
            H     D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++   P
Sbjct  42   HFGNKWDDFKFAPIRESQVSRAMTRRYFQDLDKYAESDVVIVGAGSCGLSTAYVLANARP  101

Query  403  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            ++++AIIE SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V YE
Sbjct  102  DLKIAIIEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYE  146



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K+ P++++ I
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  103  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  141



>gb|EEH38204.2| thiazole biosynthesis enzyme [Paracoccidioides sp. 'lutzii' Pb01]
Length=383

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            D FKF PI+ES V+R MTRRY  D+ TYA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  97   DEFKFGPIRESQVSRAMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  156

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FLD+L + YE
Sbjct  157  IEASVSPGGGAWLGGQLFSAMVLRKPADRFLDDLGIPYE  195



>ref|XP_011273842.1| Thiazole biosynthetic enzyme [Wickerhamomyces ciferrii]
 emb|CCH44316.1| Thiazole biosynthetic enzyme [Wickerhamomyces ciferrii]
Length=326

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +1

Query  163  VSSRVQAVKASSHHNLSVSASHTPYSLD--SFKFQPIKESIVAREMTRRYMTDMITYADT  336
            V+ + Q +  S  H +  + S    + D   F+F+PI+E+ V+R MT RY  D+  +A +
Sbjct  8    VTEQTQTLNVSGSHPIRHALSDVVKTDDWSDFEFKPIREATVSRAMTSRYFKDLDKHAVS  67

Query  337  DVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFL  513
            DV+++GAGSAG+S AY I+KN P++++ IIEQ+VSPGGGAWLGGQLFSAM++RKPA +FL
Sbjct  68   DVVIIGAGSAGISAAYTIAKNRPDLKITIIEQNVSPGGGAWLGGQLFSAMIMRKPAHLFL  127

Query  514  DELEVEYE  537
            +E+ VEYE
Sbjct  128  EEVGVEYE  135



>dbj|GAM35876.1| thiazole biosynthetic enzyme [Talaromyces cellulolyticus]
Length=334

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K  P++++AI
Sbjct  50   DSFKFAPIRESQVSRAMTRRYFNDLDKYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAI  109

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            +E +VSPGGGAWLGGQLFSAM++RKPA VFL++L V YE
Sbjct  110  VEANVSPGGGAWLGGQLFSAMIMRKPADVFLNDLGVPYE  148



>gb|KHN95056.1| thiazole biosynthetic enzyme variant 1 [Metarhizium album ARSEF 
1941]
Length=321

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            DSFKF PI+ES V+R MTRRY  D+ TYA++D++++GAGS GLS AY + K  P++++ I
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIIGAGSCGLSAAYVLGKQRPDLKICI  102

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  103  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  141



>gb|KGQ06713.1| Thiamine thiazole synthase [Beauveria bassiana D1-5]
Length=330

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D+F+F PI+ES V+R MTRRY  D+ TYA++D++++GAGS GLS AY + K  P++++AI
Sbjct  49   DTFQFAPIRESQVSRAMTRRYFQDLDTYAESDIVIIGAGSCGLSAAYVLGKKRPDLKIAI  108

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA VFL E+ V YE
Sbjct  109  IEASVSPGGGAWLGGQLFSAMVMRKPADVFLREVGVAYE  147



>ref|XP_008598283.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
 gb|EJP65993.1| mitochondrial thiazole biosynthetic enzyme [Beauveria bassiana 
ARSEF 2860]
Length=330

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 1/99 (1%)
 Frame = +1

Query  244  DSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  420
            D+F+F PI+ES V+R MTRRY  D+ TYA++D++++GAGS GLS AY + K  P++++AI
Sbjct  49   DNFQFAPIRESQVSRAMTRRYFQDLDTYAESDIVIIGAGSCGLSAAYVLGKKRPDLKIAI  108

Query  421  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  537
            IE SVSPGGGAWLGGQLFSAMV+RKPA VFL E+ V YE
Sbjct  109  IEASVSPGGGAWLGGQLFSAMVMRKPADVFLREVGVPYE  147



Lambda      K        H        a         alpha
   0.316    0.129    0.362    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800