BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF032G08

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590366.1|  PREDICTED: mitotic checkpoint protein BUB3.1       234   8e-73   Nicotiana tomentosiformis
ref|XP_009777463.1|  PREDICTED: mitotic checkpoint protein BUB3.1       233   5e-72   Nicotiana sylvestris
ref|XP_002527504.1|  mitotic checkpoint protein bub3, putative          228   2e-70   Ricinus communis
ref|XP_004230702.1|  PREDICTED: mitotic checkpoint protein BUB3.1       228   3e-70   Solanum lycopersicum
ref|XP_006346313.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    228   3e-70   Solanum tuberosum [potatoes]
ref|XP_011092506.1|  PREDICTED: mitotic checkpoint protein BUB3.1       226   1e-69   
gb|EYU39062.1|  hypothetical protein MIMGU_mgv1a009456mg                226   1e-69   Erythranthe guttata [common monkey flower]
gb|KDP44484.1|  hypothetical protein JCGZ_16317                         226   2e-69   Jatropha curcas
ref|XP_002300265.2|  WD-40 repeat family protein                        225   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010099611.1|  Mitotic checkpoint protein                         224   5e-69   Morus notabilis
ref|XP_008454389.1|  PREDICTED: mitotic checkpoint protein BUB3.2       224   9e-69   Cucumis melo [Oriental melon]
emb|CDO97272.1|  unnamed protein product                                224   1e-68   Coffea canephora [robusta coffee]
ref|XP_004152275.1|  PREDICTED: mitotic checkpoint protein BUB3-like    223   4e-68   
ref|XP_004156860.1|  PREDICTED: mitotic checkpoint protein BUB3-like    223   4e-68   
ref|XP_007042628.1|  Transducin/WD40 repeat-like superfamily protein    222   4e-68   Theobroma cacao [chocolate]
gb|KCW55112.1|  hypothetical protein EUGRSUZ_I01072                     223   9e-68   Eucalyptus grandis [rose gum]
gb|KJB79448.1|  hypothetical protein B456_013G050200                    220   1e-67   Gossypium raimondii
gb|KJB79446.1|  hypothetical protein B456_013G050200                    220   1e-67   Gossypium raimondii
gb|KJB79445.1|  hypothetical protein B456_013G050200                    221   2e-67   Gossypium raimondii
ref|XP_010030628.1|  PREDICTED: mitotic checkpoint protein BUB3.2       223   2e-67   Eucalyptus grandis [rose gum]
gb|EYU37574.1|  hypothetical protein MIMGU_mgv1a009424mg                219   5e-67   Erythranthe guttata [common monkey flower]
gb|KHG11458.1|  Bub3                                                    219   6e-67   Gossypium arboreum [tree cotton]
ref|XP_002313908.2|  WD-40 repeat family protein                        218   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011001892.1|  PREDICTED: mitotic checkpoint protein BUB3.1       218   2e-66   Populus euphratica
ref|XP_007201242.1|  hypothetical protein PRUPE_ppa008206mg             218   2e-66   Prunus persica
ref|XP_006422834.1|  hypothetical protein CICLE_v10028761mg             218   3e-66   Citrus clementina [clementine]
ref|XP_010942824.1|  PREDICTED: mitotic checkpoint protein BUB3.1       218   3e-66   Elaeis guineensis
ref|XP_006422835.1|  hypothetical protein CICLE_v10028761mg             218   3e-66   
ref|XP_008787173.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    218   3e-66   Phoenix dactylifera
ref|XP_002264472.1|  PREDICTED: mitotic checkpoint protein BUB3.2       217   4e-66   Vitis vinifera
ref|XP_010277064.1|  PREDICTED: mitotic checkpoint protein BUB3.2       217   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010541847.1|  PREDICTED: mitotic checkpoint protein BUB3.2       216   8e-66   Tarenaya hassleriana [spider flower]
ref|XP_009347116.1|  PREDICTED: mitotic checkpoint protein BUB3.2       216   9e-66   Pyrus x bretschneideri [bai li]
ref|XP_008364436.1|  PREDICTED: mitotic checkpoint protein BUB3.2       216   1e-65   Malus domestica [apple tree]
ref|XP_011088067.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    216   1e-65   Sesamum indicum [beniseed]
gb|KJB32262.1|  hypothetical protein B456_005G232100                    211   2e-65   Gossypium raimondii
ref|NP_001239974.1|  uncharacterized protein LOC100820541               216   2e-65   Glycine max [soybeans]
ref|XP_007143105.1|  hypothetical protein PHAVU_007G044000g             216   2e-65   Phaseolus vulgaris [French bean]
ref|XP_006849345.1|  hypothetical protein AMTR_s00164p00065390          216   2e-65   Amborella trichopoda
emb|CAN82065.1|  hypothetical protein VITISV_008011                     216   3e-65   Vitis vinifera
ref|XP_004289802.1|  PREDICTED: mitotic checkpoint protein BUB3.2       214   4e-65   Fragaria vesca subsp. vesca
ref|XP_004511310.1|  PREDICTED: mitotic checkpoint protein BUB3-like    214   4e-65   Cicer arietinum [garbanzo]
ref|XP_008382226.1|  PREDICTED: mitotic checkpoint protein BUB3.2       214   5e-65   
gb|KJB32260.1|  hypothetical protein B456_005G232100                    213   1e-64   Gossypium raimondii
gb|KJB32261.1|  hypothetical protein B456_005G232100                    213   2e-64   Gossypium raimondii
ref|XP_009335381.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    213   2e-64   Pyrus x bretschneideri [bai li]
ref|XP_003536585.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    213   3e-64   Glycine max [soybeans]
gb|KHN06798.1|  Mitotic checkpoint protein BUB3                         212   3e-64   Glycine soja [wild soybean]
ref|XP_010687353.1|  PREDICTED: mitotic checkpoint protein BUB3.1       212   5e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003610622.1|  Mitotic checkpoint protein BUB3                    211   8e-64   Medicago truncatula
gb|KHN42322.1|  Mitotic checkpoint protein BUB3                         211   1e-63   Glycine soja [wild soybean]
ref|XP_003555986.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    211   1e-63   Glycine max [soybeans]
gb|EPS71625.1|  hypothetical protein M569_03130                         209   3e-63   Genlisea aurea
ref|XP_007143112.1|  hypothetical protein PHAVU_007G044700g             210   3e-63   Phaseolus vulgaris [French bean]
ref|XP_010556011.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    209   4e-63   Tarenaya hassleriana [spider flower]
ref|XP_010243391.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    208   1e-62   Nelumbo nucifera [Indian lotus]
gb|ABF96948.1|  Mitotic checkpoint protein BUB3, putative, expressed    205   1e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651529.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    207   2e-62   
ref|XP_009396041.1|  PREDICTED: mitotic checkpoint protein BUB3.2       207   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001050471.1|  Os03g0448600                                       207   5e-62   
gb|EEC75559.1|  hypothetical protein OsI_12223                          207   5e-62   Oryza sativa Indica Group [Indian rice]
gb|EMS68234.1|  Mitotic checkpoint protein BUB3                         203   9e-62   Triticum urartu
ref|XP_009111676.1|  PREDICTED: mitotic checkpoint protein BUB3.1       206   1e-61   Brassica rapa
emb|CDX95434.1|  BnaC01g33260D                                          205   2e-61   
ref|XP_002436452.1|  hypothetical protein SORBIDRAFT_10g002920          204   8e-61   Sorghum bicolor [broomcorn]
gb|AFW85916.1|  hypothetical protein ZEAMMB73_533080                    201   1e-60   
ref|XP_010507823.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    202   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010487904.1|  PREDICTED: mitotic checkpoint protein BUB3.1       202   3e-60   Camelina sativa [gold-of-pleasure]
ref|NP_001149777.1|  LOC100283404                                       201   6e-60   Zea mays [maize]
gb|ACG48694.1|  mitotic checkpoint protein BUB3                         201   6e-60   Zea mays [maize]
ref|XP_010466109.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    201   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006298078.1|  hypothetical protein CARUB_v10014121mg             201   7e-60   Capsella rubella
gb|ACF78394.1|  unknown                                                 201   7e-60   Zea mays [maize]
ref|XP_002883194.1|  hypothetical protein ARALYDRAFT_898343             201   8e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_009107249.1|  PREDICTED: mitotic checkpoint protein BUB3.2       201   8e-60   Brassica rapa
gb|ABK21756.1|  unknown                                                 200   3e-59   Picea sitchensis
emb|CDY59371.1|  BnaA08g29630D                                          199   5e-59   Brassica napus [oilseed rape]
ref|XP_010461841.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010479422.1|  PREDICTED: mitotic checkpoint protein BUB3.2       198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003562373.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    198   1e-58   Brachypodium distachyon [annual false brome]
gb|AAG51772.1|AC079674_5  mitotic checkpoint protein, 3' partial;...    195   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566644.1|  cell cycle arrest protein BUB3                        198   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500544.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    198   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006393203.1|  hypothetical protein EUTSA_v10011632mg             197   2e-58   Eutrema salsugineum [saltwater cress]
gb|EMT22272.1|  hypothetical protein F775_32007                         199   3e-58   
ref|XP_002891542.1|  hypothetical protein ARALYDRAFT_474121             196   7e-58   
ref|XP_002970095.1|  hypothetical protein SELMODRAFT_146851             196   7e-58   Selaginella moellendorffii
ref|NP_175413.1|  cell cycle arrest protein BUB3                        195   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305280.1|  hypothetical protein CARUB_v10009656mg             195   2e-57   
emb|CDY03579.1|  BnaC03g68380D                                          193   7e-57   
gb|KFK35968.1|  hypothetical protein AALP_AA4G061300                    189   4e-55   Arabis alpina [alpine rockcress]
ref|XP_001764716.1|  predicted protein                                  188   5e-55   
gb|EEC82360.1|  hypothetical protein OsI_26682                          184   4e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001175281.1|  Os07g0588500                                       180   2e-51   
ref|XP_008680589.1|  PREDICTED: mitotic checkpoint protein BUB3.1...    170   2e-50   
ref|XP_003560020.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    154   1e-41   
ref|XP_010243393.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    152   2e-41   
ref|XP_001771348.1|  predicted protein                                  143   1e-37   
ref|XP_001758191.1|  predicted protein                                  139   2e-36   
gb|EMT11166.1|  hypothetical protein F775_07555                         134   6e-35   
gb|ABK24912.1|  unknown                                                 135   8e-35   Picea sitchensis
gb|KHN42317.1|  Mitotic checkpoint protein BUB3                         132   6e-34   Glycine soja [wild soybean]
ref|XP_009395198.1|  PREDICTED: mitotic checkpoint protein BUB3.2...    129   7e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE67502.1|  hypothetical protein OsJ_24938                          127   9e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005089574.1|  PREDICTED: mitotic checkpoint protein BUB3-like    126   3e-31   Aplysia californica
gb|ELU09330.1|  hypothetical protein CAPTEDRAFT_21337                   125   4e-31   Capitella teleta
ref|XP_006727789.1|  PREDICTED: mitotic checkpoint protein BUB3-like    120   8e-31   Leptonychotes weddellii
ref|XP_005648737.1|  WD40 repeat-like protein                           124   9e-31   Coccomyxa subellipsoidea C-169
ref|XP_008154368.1|  PREDICTED: mitotic checkpoint protein BUB3         123   3e-30   
gb|EDL17720.1|  budding uninhibited by benzimidazoles 3 homolog (...    120   4e-30   Mus musculus [mouse]
ref|XP_009874299.1|  PREDICTED: mitotic checkpoint protein BUB3-like    118   4e-30   Apaloderma vittatum
gb|KFP92054.1|  Mitotic checkpoint protein BUB3                         118   5e-30   Apaloderma vittatum
ref|XP_005880912.1|  PREDICTED: mitotic checkpoint protein BUB3         122   6e-30   
gb|EHH65091.1|  hypothetical protein EGM_18435                          122   1e-29   Macaca fascicularis [crab eating macaque]
ref|XP_010597524.1|  PREDICTED: LOW QUALITY PROTEIN: mitotic chec...    121   1e-29   Loxodonta africana [African bush elephant]
ref|XP_004374979.1|  PREDICTED: mitotic checkpoint protein BUB3         121   1e-29   Trichechus manatus latirostris
ref|XP_005671578.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   1e-29   
ref|XP_004700939.1|  PREDICTED: mitotic checkpoint protein BUB3         121   1e-29   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004659326.1|  PREDICTED: mitotic checkpoint protein BUB3         121   1e-29   Jaculus jaculus
ref|XP_004438950.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    121   2e-29   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004438949.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    121   2e-29   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006008248.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    121   2e-29   Latimeria chalumnae
ref|XP_006008249.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    121   2e-29   
ref|XP_006136163.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005305938.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Chrysemys picta bellii
ref|XP_005305939.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Chrysemys picta bellii
ref|XP_006267668.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   
ref|XP_005602229.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Equus caballus [domestic horse]
ref|NP_033904.2|  mitotic checkpoint protein BUB3                       120   3e-29   Mus musculus [mouse]
ref|XP_006136164.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006879938.1|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002756721.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Callithrix jacchus [common marmoset]
ref|XP_006267669.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   
ref|XP_010633595.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Fukomys damarensis [Damara mole rat]
ref|XP_006867487.1|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   Chrysochloris asiatica
ref|XP_006188783.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   
gb|EAW49287.1|  BUB3 budding uninhibited by benzimidazoles 3 homo...    120   3e-29   Homo sapiens [man]
ref|XP_006080476.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Bubalus bubalis [domestic water buffalo]
ref|XP_010633604.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Fukomys damarensis [Damara mole rat]
gb|AAD38038.1|AF149822_1  mitotic checkpoint protein BUB3               120   3e-29   Mus musculus [mouse]
ref|XP_007962513.1|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   Chlorocebus sabaeus
gb|AAX43869.1|  BUB3 budding uninhibited by benzimidazoles 3-like       120   3e-29   synthetic construct
ref|XP_004751814.1|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   
ref|XP_008825474.1|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   Nannospalax galili
ref|XP_002722642.2|  PREDICTED: mitotic checkpoint protein BUB3         120   3e-29   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003734599.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   3e-29   Callithrix jacchus [common marmoset]
ref|NP_004716.1|  mitotic checkpoint protein BUB3 isoform a             120   3e-29   Homo sapiens [man]
ref|XP_004474644.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   Dasypus novemcinctus
gb|EDL17719.1|  budding uninhibited by benzimidazoles 3 homolog (...    120   4e-29   Mus musculus [mouse]
gb|KFO37637.1|  Mitotic checkpoint protein BUB3                         120   4e-29   Fukomys damarensis [Damara mole rat]
ref|XP_010633579.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   Fukomys damarensis [Damara mole rat]
ref|XP_003755337.1|  PREDICTED: mitotic checkpoint protein BUB3         120   4e-29   Sarcophilus harrisii
ref|XP_006025193.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   
ref|XP_001367606.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   Monodelphis domestica
ref|XP_005351448.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   Microtus ochrogaster [prairie voles]
gb|ELK11851.1|  Mitotic checkpoint protein BUB3                         123   4e-29   Pteropus alecto
ref|XP_006025194.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   4e-29   
ref|XP_005351447.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   5e-29   
ref|XP_007519725.1|  PREDICTED: mitotic checkpoint protein BUB3         120   5e-29   Erinaceus europaeus [common hedgehog]
ref|XP_004680433.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    120   5e-29   Condylura cristata
ref|XP_002608311.1|  hypothetical protein BRAFLDRAFT_125481             120   6e-29   Branchiostoma floridae
ref|NP_001125579.1|  mitotic checkpoint protein BUB3                    119   6e-29   Pongo abelii [orang utan]
ref|XP_004625654.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   8e-29   Octodon degus
ref|XP_004625653.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   9e-29   Octodon degus
ref|XP_004579810.1|  PREDICTED: mitotic checkpoint protein BUB3         119   1e-28   Ochotona princeps [southern American pika]
ref|XP_010209860.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Tinamus guttatus
ref|XP_007420849.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Python bivittatus
gb|KGL75167.1|  Mitotic checkpoint protein BUB3                         119   1e-28   Tinamus guttatus
ref|XP_007420850.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Python bivittatus
ref|XP_010209861.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Tinamus guttatus
ref|XP_003218630.1|  PREDICTED: mitotic checkpoint protein BUB3         119   1e-28   Anolis carolinensis [Carolina anole]
ref|XP_009668840.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Struthio camelus australis
ref|XP_010182810.1|  PREDICTED: mitotic checkpoint protein BUB3         119   1e-28   Mesitornis unicolor
gb|ETE69240.1|  Mitotic checkpoint protein BUB3                         119   1e-28   Ophiophagus hannah
ref|XP_009668841.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    119   1e-28   Struthio camelus australis
gb|KFQ35683.1|  Mitotic checkpoint protein BUB3                         119   1e-28   Mesitornis unicolor
gb|KFV79058.1|  Mitotic checkpoint protein BUB3                         118   1e-28   Struthio camelus australis
ref|XP_005048890.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   Ficedula albicollis
ref|XP_005232503.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   Falco peregrinus [peregrine]
ref|XP_008926745.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   
ref|XP_008947573.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   Merops nubicus
ref|XP_008489974.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   Calypte anna
gb|KFW84791.1|  Mitotic checkpoint protein BUB3                         118   2e-28   Manacus vitellinus
ref|XP_004020302.1|  PREDICTED: mitotic checkpoint protein BUB3         118   2e-28   
gb|KFM06687.1|  Mitotic checkpoint protein BUB3                         118   2e-28   Aptenodytes forsteri
ref|XP_010713168.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    118   2e-28   Meleagris gallopavo [common turkey]
gb|KFQ16715.1|  Mitotic checkpoint protein BUB3                         118   2e-28   Merops nubicus
ref|NP_001006506.1|  mitotic checkpoint protein BUB3                    118   2e-28   Gallus gallus [bantam]
ref|XP_004989752.1|  mitotic checkpoint protein BUB3                    118   2e-28   Salpingoeca rosetta
ref|XP_002192609.2|  PREDICTED: mitotic checkpoint protein BUB3         118   3e-28   
ref|XP_005505842.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    117   3e-28   Columba livia [carrier pigeon]
gb|EMC88322.1|  Mitotic checkpoint protein BUB3                         117   3e-28   
ref|XP_005494903.1|  PREDICTED: mitotic checkpoint protein BUB3         117   6e-28   Zonotrichia albicollis
gb|ESA02941.1|  hypothetical protein GLOINDRAFT_67599                   116   9e-28   
ref|XP_005023233.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    116   1e-27   Anas platyrhynchos [duck]
ref|XP_005023232.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    116   1e-27   Anas platyrhynchos [duck]
ref|XP_010085772.1|  PREDICTED: mitotic checkpoint protein BUB3         115   2e-27   Pterocles gutturalis
gb|KFV05300.1|  Mitotic checkpoint protein BUB3                         115   2e-27   Pterocles gutturalis
ref|XP_002738187.1|  PREDICTED: mitotic checkpoint protein BUB3-like    115   2e-27   Saccoglossus kowalevskii
dbj|GAN04134.1|  mitotic checkpoint protein BUB3-like                   118   3e-27   Mucor ambiguus
gb|AAK12629.1|AF119790_1  WD repeat protein Bub3                        115   3e-27   Xenopus laevis [clawed frog]
ref|NP_001083768.1|  mitotic checkpoint protein BUB3                    115   3e-27   Xenopus laevis [clawed frog]
gb|EPB85009.1|  hypothetical protein HMPREF1544_08212                   115   4e-27   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_001007498.1|  BUB3 mitotic checkpoint protein                    114   4e-27   
emb|CEG76501.1|  hypothetical protein RMATCC62417_11393                 114   5e-27   Rhizopus microsporus
emb|CAJ81358.1|  BUB3 budding uninhibited by benzimidazoles 3 hom...    114   5e-27   Xenopus tropicalis [western clawed frog]
ref|XP_007902124.1|  PREDICTED: mitotic checkpoint protein BUB3         114   5e-27   Callorhinchus milii [Australian ghost shark]
ref|XP_011433685.1|  PREDICTED: mitotic checkpoint protein BUB3-like    114   5e-27   Crassostrea gigas
ref|XP_780636.1|  PREDICTED: mitotic checkpoint protein BUB3-like...    113   1e-26   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001658374.1|  AAEL007469-PA                                      113   2e-26   Aedes aegypti
ref|XP_005851317.1|  hypothetical protein CHLNCDRAFT_33942              113   2e-26   Chlorella variabilis
ref|XP_001866784.1|  mitotic checkpoint protein BUB3                    113   2e-26   Culex quinquefasciatus
ref|XP_009067387.1|  hypothetical protein LOTGIDRAFT_223691             112   2e-26   Lottia gigantea
ref|XP_001512314.2|  PREDICTED: mitotic checkpoint protein BUB3         112   5e-26   
ref|XP_010141872.1|  PREDICTED: mitotic checkpoint protein BUB3         111   5e-26   Buceros rhinoceros silvestris
gb|KFO94368.1|  Mitotic checkpoint protein BUB3                         111   6e-26   Buceros rhinoceros silvestris
ref|XP_008780968.1|  PREDICTED: mitotic checkpoint protein BUB3.3       111   1e-25   
ref|XP_002109375.1|  hypothetical protein TRIADDRAFT_53336              110   1e-25   Trichoplax adhaerens
emb|CEP12087.1|  hypothetical protein                                   110   2e-25   Parasitella parasitica
ref|XP_002129118.1|  PREDICTED: mitotic checkpoint protein BUB3-like    110   2e-25   Ciona intestinalis [sea vase]
gb|KFM75540.1|  Mitotic checkpoint protein BUB3                         110   2e-25   Stegodyphus mimosarum
ref|XP_005154549.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    110   2e-25   Melopsittacus undulatus
gb|KDQ54325.1|  hypothetical protein JAAARDRAFT_38492                   109   3e-25   Jaapia argillacea MUCL 33604
ref|XP_970295.1|  PREDICTED: mitotic checkpoint protein BUB3            109   4e-25   Tribolium castaneum [rust-red flour beetle]
ref|XP_002070172.1|  GK11174                                            108   6e-25   Drosophila willistoni
ref|XP_002055851.1|  GJ10544                                            108   7e-25   Drosophila virilis
ref|XP_005169562.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    108   7e-25   Danio rerio [leopard danio]
ref|XP_001998848.1|  GI24196                                            108   7e-25   Drosophila mojavensis
ref|XP_005185274.1|  PREDICTED: mitotic checkpoint protein BUB3         108   7e-25   Musca domestica
ref|XP_010938832.1|  PREDICTED: mitotic checkpoint protein BUB3.3       108   8e-25   Elaeis guineensis
gb|AAD44035.1|AF088846_1  mitotic checkpoint control protein            108   8e-25   Drosophila melanogaster
ref|XP_002037219.1|  GM12232                                            108   9e-25   Drosophila sechellia
ref|NP_991272.1|  mitotic checkpoint protein BUB3                       108   9e-25   Danio rerio [leopard danio]
ref|XP_007260980.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    108   9e-25   Astyanax mexicanus [blind cave fish]
ref|XP_007260981.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    108   9e-25   
ref|NP_477381.1|  Bub3, isoform A                                       108   9e-25   Drosophila melanogaster
ref|XP_001989641.1|  GH18686                                            108   1e-24   Drosophila grimshawi
ref|XP_001964758.1|  GF22876                                            108   1e-24   Drosophila ananassae
ref|XP_008478721.1|  PREDICTED: mitotic checkpoint protein BUB3         108   1e-24   
gb|AAM49895.1|  LD23540p                                                107   1e-24   Drosophila melanogaster
gb|ACO09248.1|  Mitotic checkpoint protein BUB3                         107   2e-24   Osmerus mordax
ref|XP_002098566.1|  GE10441                                            107   2e-24   Drosophila yakuba
gb|KDR15933.1|  Mitotic checkpoint protein BUB3                         107   2e-24   Zootermopsis nevadensis
emb|CDQ93187.1|  unnamed protein product                                105   3e-24   Oncorhynchus mykiss
ref|XP_008288658.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    107   3e-24   Stegastes partitus
ref|XP_008288659.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    107   3e-24   Stegastes partitus
gb|KFB42019.1|  AGAP010544-PA-like protein                              107   3e-24   Anopheles sinensis
emb|CBN81549.1|  Mitotic checkpoint protein BUB3                        107   3e-24   Dicentrarchus labrax [European sea bass]
gb|KIP03100.1|  hypothetical protein PHLGIDRAFT_111262                  106   3e-24   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_007314228.1|  hypothetical protein SERLADRAFT_379618             106   3e-24   Serpula lacrymans var. lacrymans S7.9
gb|AAH83205.1|  Bub3 protein                                            106   3e-24   Danio rerio [leopard danio]
gb|ACD13595.1|  mitotic checkpoint protein                              106   5e-24   Penaeus monodon [giant tiger prawn]
ref|XP_006630480.1|  PREDICTED: mitotic checkpoint protein BUB3-like    106   5e-24   Lepisosteus oculatus
ref|XP_010867226.1|  PREDICTED: mitotic checkpoint protein BUB3         106   6e-24   Esox lucius
gb|AAD21971.1|  WD-40 repeat protein                                    105   6e-24   Drosophila melanogaster
ref|XP_010683084.1|  PREDICTED: mitotic checkpoint protein BUB3.3       105   7e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KII87964.1|  hypothetical protein PLICRDRAFT_162888                  105   8e-24   Plicaturopsis crispa FD-325 SS-3
gb|ELW69702.1|  Mitotic checkpoint protein BUB3                         107   1e-23   Tupaia chinensis
ref|XP_007570323.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    105   1e-23   Poecilia formosa
ref|XP_007570331.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    105   1e-23   Poecilia formosa
ref|XP_005794721.1|  PREDICTED: mitotic checkpoint protein BUB3-like    105   1e-23   
ref|XP_001635419.1|  predicted protein                                  105   1e-23   Nematostella vectensis
ref|XP_010779383.1|  PREDICTED: mitotic checkpoint protein BUB3         104   2e-23   Notothenia coriiceps [yellowbelly rockcod]
gb|EPQ16815.1|  Mitotic checkpoint protein BUB3                         104   2e-23   Myotis brandtii
ref|XP_005736525.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    104   2e-23   Pundamilia nyererei
ref|XP_005736526.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    104   2e-23   Pundamilia nyererei
ref|XP_001947199.1|  PREDICTED: mitotic checkpoint protein BUB3         104   2e-23   Acyrthosiphon pisum
gb|AEE62023.1|  unknown                                                 104   3e-23   Dendroctonus ponderosae
ref|XP_004239468.1|  PREDICTED: mitotic checkpoint protein BUB3.3       104   3e-23   Solanum lycopersicum
ref|XP_314512.3|  AGAP010544-PA                                         104   3e-23   Anopheles gambiae str. PEST
ref|XP_006844849.1|  hypothetical protein AMTR_s00058p00096230          103   3e-23   
ref|XP_004561256.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    103   3e-23   Maylandia zebra
ref|XP_003441831.1|  PREDICTED: mitotic checkpoint protein BUB3-l...    103   3e-23   Oreochromis niloticus
ref|XP_004981699.1|  PREDICTED: mitotic checkpoint protein BUB3-like    103   3e-23   Setaria italica
ref|XP_011486560.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    103   4e-23   Oryzias latipes [Japanese rice fish]
gb|KFH73401.1|  cell cycle arrest protein BUB3                          103   4e-23   Mortierella verticillata NRRL 6337
ref|XP_001357763.1|  GA20454                                            103   4e-23   Drosophila pseudoobscura pseudoobscura
ref|XP_010738643.1|  PREDICTED: mitotic checkpoint protein BUB3         103   4e-23   Larimichthys crocea [croceine croaker]
ref|XP_004080489.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    103   4e-23   Oryzias latipes [Japanese rice fish]
ref|XP_008312802.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    103   5e-23   
ref|XP_008312803.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    103   5e-23   
ref|XP_008312801.1|  PREDICTED: mitotic checkpoint protein BUB3 i...    103   6e-23   
gb|AAP92574.1|  Aa2-050                                                 105   6e-23   
ref|XP_003961201.1|  PREDICTED: mitotic checkpoint protein BUB3-like    103   6e-23   
tpg|DAA51492.1|  TPA: hypothetical protein ZEAMMB73_904187              102   8e-23   
ref|XP_008677809.1|  PREDICTED: nucleotide binding protein isofor...    102   8e-23   
ref|XP_003746497.1|  PREDICTED: mitotic checkpoint protein BUB3-like    102   8e-23   
ref|NP_001150233.1|  nucleotide binding protein                         102   9e-23   
ref|XP_008677807.1|  PREDICTED: nucleotide binding protein isofor...    102   9e-23   
ref|XP_006391022.1|  hypothetical protein EUTSA_v10018903mg             102   9e-23   
ref|XP_001698657.1|  WD40 repeat protein                                102   1e-22   
gb|EHJ78871.1|  putative BUB3 budding uninhibited by benzimidazol...    102   1e-22   
ref|XP_009549776.1|  hypothetical protein HETIRDRAFT_435775             102   1e-22   
emb|CDP00388.1|  unnamed protein product                                102   1e-22   
gb|KFB47336.1|  AGAP010544-PA-like protein                              102   1e-22   
ref|XP_002466420.1|  hypothetical protein SORBIDRAFT_01g007510          102   1e-22   
emb|CDS14344.1|  hypothetical protein LRAMOSA06514                      102   2e-22   
ref|XP_006348728.1|  PREDICTED: mitotic checkpoint protein BUB3.3...    101   2e-22   
ref|XP_002502906.1|  predicted protein                                  102   2e-22   
gb|KIM84438.1|  hypothetical protein PILCRDRAFT_6108                    101   2e-22   
ref|XP_004927396.1|  PREDICTED: mitotic checkpoint protein BUB3-like    101   2e-22   
ref|XP_011184683.1|  PREDICTED: mitotic checkpoint protein BUB3         101   2e-22   
ref|XP_011210437.1|  PREDICTED: mitotic checkpoint protein BUB3         101   3e-22   
ref|XP_007393047.1|  hypothetical protein PHACADRAFT_170913             101   3e-22   
gb|EPS57466.1|  hypothetical protein M569_17352                         100   3e-22   
gb|KIJ11703.1|  hypothetical protein PAXINDRAFT_171655                  100   4e-22   
emb|CDH56797.1|  mitotic checkpoint protein bub3                        100   4e-22   
ref|XP_007045974.1|  Transducin/WD40 repeat-like superfamily protein    101   4e-22   
emb|CDH56796.1|  mitotic checkpoint protein bub3                        100   5e-22   
emb|CDO71027.1|  hypothetical protein BN946_scf184844.g31               100   5e-22   
gb|EPS98297.1|  hypothetical protein FOMPIDRAFT_1061466                 100   7e-22   
gb|KDN52472.1|  WD40 repeat-like protein                                100   7e-22   
gb|KDQ31686.1|  hypothetical protein PLEOSDRAFT_1091798                 100   7e-22   
gb|KJB50597.1|  hypothetical protein B456_008G178600                    100   8e-22   
ref|XP_007223765.1|  hypothetical protein PRUPE_ppa010569mg           99.0    1e-21   
ref|XP_007870754.1|  WD40 repeat-like protein                         99.8    1e-21   
ref|XP_003378580.1|  mitotic checkpoint protein BUB3                    102   1e-21   
ref|XP_004356556.1|  WD domain, Gbeta repeat-containing protein       99.8    1e-21   
gb|ETN62426.1|  mitotic checkpoint protein bub3                       99.8    1e-21   
ref|XP_006675919.1|  hypothetical protein BATDEDRAFT_84472            99.8    1e-21   
gb|KIK95471.1|  hypothetical protein PAXRUDRAFT_380581                99.4    1e-21   
ref|XP_011352277.1|  PREDICTED: mitotic checkpoint protein BUB3       99.0    2e-21   
ref|XP_007368929.1|  WD40 repeat-like protein                         99.0    2e-21   
ref|XP_008221725.1|  PREDICTED: mitotic checkpoint protein BUB3.3     98.6    3e-21   
ref|XP_004521190.1|  PREDICTED: mitotic checkpoint protein BUB3-like  98.6    3e-21   
gb|KIJ59972.1|  hypothetical protein HYDPIDRAFT_32701                 98.6    3e-21   
ref|XP_011265368.1|  PREDICTED: mitotic checkpoint protein BUB3       98.2    4e-21   
ref|XP_011075552.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  99.8    4e-21   
ref|XP_002957572.1|  hypothetical protein VOLCADRAFT_102432           98.2    4e-21   
gb|KIM60024.1|  hypothetical protein SCLCIDRAFT_976483                98.2    4e-21   
ref|XP_011050868.1|  PREDICTED: mitotic checkpoint protein BUB3       98.2    4e-21   
ref|XP_007152243.1|  hypothetical protein PHAVU_004G113600g           98.2    4e-21   
ref|XP_006301939.1|  hypothetical protein CARUB_v10022417mg           97.8    4e-21   
ref|XP_011298128.1|  PREDICTED: mitotic checkpoint protein BUB3       97.8    4e-21   
ref|XP_003384302.1|  PREDICTED: mitotic checkpoint protein BUB3-like  97.8    5e-21   
ref|XP_003393260.1|  PREDICTED: mitotic checkpoint protein BUB3-like  97.4    6e-21   
ref|XP_006438774.1|  hypothetical protein CICLE_v10033345mg           97.4    7e-21   
ref|XP_008339841.1|  PREDICTED: mitotic checkpoint protein BUB3.3     97.4    7e-21   
ref|XP_005842151.1|  hypothetical protein GUITHDRAFT_62815            97.4    8e-21   
ref|XP_393536.2|  PREDICTED: mitotic checkpoint protein BUB3          97.4    8e-21   
ref|XP_003706037.1|  PREDICTED: mitotic checkpoint protein BUB3-like  97.4    8e-21   
ref|XP_009788126.1|  PREDICTED: mitotic checkpoint protein BUB3.3     97.1    8e-21   
gb|KHJ46884.1|  nucleoporin GLE2 family protein                       96.7    1e-20   
gb|KCW64911.1|  hypothetical protein EUGRSUZ_G02467                   96.7    1e-20   
gb|KIO01416.1|  hypothetical protein M404DRAFT_1003112                97.1    1e-20   
gb|ADD24391.1|  Mitotic checkpoint protein BUB3                       97.1    1e-20   
gb|ACO12446.1|  Mitotic checkpoint protein BUB3                       96.7    1e-20   
gb|KHN03138.1|  Mitotic checkpoint protein bub3                       96.3    1e-20   
gb|KIL58738.1|  hypothetical protein M378DRAFT_170200                 96.7    2e-20   
ref|XP_002154916.2|  PREDICTED: mitotic checkpoint protein BUB3-like  96.3    2e-20   
ref|XP_011463671.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  97.8    2e-20   
gb|KDQ09640.1|  hypothetical protein BOTBODRAFT_58543                 95.9    2e-20   
ref|XP_001607033.1|  PREDICTED: mitotic checkpoint protein BUB3       95.9    2e-20   
ref|XP_009591365.1|  PREDICTED: mitotic checkpoint protein BUB3.3     95.9    3e-20   
gb|KIO23258.1|  hypothetical protein M407DRAFT_111042                 95.9    3e-20   
gb|KFD47333.1|  hypothetical protein M513_11791                       98.2    4e-20   
ref|XP_011499082.1|  PREDICTED: mitotic checkpoint protein BUB3       95.5    4e-20   
ref|XP_009012296.1|  hypothetical protein HELRODRAFT_156412           94.7    5e-20   
gb|KHN01999.1|  Mitotic checkpoint protein bub3                       94.7    5e-20   
ref|XP_007261994.1|  WD40 repeat-like protein                         95.1    5e-20   
gb|KFK41356.1|  hypothetical protein AALP_AA2G119600                  94.7    5e-20   
gb|ESZ89838.1|  mitotic checkpoint protein BUB3                       95.1    5e-20   
emb|CCA78052.1|  probable SONA                                        95.1    5e-20   
ref|XP_002267447.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  94.7    6e-20   
ref|XP_010470926.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  94.7    6e-20   
ref|NP_974113.1|  transducin/WD-40 repeat-containing protein          94.4    6e-20   
gb|EFX90203.1|  hypothetical protein DAPPUDRAFT_310020                94.7    7e-20   
ref|XP_001836495.2|  polyA+ RNA export                                94.7    8e-20   
ref|XP_001223719.1|  hypothetical protein CHGG_04505                  94.4    8e-20   
ref|XP_010068784.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  96.7    8e-20   
gb|AAG60107.1|AC073178_18  mitotic checkpoint protein, putative       94.4    9e-20   
ref|NP_564965.1|  transducin/WD-40 repeat-containing protein          94.4    9e-20   
gb|ETN62481.1|  mitotic checkpoint protein bub3                       94.4    1e-19   
ref|XP_007393402.1|  hypothetical protein PHACADRAFT_139699           94.4    1e-19   
ref|XP_003061020.1|  predicted protein                                94.0    1e-19   
gb|KFD69769.1|  hypothetical protein M514_11791                       96.7    1e-19   
emb|CCM00075.1|  predicted protein                                    94.0    1e-19   
gb|EMD34158.1|  hypothetical protein CERSUDRAFT_67742                 93.6    2e-19   
ref|XP_008039588.1|  WD40 repeat-like protein                         93.6    2e-19   
ref|XP_007318749.1|  hypothetical protein SERLADRAFT_468460           93.6    2e-19   
gb|KIK36064.1|  hypothetical protein CY34DRAFT_811620                 93.2    2e-19   
ref|XP_004349076.1|  testis mitotic checkpoint BUB3                   93.2    2e-19   
gb|KIO34489.1|  hypothetical protein M407DRAFT_13364                  93.2    2e-19   
ref|XP_006574334.1|  PREDICTED: uncharacterized LOC100306157 isof...  94.4    3e-19   
ref|XP_008041777.1|  WD40 repeat-like protein                         92.8    3e-19   
ref|XP_007853389.1|  mitotic checkpoint protein                       92.8    3e-19   
ref|XP_007301637.1|  WD40 repeat-like protein                         92.4    4e-19   
ref|XP_010258422.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  94.7    4e-19   
ref|XP_004490179.1|  PREDICTED: mitotic checkpoint protein bub3-like  94.4    4e-19   
ref|XP_002887233.1|  transducin family protein                        92.4    4e-19   
gb|KIP08067.1|  hypothetical protein PHLGIDRAFT_29792                 92.4    4e-19   
dbj|GAM25293.1|  hypothetical protein SAMD00019534_084680             92.4    5e-19   
ref|XP_008546185.1|  PREDICTED: mitotic checkpoint protein BUB3       92.0    5e-19   
gb|KIR85912.1|  cell cycle arrest protein BUB3                        92.4    5e-19   
gb|AAM65609.1|  mitotic checkpoint protein, putative                  92.0    5e-19   
ref|XP_006463599.1|  hypothetical protein AGABI2DRAFT_194378          92.0    5e-19   
ref|XP_007334343.1|  hypothetical protein AGABI1DRAFT_116607          92.0    5e-19   
gb|KIM56897.1|  hypothetical protein SCLCIDRAFT_131585                92.0    6e-19   
gb|KDQ13524.1|  hypothetical protein BOTBODRAFT_111302                92.0    6e-19   
ref|XP_007351004.1|  WD40 repeat-like protein                         92.0    6e-19   
ref|XP_007831830.1|  hypothetical protein PFICI_05058                 92.0    6e-19   
ref|XP_009416817.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  91.7    6e-19   
gb|KIR29361.1|  cell cycle arrest protein BUB3                        91.7    7e-19   
gb|EIE82642.1|  hypothetical protein RO3G_07347                       91.3    7e-19   
gb|KIL59099.1|  hypothetical protein M378DRAFT_169744                 91.7    7e-19   
ref|XP_629851.1|  WD40 repeat-containing protein                      91.7    8e-19   
ref|XP_011137881.1|  PREDICTED: mitotic checkpoint protein BUB3       91.7    8e-19   
gb|EMF08363.1|  WD40 repeat-like protein                              91.3    1e-18   
gb|KIK41734.1|  hypothetical protein CY34DRAFT_805760                 91.3    1e-18   
ref|XP_010415586.1|  PREDICTED: mitotic checkpoint protein BUB3.3     90.9    1e-18   
gb|KFH43706.1|  Mitotic checkpoint protein BUB3-like protein          90.9    1e-18   
gb|AFR95559.2|  cell cycle arrest protein BUB3                        90.9    1e-18   
ref|XP_009127727.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  90.5    2e-18   
ref|XP_009127726.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  90.5    2e-18   
ref|XP_002512132.1|  initiation factor 5a, putative                   92.4    2e-18   
emb|CDO75792.1|  hypothetical protein BN946_scf184934.g7              90.9    2e-18   
gb|KGB77895.1|  cell cycle arrest protein BUB3                        90.1    2e-18   
emb|CCD52666.1|  similar to mitotic checkpoint protein BUB3           90.1    3e-18   
ref|XP_007384174.1|  WD40 repeat-like protein                         90.5    3e-18   
gb|KIY43859.1|  WD40 repeat-like protein                              90.1    3e-18   
gb|KIR99522.1|  cell cycle arrest protein BUB3                        89.7    3e-18   
gb|KIP05176.1|  hypothetical protein PHLGIDRAFT_129061                90.1    3e-18   
gb|EEE59965.1|  hypothetical protein OsJ_12660                        91.3    3e-18   
gb|KIR56684.1|  cell cycle arrest protein BUB3                        89.7    4e-18   
emb|CDY44065.1|  BnaA02g14290D                                        89.7    4e-18   
gb|KII89844.1|  hypothetical protein PLICRDRAFT_29077                 89.7    4e-18   
ref|XP_007342793.1|  WD40 repeat-like protein                         89.7    4e-18   
gb|KIY34780.1|  cell cycle arrest protein BUB3                        89.7    4e-18   
gb|KJE00778.1|  cell cycle arrest protein BUB3                        89.7    4e-18   
ref|XP_010096559.1|  Mitotic checkpoint protein bub3                  89.7    4e-18   
gb|EEC76213.1|  hypothetical protein OsI_13610                        91.3    5e-18   
gb|ETO19043.1|  hypothetical protein RFI_18194                        90.5    5e-18   
gb|KEZ41198.1|  Mitotic checkpoint protein BUB3                       89.4    5e-18   
gb|KDQ16126.1|  hypothetical protein BOTBODRAFT_157397                89.4    5e-18   
ref|XP_003194286.1|  poly(a)+ rna export protein                      89.4    5e-18   
gb|KIJ62781.1|  hypothetical protein HYDPIDRAFT_113879                89.0    7e-18   
ref|XP_001836388.1|  Poly(A)+ RNA export protein                      89.0    7e-18   
gb|KIR60002.1|  cell cycle arrest protein BUB3                        89.0    7e-18   
gb|KHJ30435.1|  putative mitotic checkpoint protein bub3              89.0    8e-18   
ref|XP_007776320.1|  cell cycle arrest protein BUB3                   89.0    8e-18   
ref|XP_011116292.1|  hypothetical protein H072_10876                  89.0    8e-18   
ref|XP_002841512.1|  hypothetical protein                             89.0    8e-18   
ref|XP_009545146.1|  hypothetical protein HETIRDRAFT_439495           88.6    9e-18   
ref|XP_003027427.1|  hypothetical protein SCHCODRAFT_86026            88.6    1e-17   
ref|XP_006693888.1|  hypothetical protein CTHT_0034550                88.6    1e-17   
gb|KIK28701.1|  hypothetical protein PISMIDRAFT_90050                 88.6    1e-17   
ref|XP_003291452.1|  WD40 repeat-containing protein                   88.2    1e-17   
ref|XP_002560578.1|  Pc16g02050                                       88.6    1e-17   
gb|EPT01716.1|  Poly+ RNA export protein                              88.6    1e-17   
ref|XP_002837803.1|  hypothetical protein                             88.2    1e-17   
ref|XP_006961527.1|  predicted protein                                88.2    1e-17   
emb|CDY28548.1|  BnaC02g19170D                                        88.2    1e-17   
gb|KGN51155.1|  hypothetical protein Csa_5G468480                     88.2    1e-17   
ref|XP_006674422.1|  Poly(A)+ RNA export protein                      88.2    1e-17   
emb|CDM30052.1|  Poly(A)+ RNA export protein                          88.2    1e-17   
gb|KIO14613.1|  hypothetical protein M404DRAFT_991355                 88.2    2e-17   
gb|EUC64874.1|  poly(A)+ RNA export protein                           88.2    2e-17   
gb|KGO46465.1|  hypothetical protein PEXP_100220                      88.2    2e-17   
gb|ABK92875.1|  unknown                                               87.8    2e-17   
ref|XP_002312269.2|  transducin family protein                        87.8    2e-17   
ref|XP_003559161.1|  PREDICTED: mitotic checkpoint protein BUB3.3     87.4    2e-17   
gb|EFA83564.1|  WD40 repeat-containing protein                        87.4    2e-17   
gb|KIH89360.1|  cell cycle arrest protein BUB3                        87.8    2e-17   
ref|XP_752269.1|  nuclear pore complex protein (SonA)                 87.8    2e-17   
gb|KIK62481.1|  hypothetical protein GYMLUDRAFT_72708                 87.4    2e-17   
ref|XP_001264863.1|  nuclear pore complex protein (SonA), putative    87.4    3e-17   
ref|XP_002681792.1|  predicted protein                                87.4    3e-17   
ref|XP_007362410.1|  Poly(A)+ RNA export protein                      87.4    3e-17   
gb|ERS96749.1|  hypothetical protein HMPREF1624_06958                 87.4    3e-17   
gb|KIY72387.1|  Poly(A)+ RNA export protein                           87.4    3e-17   
gb|KIJ97317.1|  hypothetical protein K443DRAFT_632180                 87.0    3e-17   
gb|EYU28818.1|  hypothetical protein MIMGU_mgv1a010313mg              87.0    3e-17   
ref|XP_007263264.1|  poly RNA export protein                          87.0    3e-17   
ref|XP_007911821.1|  putative poly + rna export protein               87.0    3e-17   
ref|XP_003848127.1|  hypothetical protein MYCGRDRAFT_111499           87.0    3e-17   
ref|XP_010532631.1|  PREDICTED: mitotic checkpoint protein BUB3.3     86.7    4e-17   
ref|XP_003660355.1|  hypothetical protein MYCTH_2298566               87.0    4e-17   
ref|XP_011125002.1|  hypothetical protein AOL_s00110g10               87.0    4e-17   
gb|EPS31846.1|  hypothetical protein PDE_06804                        87.0    4e-17   
gb|KDP41256.1|  hypothetical protein JCGZ_15663                       86.7    4e-17   
ref|XP_003007433.1|  mitotic checkpoint protein BUB3                  86.7    5e-17   
ref|XP_001243277.1|  hypothetical protein CIMG_07173                  86.7    5e-17   
gb|KDQ59327.1|  hypothetical protein JAAARDRAFT_34068                 86.7    5e-17   
ref|XP_003070313.1|  poly(A)+ RNA export protein, putative            86.7    5e-17   
ref|XP_005776026.1|  hypothetical protein EMIHUDRAFT_74365            86.3    5e-17   
ref|XP_009656255.1|  mitotic checkpoint protein BUB3                  86.7    5e-17   
gb|KIY32960.1|  mRNA export factor                                    86.7    5e-17   
emb|CCX30750.1|  Similar to Poly(A)+ RNA export protein; acc. no....  86.7    6e-17   
gb|EQL00725.1|  mitotic checkpoint protein BUB3                       86.3    6e-17   
ref|XP_010511967.1|  PREDICTED: mitotic checkpoint protein BUB3.3...  85.9    6e-17   
gb|EHK24895.1|  hypothetical protein TRIVIDRAFT_72120                 86.3    6e-17   
ref|XP_004143820.1|  PREDICTED: mitotic checkpoint protein bub3-like  87.8    7e-17   
gb|KIK21105.1|  hypothetical protein PISMIDRAFT_681651                85.9    7e-17   
gb|KIL92745.1|  cell cycle arrest protein bub3                        86.3    7e-17   
gb|KJA26258.1|  hypothetical protein HYPSUDRAFT_36528                 86.3    7e-17   
ref|XP_005780788.1|  hypothetical protein EMIHUDRAFT_64104            85.9    7e-17   
gb|KIY94399.1|  Mitotic checkpoint protein BUB3                       85.5    7e-17   
gb|KFH43890.1|  Poly(A)+ RNA export protein-like protein              86.3    7e-17   
ref|XP_007791581.1|  putative mitotic checkpoint protein bub3 pro...  86.3    8e-17   
ref|XP_001269354.1|  nuclear pore complex protein (SonA), putative    86.3    8e-17   



>ref|XP_009590366.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Nicotiana tomentosiformis]
Length=340

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MTA P   GREL+ PP DGISNLRFSNHSD LLVSSWDKTVRLYDASANALRG F+HGG 
Sbjct  1    MTAVPQSAGRELASPPKDGISNLRFSNHSDHLLVSSWDKTVRLYDASANALRGEFMHGGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS DNTVRRLVFNYGR+DILG+HDAPVRC+EYSY TGQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSASADNTVRRLVFNYGREDILGRHDAPVRCIEYSYATGQVITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_009777463.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Nicotiana sylvestris]
Length=340

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MTA P   GREL+ PP DGISNLRFSNHSD LLVSSWDKTVRLYDASANALRG F+HGG 
Sbjct  1    MTAVPQSAGRELASPPKDGISNLRFSNHSDHLLVSSWDKTVRLYDASANALRGEFMHGGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS DNTVRRLVFNYGR+DILG+HDAPVRC++YSY TGQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSASADNTVRRLVFNYGREDILGRHDAPVRCIDYSYATGQVITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_002527504.1| mitotic checkpoint protein bub3, putative [Ricinus communis]
 gb|EEF34902.1| mitotic checkpoint protein bub3, putative [Ricinus communis]
Length=342

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  172  TAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAV  351
             A PL +GRELS+PP DGISNLRFSNHSD LLVSSWDK+VRLYDASANALRG F+HGG V
Sbjct  4    VAPPLGSGRELSNPPTDGISNLRFSNHSDHLLVSSWDKSVRLYDASANALRGEFLHGGPV  63

Query  352  LDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKT  528
            LDCCFHDDSSGFSAS DNTVRRLVFNYG++DILG+HDAPVRC+EYSY  GQVITGSWDKT
Sbjct  64   LDCCFHDDSSGFSASADNTVRRLVFNYGKEDILGRHDAPVRCIEYSYAAGQVITGSWDKT  123

Query  529  LKCWD  543
            LKCWD
Sbjct  124  LKCWD  128



>ref|XP_004230702.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Solanum lycopersicum]
Length=340

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MTA     GREL +PP DGISNLRFSNHSD LLVSSWDKTVRLYDASANALRG F+HGGA
Sbjct  1    MTAVSQSAGRELENPPKDGISNLRFSNHSDHLLVSSWDKTVRLYDASANALRGEFMHGGA  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS DNTVRRLVFN GR+DILG+HDAPVRC++YSY TGQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSASADNTVRRLVFNSGREDILGRHDAPVRCIDYSYATGQVITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_006346313.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Solanum tuberosum]
Length=340

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MTA     GREL +PP DGISNLRFSNHSD LLVSSWDKTVRLYDASANALRG F+HGGA
Sbjct  1    MTAVSQSAGRELENPPKDGISNLRFSNHSDHLLVSSWDKTVRLYDASANALRGEFMHGGA  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS DNTVRRLVFN GR+DILG+HDAPVRC++YSY TGQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSASADNTVRRLVFNSGREDILGRHDAPVRCIDYSYATGQVITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_011092506.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Sesamum indicum]
 ref|XP_011092507.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Sesamum indicum]
Length=342

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAAPLP--TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA P P  TGRELS PP DGISNLRFSNHSD LLVSSWDK+VRLYDASANALRG F+HG
Sbjct  1    MTAPPPPPSTGRELSSPPTDGISNLRFSNHSDHLLVSSWDKSVRLYDASANALRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSA  D+TVRRLVFNY R+D+LG+HDAPVRCVEYSY TGQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSACADHTVRRLVFNYNREDVLGRHDAPVRCVEYSYGTGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>gb|EYU39062.1| hypothetical protein MIMGU_mgv1a009456mg [Erythranthe guttata]
Length=341

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            +  A P P GRELS+PP DGISNLRFSNHSDQLLVSSWDK+VRLYDASANAL G F+HG 
Sbjct  1    MSAAPPQPPGRELSNPPTDGISNLRFSNHSDQLLVSSWDKSVRLYDASANALMGEFMHGA  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
            AVLDCCFHDDSSGFSA  D+TVRRLVFNY R+DILG+HDAPVRCVEYSY TGQVITGSWD
Sbjct  61   AVLDCCFHDDSSGFSACADHTVRRLVFNYNREDILGRHDAPVRCVEYSYATGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>gb|KDP44484.1| hypothetical protein JCGZ_16317 [Jatropha curcas]
Length=342

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 116/128 (91%), Gaps = 2/128 (2%)
 Frame = +1

Query  166  IMTAAPLP-TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            + T  P P +GRELS PP+DGISNLRFSNHSD LLVSSWDK+VRLYDASANALRG F+HG
Sbjct  1    MTTVLPPPGSGRELSSPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANALRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSAS DNTVRRLVFNYG++DILG+HDAPVRC+EYSY  GQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSASADNTVRRLVFNYGKEDILGRHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|XP_002300265.2| WD-40 repeat family protein [Populus trichocarpa]
 ref|XP_011030351.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Populus euphratica]
 ref|XP_011012431.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Populus euphratica]
 gb|EEE85070.2| WD-40 repeat family protein [Populus trichocarpa]
Length=342

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAAPLP--TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA   P  +GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASANALRG F+HG
Sbjct  1    MTAVIPPPFSGRELSNPPTDGISNLRFSNHSDLLLVSSWDKTVRLYDASANALRGEFLHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            GAVLDCCFHDDSSGFSAS DNTVRRLVFN+G++DILG+HDAPVRC+EYSY  GQVITGSW
Sbjct  61   GAVLDCCFHDDSSGFSASGDNTVRRLVFNHGKEDILGRHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|XP_010099611.1| Mitotic checkpoint protein [Morus notabilis]
 gb|EXB80042.1| Mitotic checkpoint protein [Morus notabilis]
Length=338

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTAAP P  GRELS+PP+DGISNLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+HGG
Sbjct  1    MTAAPPPVPGRELSNPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRRLVFNY ++DILG+HDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGGDNTVRRLVFNYNKEDILGRHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_008454389.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Cucumis melo]
Length=341

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG FVHGG
Sbjct  1    MTAVPPPAAGRELSNPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFVHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFS S DNTVRRLVFN+ ++DILG+HDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSVSVDNTVRRLVFNHNKEDILGRHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>emb|CDO97272.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAP-LPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P + TGRELS PP DGI+NLRFS HSD LLVSSWDK+VRLYDASANA+RG F+HGG
Sbjct  1    MTAPPQVTTGRELSSPPADGITNLRFSTHSDHLLVSSWDKSVRLYDASANAVRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWD  522
            AVLDCCFHDDSSGFSA  DNTVRRLVFNYGR+DILG+HDAPVRCVEY S TGQVITGSWD
Sbjct  61   AVLDCCFHDDSSGFSAGADNTVRRLVFNYGREDILGRHDAPVRCVEYSSATGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_004152275.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cucumis sativus]
Length=341

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG FVHGG
Sbjct  1    MTAVPPPAAGRELSNPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFVHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFS S DNTVRRLVFN+ ++DILG+HDAPVRCVEYSY  GQ+ITG WD
Sbjct  61   PVLDCCFHDDSSGFSVSVDNTVRRLVFNHNKEDILGRHDAPVRCVEYSYAAGQLITGGWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_004156860.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cucumis sativus]
 gb|KGN52771.1| hypothetical protein Csa_4G000900 [Cucumis sativus]
Length=341

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG FVHGG
Sbjct  1    MTAVPPPAAGRELSNPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFVHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFS S DNTVRRLVFN+ ++DILG+HDAPVRCVEYSY  GQ+ITG WD
Sbjct  61   PVLDCCFHDDSSGFSVSVDNTVRRLVFNHNKEDILGRHDAPVRCVEYSYAAGQLITGGWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_007042628.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOX98459.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=342

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA--PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA   P   GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASAN+LRG F+HG
Sbjct  1    MTAVHPPPAPGRELSNPPMDGISNLRFSNHSDHLLVSSWDKTVRLYDASANSLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSAS DNTVRR+VF+YG++DILG+HDAPVRC+EYSY  GQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSASADNTVRRIVFSYGKEDILGRHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>gb|KCW55112.1| hypothetical protein EUGRSUZ_I01072, partial [Eucalyptus grandis]
Length=375

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            I +  P   GRELS PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F+HGG
Sbjct  35   INSPVPPAPGRELSSPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFLHGG  94

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
            AVLDCCFHDDSSGFSAS D+ VRRLVFN G++DILGKHDAPVRCVEYSY  GQVITGSWD
Sbjct  95   AVLDCCFHDDSSGFSASADHAVRRLVFNAGKEDILGKHDAPVRCVEYSYAAGQVITGSWD  154

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  155  KTLKCWD  161



>gb|KJB79448.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=312

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            + +A P   GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA++LRG F+HGG
Sbjct  1    MTSAQPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASADSLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DNTVRR+VF++G++DILG+HDAPVRC+EYSY  GQVITGSWD
Sbjct  61   PVLDCCFHDDSSGFSASADNTVRRIVFSHGKEDILGRHDAPVRCIEYSYAAGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>gb|KJB79446.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=313

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            + +A P   GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA++LRG F+HGG
Sbjct  1    MTSAQPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASADSLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DNTVRR+VF++G++DILG+HDAPVRC+EYSY  GQVITGSWD
Sbjct  61   PVLDCCFHDDSSGFSASADNTVRRIVFSHGKEDILGRHDAPVRCIEYSYAAGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>gb|KJB79445.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
 gb|KJB79449.1| hypothetical protein B456_013G050200 [Gossypium raimondii]
Length=341

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            + +A P   GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA++LRG F+HGG
Sbjct  1    MTSAQPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASADSLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DNTVRR+VF++G++DILG+HDAPVRC+EYSY  GQVITGSWD
Sbjct  61   PVLDCCFHDDSSGFSASADNTVRRIVFSHGKEDILGRHDAPVRCIEYSYAAGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_010030628.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Eucalyptus grandis]
Length=426

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            I +  P   GRELS PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F+HGG
Sbjct  86   INSPVPPAPGRELSSPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFLHGG  145

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
            AVLDCCFHDDSSGFSAS D+ VRRLVFN G++DILGKHDAPVRCVEYSY  GQVITGSWD
Sbjct  146  AVLDCCFHDDSSGFSASADHAVRRLVFNAGKEDILGKHDAPVRCVEYSYAAGQVITGSWD  205

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  206  KTLKCWD  212



>gb|EYU37574.1| hypothetical protein MIMGU_mgv1a009424mg [Erythranthe guttata]
Length=342

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA--PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTAA  P PTGRELS PP DGISNLRFSNHSD LLVSSWDK+VRLYDASA+ L+  FVHG
Sbjct  1    MTAAAPPPPTGRELSSPPTDGISNLRFSNHSDHLLVSSWDKSVRLYDASADKLKVQFVHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            GAVLDCCFHDDSSGFSAS D+TVRRLVF+Y  +DILG+HDAPVRC++YSY TGQVITGSW
Sbjct  61   GAVLDCCFHDDSSGFSASADHTVRRLVFDYKNEDILGRHDAPVRCIDYSYATGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>gb|KHG11458.1| Bub3 [Gossypium arboreum]
 gb|KHG11459.1| Bub3 [Gossypium arboreum]
Length=342

 Score =   219 bits (559),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA--PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MT+A  P   GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA++LRG F+HG
Sbjct  1    MTSAHPPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASADSLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSAS DNTVRR+VF++G++DILG+HDAPVRC+EYSY  GQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSASADNTVRRIVFSHGKEDILGRHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|XP_002313908.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE87863.2| WD-40 repeat family protein [Populus trichocarpa]
Length=342

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 112/128 (88%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA--PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA   P  +GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDA  N LRG F+HG
Sbjct  1    MTAVIPPQFSGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDAGTNVLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            GAVLDCCFHDDSSGFSAS DNTVRRLVFNY ++DILG+HDA VRCVEYSY  GQVITGSW
Sbjct  61   GAVLDCCFHDDSSGFSASADNTVRRLVFNYEKEDILGRHDAHVRCVEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|XP_011001892.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Populus euphratica]
Length=342

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 112/128 (88%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAAPLP--TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA   P  +GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDA  N LRG F+HG
Sbjct  1    MTAVIPPPFSGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDAGTNVLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            GAVLDCCFHDDSSGFSAS DNTVRRLVFNY ++DILG+HDA VRCVEYSY  GQVITGSW
Sbjct  61   GAVLDCCFHDDSSGFSASADNTVRRLVFNYEKEDILGRHDAHVRCVEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|XP_007201242.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica]
 ref|XP_008236327.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Prunus mume]
 gb|EMJ02441.1| hypothetical protein PRUPE_ppa008206mg [Prunus persica]
Length=341

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F HGG
Sbjct  1    MTAVPPPAPGRELSSPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFKHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGADNTVRRLVFSSSKEDILGRHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_006422834.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 ref|XP_006486924.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Citrus sinensis]
 gb|ESR36074.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 gb|KDO57878.1| hypothetical protein CISIN_1g019384mg [Citrus sinensis]
Length=342

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA-PLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA  P PT GREL +PP+DGISNLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+HG
Sbjct  1    MTAVHPPPTSGRELGNPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSAS D+TVRRLVF++G++DILGKHDAPVRC+EYSY  GQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSASADHTVRRLVFSHGKEDILGKHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DK+LKCWD
Sbjct  121  DKSLKCWD  128



>ref|XP_010942824.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Elaeis guineensis]
Length=343

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +1

Query  169  MTAAPLPT---GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVH  339
            M+AA LPT   GRELS+PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN L+G F+H
Sbjct  1    MSAAVLPTSSGGRELSNPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANILKGEFMH  60

Query  340  GGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGS  516
            GG VLDCCFHDD SGFSAS DNTVRR VF  G++DILG+H+APVRCVEYSY  GQVITGS
Sbjct  61   GGPVLDCCFHDDFSGFSASADNTVRRFVFGTGKEDILGRHEAPVRCVEYSYAAGQVITGS  120

Query  517  WDKTLKCWD  543
            WDKTLKCWD
Sbjct  121  WDKTLKCWD  129



>ref|XP_006422835.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
 gb|ESR36075.1| hypothetical protein CICLE_v10028761mg [Citrus clementina]
Length=344

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAA-PLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            MTA  P PT GREL +PP+DGISNLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+HG
Sbjct  1    MTAVHPPPTSGRELGNPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHG  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSAS D+TVRRLVF++G++DILGKHDAPVRC+EYSY  GQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSASADHTVRRLVFSHGKEDILGKHDAPVRCIEYSYAAGQVITGSW  120

Query  520  DKTLKCWD  543
            DK+LKCWD
Sbjct  121  DKSLKCWD  128



>ref|XP_008787173.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3.1-like 
[Phoenix dactylifera]
Length=344

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLPT----GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M+AA LPT    GRELS+PP+DGISNLRFSNHSD LLVSSWDKTVRLYDASAN L+G F+
Sbjct  1    MSAAVLPTSSGGGRELSNPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            HGG VLDCCFHDD SGFSAS DNTVRR VF  G++DILG+H+APVRCVEYSY  GQVITG
Sbjct  61   HGGPVLDCCFHDDFSGFSASADNTVRRFVFGTGKEDILGRHEAPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKTLKCWD
Sbjct  121  SWDKTLKCWD  130



>ref|XP_002264472.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Vitis vinifera]
 emb|CBI22464.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA   P  GREL +PP DGISNLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+HGG
Sbjct  1    MTAVNPPVIGRELVNPPADGISNLRFSNHSDNLLVSSWDKSVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DN+VRRLVF++G++D+LG+HDAPVRC+EYSY TGQV+TGSWD
Sbjct  61   PVLDCCFHDDSSGFSASVDNSVRRLVFSHGKEDVLGRHDAPVRCIEYSYATGQVVTGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_010277064.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Nelumbo nucifera]
Length=341

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 113/127 (89%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAA-PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA  P   GRELS+PP+DGISNLRFSNHSD LLVSSWD+TVRLY+ASAN LRG F+H G
Sbjct  1    MTAVLPTSAGRELSNPPSDGISNLRFSNHSDNLLVSSWDRTVRLYEASANVLRGEFMHAG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
            AVLDCCFHDDSSGFSA  DNTVRRLVF+ G++DILG+HDAPVRCVEYSY  GQVITGSWD
Sbjct  61   AVLDCCFHDDSSGFSACVDNTVRRLVFSTGKEDILGRHDAPVRCVEYSYAAGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_010541847.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Tarenaya hassleriana]
Length=339

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP DGISNLRFSNHSD LLVSSWDK+VRLYDASA++LRG F+HGG 
Sbjct  1    MTTVPA-AGRELSNPPADGISNLRFSNHSDHLLVSSWDKSVRLYDASADSLRGEFMHGGP  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSA  DN VRRLVFN G++DILGKHDAPVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSACADNKVRRLVFNAGKEDILGKHDAPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            TLKCWD
Sbjct  120  TLKCWD  125



>ref|XP_009347116.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Pyrus x bretschneideri]
Length=341

 Score =   216 bits (551),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F+HGG
Sbjct  1    MTAVPPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRR VF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGADNTVRRFVFSSSKEDILGRHDAPVRCIEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KT+KCWD
Sbjct  121  KTVKCWD  127



>ref|XP_008364436.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Malus domestica]
Length=341

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F+HGG
Sbjct  1    MTAVPPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRR VF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGADNTVRRFVFSSSKEDILGRHDAPVRCIEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KT+KCWD
Sbjct  121  KTVKCWD  127



>ref|XP_011088067.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Sesamum indicum]
Length=341

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            +  A P  TGRELSDPP DG+SN+RFSNHSD LLVSSWDK+VRLYDASA+ LRG F+HGG
Sbjct  1    MTVAPPSSTGRELSDPPTDGVSNIRFSNHSDHLLVSSWDKSVRLYDASADVLRGKFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWD  522
            AVLDCCFHDD+SGF+AS D+TVRRLVFNY ++D LG+HDAPVRC+EYS  TGQVITGSWD
Sbjct  61   AVLDCCFHDDASGFTASLDHTVRRLVFNYNKEDTLGRHDAPVRCIEYSCTTGQVITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>gb|KJB32262.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=207

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            P+P GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA+ LRG F+HGG VLDC
Sbjct  8    PVP-GRELSNPPTDGISNLRFSNHSDNLLVSSWDKTVRLYDASASVLRGEFMHGGPVLDC  66

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFSAS DN VRR++F++G+++ILG+HDAPVRC+EYSY  GQVITGSWDKTLKC
Sbjct  67   CFHDDSSGFSASADNKVRRIMFSHGKEEILGRHDAPVRCIEYSYAAGQVITGSWDKTLKC  126

Query  538  WD  543
            WD
Sbjct  127  WD  128



>ref|NP_001239974.1| uncharacterized protein LOC100820541 [Glycine max]
 gb|ACU23267.1| unknown [Glycine max]
Length=344

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M  A L TGRELS+PP+DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G 
Sbjct  1    MATAVLTTGRELSNPPSDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSA+ DNTVRRLVF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSAAADNTVRRLVFSSNKEDILGRHDAPVRCIEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_007143105.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris]
 gb|ESW15099.1| hypothetical protein PHAVU_007G044000g [Phaseolus vulgaris]
Length=342

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            + +A P  TGRELS+PP+DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G
Sbjct  1    MASAVPAATGRELSNPPSDGITNLRFSNHSDNLLVSSWDKSVRLYDASANVLRGEFMHAG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DNTVRRL F+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSASADNTVRRLFFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_006849345.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda]
 gb|ERN10926.1| hypothetical protein AMTR_s00164p00065390 [Amborella trichopoda]
Length=342

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            P  TGRELS+PP+DGI+NLRFSNHSD LLVS+WDKTVRLYDASAN LRG F+HGGAVLDC
Sbjct  7    PPVTGRELSNPPSDGITNLRFSNHSDHLLVSAWDKTVRLYDASANTLRGEFMHGGAVLDC  66

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFSAS D+TVRR VF  G++DILG+HDAPVRCVEYSY  GQVITGSWDKT+KC
Sbjct  67   CFHDDSSGFSASADHTVRRFVFGSGKEDILGRHDAPVRCVEYSYGAGQVITGSWDKTIKC  126

Query  538  WD  543
            WD
Sbjct  127  WD  128



>emb|CAN82065.1| hypothetical protein VITISV_008011 [Vitis vinifera]
Length=371

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 114/127 (90%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA   P  GREL +PP DGISNLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+HGG
Sbjct  1    MTAVNPPVIGRELVNPPADGISNLRFSNHSDNLLVSSWDKSVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DN+VRRLVF++G++D+LG+HDAPVRC+EYSY TGQV+TGSWD
Sbjct  61   PVLDCCFHDDSSGFSASVDNSVRRLVFSHGKEDVLGRHDAPVRCIEYSYATGQVVTGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_004289802.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P+ G+ELS+PP DG+SNLRFSNHSD LLVSSWD+TVRLYDA+AN LRG F HG 
Sbjct  1    MTAVPPPSSGQELSNPPTDGVSNLRFSNHSDHLLVSSWDRTVRLYDATANVLRGEFSHGS  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS DNTVRR VFN  ++DI+GKHDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSASADNTVRRFVFNSNKEDIIGKHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_004511310.1| PREDICTED: mitotic checkpoint protein BUB3-like [Cicer arietinum]
Length=340

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M A  +  GRELS+PP+DGISN+RFSNHSD LLVSSWDK+VRLYDASAN LRG F+HGG 
Sbjct  1    MAATTVVAGRELSNPPSDGISNIRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHGGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSA  DNTVRRL+F+  ++DILGKHDAPVRC+EYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSAGADNTVRRLLFSTNKEDILGKHDAPVRCIEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_008382226.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Malus domestica]
Length=341

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA+ LRG F+HGG
Sbjct  1    MTAVPPPAPGRELSNPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASADVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRR VF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGADNTVRRFVFSSSKEDILGRHDAPVRCIEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KT+KCWD
Sbjct  121  KTVKCWD  127



>gb|KJB32260.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=341

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            P+P GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA+ LRG F+HGG VLDC
Sbjct  8    PVP-GRELSNPPTDGISNLRFSNHSDNLLVSSWDKTVRLYDASASVLRGEFMHGGPVLDC  66

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFSAS DN VRR++F++G+++ILG+HDAPVRC+EYSY  GQVITGSWDKTLKC
Sbjct  67   CFHDDSSGFSASADNKVRRIMFSHGKEEILGRHDAPVRCIEYSYAAGQVITGSWDKTLKC  126

Query  538  WD  543
            WD
Sbjct  127  WD  128



>gb|KJB32261.1| hypothetical protein B456_005G232100 [Gossypium raimondii]
Length=342

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            P+P GRELS+PP DGISNLRFSNHSD LLVSSWDKTVRLYDASA+ LRG F+HGG VLDC
Sbjct  8    PVP-GRELSNPPTDGISNLRFSNHSDNLLVSSWDKTVRLYDASASVLRGEFMHGGPVLDC  66

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFSAS DN VRR++F++G+++ILG+HDAPVRC+EYSY  GQVITGSWDKTLKC
Sbjct  67   CFHDDSSGFSASADNKVRRIMFSHGKEEILGRHDAPVRCIEYSYAAGQVITGSWDKTLKC  126

Query  538  WD  543
            WD
Sbjct  127  WD  128



>ref|XP_009335381.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Pyrus x bretschneideri]
Length=341

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA P P  GRELS+ P DGISNLRFSNHSD LLVSSWDKTVRLYDASAN LRG F+HGG
Sbjct  1    MTAVPPPAPGRELSNSPTDGISNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFMHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSA  DNTVRR VF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSAGADNTVRRFVFSSSKEDILGRHDAPVRCIEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KT+KCWD
Sbjct  121  KTVKCWD  127



>ref|XP_003536585.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max]
Length=340

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M +A   TGRELS+PP+DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G 
Sbjct  1    MASAVPATGRELSNPPSDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS + DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVAADNTVRRLVFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>gb|KHN06798.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=340

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M +A   TGRELS+PP+DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G 
Sbjct  1    MASAVPATGRELSNPPSDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS + DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVAADNTVRRLVFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_010687353.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Beta vulgaris subsp. 
vulgaris]
Length=341

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            +   AP   GREL +PP DG++NLRFSNHSD LLVSSWDKTVRLYDASAN LRG F HGG
Sbjct  1    MSAVAPPVVGRELLNPPTDGVTNLRFSNHSDHLLVSSWDKTVRLYDASANVLRGEFKHGG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFSAS D+TVRRLVFN G++DILGKH+A VRCVEYSY TGQVI+GSWD
Sbjct  61   PVLDCCFHDDSSGFSASGDSTVRRLVFNSGKEDILGKHEAHVRCVEYSYTTGQVISGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_003610622.1| Mitotic checkpoint protein BUB3 [Medicago truncatula]
 gb|AES93580.1| mitotic checkpoint protein BUB3 [Medicago truncatula]
Length=344

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +GREL++PP+DGISN+RFSNHSD LLVSSWDKTVRLYDA+A+ LRG F+HGG VLDCCFH
Sbjct  12   SGRELTNPPSDGISNIRFSNHSDHLLVSSWDKTVRLYDATADFLRGEFLHGGPVLDCCFH  71

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DDSSGFSAS DNTVRRL+F  G++DILGKHDAPVRCVEYSY  GQ+ITGSWDKT+KCWD
Sbjct  72   DDSSGFSASADNTVRRLIFATGKEDILGKHDAPVRCVEYSYAAGQLITGSWDKTIKCWD  130



>gb|KHN42322.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=340

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M +A   TGRELS+PP DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G 
Sbjct  1    MASAVPATGRELSNPPLDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS + DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVAADNTVRRLVFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>ref|XP_003555986.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Glycine max]
Length=340

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M +A   TGRELS+PP DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G 
Sbjct  1    MASAVPATGRELSNPPLDGITNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHAGP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS + DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVAADNTVRRLVFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWDK  120

Query  526  TLKCWD  543
            TLKCWD
Sbjct  121  TLKCWD  126



>gb|EPS71625.1| hypothetical protein M569_03130, partial [Genlisea aurea]
Length=328

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GREL +PP DGISNLRFSNH+D LLVSSWDK++RLYDAS N L+G  +HGGAVLDCCFHD
Sbjct  1    GRELLNPPTDGISNLRFSNHTDLLLVSSWDKSIRLYDASTNVLKGELIHGGAVLDCCFHD  60

Query  373  DSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DSSGFSA  DN VRRLVF+Y R+D+LGKHDAPVRC+EYSY TGQVITGSWDKTLKCWD
Sbjct  61   DSSGFSACADNKVRRLVFSYNREDVLGKHDAPVRCIEYSYTTGQVITGSWDKTLKCWD  118



>ref|XP_007143112.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris]
 gb|ESW15106.1| hypothetical protein PHAVU_007G044700g [Phaseolus vulgaris]
Length=345

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            + +A    TG+ELS+PP+DGI+NLRFSNHSD LLVSSWDK+VRLYDASAN LRG F+H G
Sbjct  1    MASAVAAATGQELSNPPSDGITNLRFSNHSDNLLVSSWDKSVRLYDASANVLRGEFMHAG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
             VLDCCFHDDSSGFS + DNTVRRLVF+  ++DILG+HDAPVRCVEYSY  GQ+ITGSWD
Sbjct  61   PVLDCCFHDDSSGFSVAADNTVRRLVFSSNKEDILGRHDAPVRCVEYSYAAGQLITGSWD  120

Query  523  KTLKCWD  543
            KTLKCWD
Sbjct  121  KTLKCWD  127



>ref|XP_010556011.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Tarenaya hassleriana]
Length=339

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GR++S+ P DGISNLRFSNHSD LLVSSWDK VRLYDASA++ RG F+HGG 
Sbjct  1    MTMVP-SIGRQISNSPADGISNLRFSNHSDHLLVSSWDKNVRLYDASADSFRGEFMHGGP  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSA  DN VRRLVFN G++DILGKHDAPVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSACADNKVRRLVFNVGKEDILGKHDAPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            TLKCWD
Sbjct  120  TLKCWD  125



>ref|XP_010243391.1| PREDICTED: mitotic checkpoint protein BUB3.1 isoform X1 [Nelumbo 
nucifera]
Length=339

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 107/122 (88%), Gaps = 1/122 (1%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            P   GRELS+PP+DGISNLRFSNHSD LLVSSWD+TVRLYDASAN LRG F HGG VLDC
Sbjct  6    PNSAGRELSNPPSDGISNLRFSNHSDNLLVSSWDRTVRLYDASANVLRGEFFHGGPVLDC  65

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFSA  DNTVRR VF+ G++DILG+HDAPV CVEYSY  GQVITGSWDKTLKC
Sbjct  66   CFHDDSSGFSACVDNTVRRYVFSSGKEDILGRHDAPVCCVEYSYAAGQVITGSWDKTLKC  125

Query  538  WD  543
            WD
Sbjct  126  WD  127



>gb|ABF96948.1| Mitotic checkpoint protein BUB3, putative, expressed [Oryza sativa 
Japonica Group]
Length=248

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +G+EL++PP DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G FVH GAVLDCCFH
Sbjct  13   SGKELANPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDADANVLKGEFVHAGAVLDCCFH  72

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DDSSGFSA  D+TVRRLVF   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+KCWD
Sbjct  73   DDSSGFSAGADHTVRRLVFGSAKEDLLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWD  131



>ref|XP_006651529.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Oryza brachyantha]
Length=333

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 1/121 (1%)
 Frame = +1

Query  184  LPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            + +G+EL++PP DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G FVH GAVLDCC
Sbjct  1    MGSGKELANPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDAEANVLKGEFVHAGAVLDCC  60

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCW  540
            FHDDSSGFSA  D+TVRRLVF   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+KCW
Sbjct  61   FHDDSSGFSAGADHTVRRLVFGSAKEDLLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCW  120

Query  541  D  543
            D
Sbjct  121  D  121



>ref|XP_009396041.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (87%), Gaps = 3/128 (2%)
 Frame = +1

Query  169  MTAAPLPT--GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHG  342
            M+AA LP   GRELSDPP+DGISNLRFSNHSD LLVSSWD+++RLYDA A+AL+G F H 
Sbjct  1    MSAATLPATGGRELSDPPSDGISNLRFSNHSDLLLVSSWDRSLRLYDAGADALKGEFAHV  60

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSW  519
            G VLDCCFHDDSSGFSA  D+ VRR VF  G++DILG+HDAPVRCVEYSY TGQVITGSW
Sbjct  61   GPVLDCCFHDDSSGFSACADHMVRRFVFGSGKEDILGRHDAPVRCVEYSYATGQVITGSW  120

Query  520  DKTLKCWD  543
            DKTLKCWD
Sbjct  121  DKTLKCWD  128



>ref|NP_001050471.1| Os03g0448600 [Oryza sativa Japonica Group]
 gb|AAS01923.1| putative mitotic checkpoint protein [Oryza sativa Japonica Group]
 gb|ABF96947.1| Mitotic checkpoint protein BUB3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12385.1| Os03g0448600 [Oryza sativa Japonica Group]
 dbj|BAG99453.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59336.1| hypothetical protein OsJ_11417 [Oryza sativa Japonica Group]
Length=343

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +G+EL++PP DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G FVH GAVLDCCFH
Sbjct  13   SGKELANPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDADANVLKGEFVHAGAVLDCCFH  72

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DDSSGFSA  D+TVRRLVF   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+KCWD
Sbjct  73   DDSSGFSAGADHTVRRLVFGSAKEDLLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWD  131



>gb|EEC75559.1| hypothetical protein OsI_12223 [Oryza sativa Indica Group]
Length=343

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +G+EL++PP DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G FVH GAVLDCCFH
Sbjct  13   SGKELANPPTDGISNLRFSNHSDHLLVSSWDKTVRLYDADANVLKGEFVHAGAVLDCCFH  72

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DDSSGFSA  D+TVRRLVF   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+KCWD
Sbjct  73   DDSSGFSAGADHTVRRLVFGSAKEDLLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWD  131



>gb|EMS68234.1| Mitotic checkpoint protein BUB3 [Triticum urartu]
Length=241

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  175  AAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVL  354
            A+ + +GREL+ PP+DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G F H G VL
Sbjct  9    ASAMGSGRELATPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDAEANLLKGEFAHPGPVL  68

Query  355  DCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTL  531
            DCCFHDDSSGFSA  D+TVRRL F   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+
Sbjct  69   DCCFHDDSSGFSAGADHTVRRLSFTSSKEDVLGRHDAPVRCVEYSYAAGQVITGSWDKTI  128

Query  532  KCWD  543
            KCWD
Sbjct  129  KCWD  132



>ref|XP_009111676.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Brassica rapa]
 emb|CDY42193.1| BnaA01g26020D [Brassica napus]
Length=340

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M+  P   GREL++PP+DGISNLRFSN SD LLVSSWDK VRLYD S N+L+G F+HGGA
Sbjct  1    MSQPPPSAGRELANPPSDGISNLRFSNTSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGA  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS  +DN VRR+VFN G++D+LG H+ PVRCVEYSY  GQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVGSDNKVRRIVFNVGKEDVLGMHEKPVRCVEYSYAAGQVITGSWDK  120

Query  526  TLKCWD  543
            T+KCWD
Sbjct  121  TVKCWD  126



>emb|CDX95434.1| BnaC01g33260D [Brassica napus]
Length=340

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M+  P   GREL++PP+DGISNLRFSN SD LLVSSWDK VRLYD S N+L+G F+HGGA
Sbjct  1    MSLPPPSAGRELANPPSDGISNLRFSNTSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGA  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS  +DN VRR+VFN G++D+LG H+ PVRCVEYSY  GQVITGSWDK
Sbjct  61   VLDCCFHDDSSGFSVGSDNKVRRIVFNVGKEDVLGMHEKPVRCVEYSYAAGQVITGSWDK  120

Query  526  TLKCWD  543
            T+KCWD
Sbjct  121  TVKCWD  126



>ref|XP_002436452.1| hypothetical protein SORBIDRAFT_10g002920 [Sorghum bicolor]
 gb|EER87819.1| hypothetical protein SORBIDRAFT_10g002920 [Sorghum bicolor]
Length=343

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGISNLRFSNHS+ LLVSSWDKTVRLYDA AN L+G FV
Sbjct  1    MSSAAAPAAVGSGKELANPPADGISNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFV  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY  GQVITG
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSNKEDVLGRHDGPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKT+KCWD
Sbjct  121  SWDKTVKCWD  130



>gb|AFW85916.1| hypothetical protein ZEAMMB73_533080 [Zea mays]
Length=256

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGI+NLRFSNHS+ LLVSSWDKTVRLYDA AN L+G F+
Sbjct  1    MSSAAAPAAVGSGKELANPPADGITNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY  GQVITG
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSSKEDVLGRHDGPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKT+KCWD
Sbjct  121  SWDKTVKCWD  130



>ref|XP_010507823.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Camelina sativa]
Length=339

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+LRG F+HGGA
Sbjct  1    MTTTP-SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLRGEFLHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   D  VRR+VFN G++DILG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TVKCWD  125



>ref|XP_010487904.1| PREDICTED: mitotic checkpoint protein BUB3.1 [Camelina sativa]
Length=339

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+LRG F+HGGA
Sbjct  1    MTTTP-SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLRGEFLHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   D  VRR+VFN G++DILG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TVKCWD  125



>ref|NP_001149777.1| LOC100283404 [Zea mays]
 gb|ACF84850.1| unknown [Zea mays]
 gb|ACG36755.1| mitotic checkpoint protein BUB3 [Zea mays]
 gb|ACG37866.1| mitotic checkpoint protein BUB3 [Zea mays]
 gb|ACR35836.1| unknown [Zea mays]
 gb|AFW85917.1| mitotic checkpoint protein BUB3 [Zea mays]
Length=343

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGI+NLRFSNHS+ LLVSSWDKTVRLYDA AN L+G F+
Sbjct  1    MSSAAAPAAVGSGKELANPPADGITNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY  GQVITG
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSSKEDVLGRHDGPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKT+KCWD
Sbjct  121  SWDKTVKCWD  130



>gb|ACG48694.1| mitotic checkpoint protein BUB3 [Zea mays]
Length=343

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGI+NLRFSNHS+ LLVSSWDKTVRLYDA AN L+G F+
Sbjct  1    MSSAAAPASVGSGKELANPPADGITNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY  GQVITG
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSSKEDVLGRHDGPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKT+KCWD
Sbjct  121  SWDKTVKCWD  130



>ref|XP_010466109.1| PREDICTED: mitotic checkpoint protein BUB3.1-like isoform X1 
[Camelina sativa]
 ref|XP_010466111.1| PREDICTED: mitotic checkpoint protein BUB3.1-like isoform X2 
[Camelina sativa]
Length=340

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+LRG F+HGGA
Sbjct  1    MTTTP-SGGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLRGEFLHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   D  VRR+VFN G++DILG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TVKCWD  125



>ref|XP_006298078.1| hypothetical protein CARUB_v10014121mg [Capsella rubella]
 gb|EOA30976.1| hypothetical protein CARUB_v10014121mg [Capsella rubella]
Length=339

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT+ P   GRELS PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+LRG F+HGGA
Sbjct  1    MTSTP-SAGRELSSPPSDGISNLRFSNNSDHLLVSSWDKHVRLYDVSTNSLRGEFLHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   DN VRR+VFN G++DILG HD  VRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDFSGFSVGADNKVRRIVFNVGKEDILGMHDKAVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TVKCWD  125



>gb|ACF78394.1| unknown [Zea mays]
Length=343

 Score =   201 bits (512),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGI+NLRFSNHS+ LLVSSWDKTVRLYDA AN L+G F+
Sbjct  1    MSSAAAPAAVGSGKELANPPADGITNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITG  513
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY  GQVITG
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSSKEDVLGRHDGPVRCVEYSYAAGQVITG  120

Query  514  SWDKTLKCWD  543
            SWDKT+KCWD
Sbjct  121  SWDKTVKCWD  130



>ref|XP_002883194.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59453.1| hypothetical protein ARALYDRAFT_898343 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+L+G F+HGGA
Sbjct  1    MTTTP-SAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   D  VRR+VFN G++DILG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TVKCWD  125



>ref|XP_009107249.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Brassica rapa]
Length=339

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DG+SNLRFSN SD LLVSSWDK+VRLYDA+A+++RG F HGGA
Sbjct  1    MTLVP-SIGRELSNPPSDGVSNLRFSNSSDHLLVSSWDKSVRLYDANADSMRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS D+ VRR+ FN G++DILG HD PVRCVEYSY  GQVITGSWD+
Sbjct  60   VLDCCFHDDSSGFSASADHKVRRIDFNAGKEDILGMHDEPVRCVEYSYAAGQVITGSWDR  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>gb|ABK21756.1| unknown [Picea sitchensis]
 gb|ABK22148.1| unknown [Picea sitchensis]
Length=342

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +GREL++PP DGISNLRFSNHSD LLVSSWD+ VRLYDASAN L+G FVHGG VLDCCFH
Sbjct  11   SGRELANPPTDGISNLRFSNHSDHLLVSSWDRKVRLYDASANTLKGQFVHGGPVLDCCFH  70

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DD+SGFS S D+ VRR  F+  ++DILG+H+APVRCVEYSY  GQVITGSWDKTLKCWD
Sbjct  71   DDASGFSGSADHAVRRYDFSTRKEDILGRHEAPVRCVEYSYAAGQVITGSWDKTLKCWD  129



>emb|CDY59371.1| BnaA08g29630D [Brassica napus]
Length=339

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DG+SNLRFSN SD LLVSSWDK+VRLYDA+A+++RG F HGGA
Sbjct  1    MTLVP-SIGRELSNPPSDGVSNLRFSNSSDHLLVSSWDKSVRLYDANADSMRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFSAS D+ VRR+ F+ G++DILG HD PVRCVEYSY  GQVITGSWD+
Sbjct  60   VLDCCFHDDSSGFSASADHKVRRIDFSAGKEDILGMHDEPVRCVEYSYAAGQVITGSWDR  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_010461841.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Camelina sativa]
Length=339

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+ LRG F HGGA
Sbjct  1    MTMMPA-IGRELSNPPSDGISNLRFSNSSDYLLVSSWDKSVRLYDANADLLRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D+ VRR+ FN G++D+LG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADSKVRRIDFNAGKEDVLGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_010479422.1| PREDICTED: mitotic checkpoint protein BUB3.2 [Camelina sativa]
Length=339

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+ LRG F HGGA
Sbjct  1    MTMVPA-IGRELSNPPSDGISNLRFSNSSDHLLVSSWDKSVRLYDANADLLRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADYKVRRIDFNAGKEDVLGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_003562373.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Brachypodium 
distachyon]
Length=345

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = +1

Query  184  LPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            + +GREL++PP DGISNLRFSNHSD LLVSSWDKTVRLYDA AN L+G F H G VLDCC
Sbjct  12   MGSGRELANPPADGISNLRFSNHSDHLLVSSWDKTVRLYDADANVLKGEFAHPGPVLDCC  71

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCW  540
            FHDDSSGFSA  D+TVRRLVF   ++D+LG+HD PV CVEYSY  GQVITGSWDKT+KCW
Sbjct  72   FHDDSSGFSAGADHTVRRLVFTSSKEDVLGRHDGPVCCVEYSYAAGQVITGSWDKTIKCW  131

Query  541  D  543
            D
Sbjct  132  D  132



>gb|AAG51772.1|AC079674_5 mitotic checkpoint protein, 3' partial; 47356-48732 [Arabidopsis 
thaliana]
Length=250

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK+VRLYDA+ + +RG F HGGA
Sbjct  1    MTLVP-AIGRELSNPPSDGISNLRFSNNSDHLLVSSWDKSVRLYDANGDLMRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG H+ PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADTKVRRIDFNAGKEDVLGTHEKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|NP_566644.1| cell cycle arrest protein BUB3  [Arabidopsis thaliana]
 sp|Q9LJN8.1|BUB31_ARATH RecName: Full=Mitotic checkpoint protein BUB3.1; AltName: Full=Protein 
BUDDING UNINHIBITED BY BENZYMIDAZOL 3.1 [Arabidopsis 
thaliana]
 dbj|BAB02543.1| mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AAM64953.1| mitotic checkpoint protein, putative [Arabidopsis thaliana]
 gb|AAO42274.1| putative mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AAP04137.1| putative mitotic checkpoint protein [Arabidopsis thaliana]
 gb|AEE76263.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana]
Length=340

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT      GRELS+PP+DGISNLRFSN+SD LLVSSWDK VRLYD S N+L+G F+HGGA
Sbjct  1    MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGA  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDD SGFS   D  VRR+VFN G++DILG HD  VRCVEYSY  GQVITGSWDK
Sbjct  61   VLDCCFHDDFSGFSVGADYKVRRIVFNVGKEDILGTHDKAVRCVEYSYAAGQVITGSWDK  120

Query  526  TLKCWD  543
            T+KCWD
Sbjct  121  TVKCWD  126



>ref|XP_010500544.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Camelina sativa]
Length=339

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+ LRG F HGGA
Sbjct  1    MTMVPT-IGRELSNPPSDGISNLRFSNSSDHLLVSSWDKSVRLYDANADLLRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADYKVRRIDFNAGKEDVLGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_006393203.1| hypothetical protein EUTSA_v10011632mg [Eutrema salsugineum]
 gb|ESQ30489.1| hypothetical protein EUTSA_v10011632mg [Eutrema salsugineum]
Length=339

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = +1

Query  184  LPT-GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDC  360
            +PT GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+++RG F HGG VLDC
Sbjct  4    VPTVGRELSNPPSDGISNLRFSNSSDHLLVSSWDKSVRLYDANADSMRGEFKHGGPVLDC  63

Query  361  CFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKC  537
            CFHDDSSGFS   DN VRR+ FN G++DILG HD PVRCVEYSY  GQVITGSWDKT+KC
Sbjct  64   CFHDDSSGFSVCGDNKVRRIDFNAGKEDILGTHDKPVRCVEYSYAAGQVITGSWDKTIKC  123

Query  538  WD  543
            WD
Sbjct  124  WD  125



>gb|EMT22272.1| hypothetical protein F775_32007 [Aegilops tauschii]
Length=440

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            +GREL+ PP+DGISNLRFSNHSD LLVSSWDKTVRLYDA A+ L+G F H G VLDCCFH
Sbjct  3    SGRELASPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDAEASLLKGEFAHPGPVLDCCFH  62

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DDSSGFSA  D+TVRRL F   ++D+LG+HDAPVRCVEYSY  GQVITGSWDKT+KCWD
Sbjct  63   DDSSGFSAGADHTVRRLSFTSSKEDVLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWD  121



>ref|XP_002891542.1| hypothetical protein ARALYDRAFT_474121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67801.1| hypothetical protein ARALYDRAFT_474121 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN SD L+VSSWDK+VRLYDA+A+ +RG F HGGA
Sbjct  1    MTLLPA-IGRELSNPPSDGISNLRFSNSSDHLIVSSWDKSVRLYDANADLMRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG HD PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADTKVRRIDFNAGKEDVLGTHDKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_002970095.1| hypothetical protein SELMODRAFT_146851 [Selaginella moellendorffii]
 ref|XP_002985287.1| hypothetical protein SELMODRAFT_446198 [Selaginella moellendorffii]
 gb|EFJ13781.1| hypothetical protein SELMODRAFT_446198 [Selaginella moellendorffii]
 gb|EFJ29219.1| hypothetical protein SELMODRAFT_146851 [Selaginella moellendorffii]
Length=339

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = +1

Query  166  IMTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGG  345
            +M A     GREL+ PP DGISNLRFSNHSD LLVSSWD  VRLYDASAN L+G F H G
Sbjct  1    MMGAVGAGAGRELTSPPPDGISNLRFSNHSDHLLVSSWDSKVRLYDASANTLKGQFEHRG  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWD  522
             VLDCCFHDD+SGFSAS D TVRR  FN GR+DILG H+A VRCVEYS +TGQVITGSWD
Sbjct  61   PVLDCCFHDDASGFSASADYTVRRYDFNTGREDILGSHEASVRCVEYSHHTGQVITGSWD  120

Query  523  KTLKCWD  543
            KTL+CWD
Sbjct  121  KTLRCWD  127



>ref|NP_175413.1| cell cycle arrest protein BUB3  [Arabidopsis thaliana]
 sp|Q9C701.1|BUB32_ARATH RecName: Full=Mitotic checkpoint protein BUB3.2; AltName: Full=Protein 
BUDDING UNINHIBITED BY BENZYMIDAZOL 3.2 [Arabidopsis 
thaliana]
 gb|AAG60165.1|AC074110_3 mitotic checkpoint protein, putative [Arabidopsis thaliana]
 gb|AEE32490.1| cell cycle arrest protein BUB3 [Arabidopsis thaliana]
Length=339

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN+SD LLVSSWDK+VRLYDA+ + +RG F HGGA
Sbjct  1    MTLVPA-IGRELSNPPSDGISNLRFSNNSDHLLVSSWDKSVRLYDANGDLMRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG H+ PVRCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADTKVRRIDFNAGKEDVLGTHEKPVRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>ref|XP_006305280.1| hypothetical protein CARUB_v10009656mg [Capsella rubella]
 gb|EOA38178.1| hypothetical protein CARUB_v10009656mg [Capsella rubella]
Length=339

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P   GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+ LRG F HGGA
Sbjct  1    MTLVPA-IGRELSNPPSDGISNLRFSNSSDHLLVSSWDKSVRLYDANADLLRGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   D  VRR+ FN G++D+LG HD PVRCVEYSY  GQVI+GSWD+
Sbjct  60   VLDCCFHDDSSGFSVCADYKVRRIDFNAGKEDVLGTHDKPVRCVEYSYAAGQVISGSWDR  119

Query  526  TLKCWD  543
            T+KCWD
Sbjct  120  TIKCWD  125



>emb|CDY03579.1| BnaC03g68380D [Brassica napus]
Length=340

 Score =   193 bits (491),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVH-GG  345
            MT  P   GRELS+PP+DGISNLRFSN SD LLVSSWDK+VRLYDA+A+++RG F H GG
Sbjct  1    MTLLP-SVGRELSNPPSDGISNLRFSNSSDHLLVSSWDKSVRLYDANADSMRGEFKHGGG  59

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWD  522
            AVLDCCFHD+SSGFSA  D+ VRR+ FN G++DILG HD PVRCVEYSY  GQVITGSWD
Sbjct  60   AVLDCCFHDESSGFSACADHKVRRIDFNAGKEDILGMHDEPVRCVEYSYAAGQVITGSWD  119

Query  523  KTLKCWD  543
            +T+KCWD
Sbjct  120  RTIKCWD  126



>gb|KFK35968.1| hypothetical protein AALP_AA4G061300 [Arabis alpina]
Length=339

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            MT  P+  GRELS+PP+DGISNLRFSN SD LLVSSWD +VRLYDA+A++++G F HGGA
Sbjct  1    MTMVPI-VGRELSNPPSDGISNLRFSNTSDNLLVSSWDMSVRLYDANADSMKGEFKHGGA  59

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCFHDDSSGFS   DN VRR+ FN G++DILG HD   RCVEYSY  GQVITGSWDK
Sbjct  60   VLDCCFHDDSSGFSVCADNKVRRIDFNAGKEDILGTHDKTGRCVEYSYAAGQVITGSWDK  119

Query  526  TLKCWD  543
            T+K WD
Sbjct  120  TIKFWD  125



>ref|XP_001764716.1| predicted protein [Physcomitrella patens]
 gb|EDQ70415.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GRELS PP+DGISNLRFSN SD LLVSSWD  VRLYDASAN L+G F H  AVLDCCFHD
Sbjct  12   GRELSSPPSDGISNLRFSNFSDHLLVSSWDAKVRLYDASANVLKGQFAHRAAVLDCCFHD  71

Query  373  DSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DSSGFSAS D+TV R  FN G +D+LG HDAPVRCVEYS+ TG V+TGSWDKT++CWD
Sbjct  72   DSSGFSASADHTVYRYDFNTGSEDLLGTHDAPVRCVEYSHATGHVVTGSWDKTVRCWD  129



>gb|EEC82360.1| hypothetical protein OsI_26682 [Oryza sativa Indica Group]
Length=260

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +1

Query  196  RELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +EL +PP+DG+S+LRFS HSD+LLVSSWDKTVRLYDA AN  RG F+H  +VL CCFHDD
Sbjct  26   KELREPPSDGVSSLRFSKHSDRLLVSSWDKTVRLYDAEANVPRGVFMHAASVLGCCFHDD  85

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            SSGFSAS DNTVRRL F+ G +  LG+HDA V CVEYSY TGQVITGSWDKT+ CWD
Sbjct  86   SSGFSASADNTVRRLAFSSGGNYFLGRHDAAVSCVEYSYSTGQVITGSWDKTIMCWD  142



>ref|NP_001175281.1| Os07g0588500 [Oryza sativa Japonica Group]
 dbj|BAC57743.1| putative mitotic checkpoint protein [Oryza sativa Japonica Group]
 dbj|BAH94009.1| Os07g0588500 [Oryza sativa Japonica Group]
Length=364

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = +1

Query  196  RELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +EL +PP+DG+S+LRFS HSD+LLVSSWDKTVRLYDA AN  RG F+H  +VL CCFHDD
Sbjct  26   KELREPPSDGVSSLRFSKHSDRLLVSSWDKTVRLYDAEANVPRGVFMHAASVLGCCFHDD  85

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            SSGFSAS DNTVRRL F+ G +  L +HDA V CVEYSY TGQVITGSWDKT+ CWD
Sbjct  86   SSGFSASADNTVRRLAFSSGGNYFLVRHDAAVSCVEYSYSTGQVITGSWDKTIMCWD  142



>ref|XP_008680589.1| PREDICTED: mitotic checkpoint protein BUB3.1-like [Zea mays]
Length=127

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +1

Query  169  MTAAPLP----TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFV  336
            M++A  P    +G+EL++PP DGI+NLRFSNHS+ LLVSSWDKTVRLYDA AN L+G F+
Sbjct  1    MSSAAAPAAVGSGKELANPPADGITNLRFSNHSNNLLVSSWDKTVRLYDADANVLKGEFM  60

Query  337  HGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQVI  507
            H GAVLDCCFHDDSSGFSA  D+TVRRLVF+  ++D+LG+HD PVRCVEYSY   + 
Sbjct  61   HPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSSKEDVLGRHDGPVRCVEYSYAAVLF  117



>ref|XP_003560020.1| PREDICTED: mitotic checkpoint protein BUB3.2-like [Brachypodium 
distachyon]
Length=357

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GRELS PP DG+SNL FS HS++LLVSSWDK+VR +D  AN +   F H   VLDCCFHD
Sbjct  26   GRELSHPPRDGVSNLCFSRHSNRLLVSSWDKSVRFFDVEANQMIAVFSHKRPVLDCCFHD  85

Query  373  DSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            D SGFSA +D  VRRL  +  +   LG HDAPV CVEYS   GQVI+G WD T+KCWD
Sbjct  86   DQSGFSACSDRVVRRLSLDSKKSFRLGIHDAPVSCVEYSCVAGQVISGGWDNTIKCWD  143



>ref|XP_010243393.1| PREDICTED: mitotic checkpoint protein BUB3.2 isoform X2 [Nelumbo 
nucifera]
Length=300

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  286  TVRLYDASANALRGTFVHGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDA  465
            TVRLYDASAN LRG F HGG VLDCCFHDDSSGFSA  DNTVRR VF+ G++DILG+HDA
Sbjct  2    TVRLYDASANVLRGEFFHGGPVLDCCFHDDSSGFSACVDNTVRRYVFSSGKEDILGRHDA  61

Query  466  PVRCVEYSY-TGQVITGSWDKTLKCWD  543
            PV CVEYSY  GQVITGSWDKTLKCWD
Sbjct  62   PVCCVEYSYAAGQVITGSWDKTLKCWD  88



>ref|XP_001771348.1| predicted protein [Physcomitrella patens]
 gb|EDQ63908.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GREL  PP+D I+NLRFSN  D LLVSSWD  +RLYD +AN L+  F   G VLDCCF D
Sbjct  11   GRELWPPPSDAITNLRFSNQIDHLLVSSWDAKLRLYDVAANVLKAEFGSQGPVLDCCFCD  70

Query  373  DSSGFSASTDNTV-RRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            DSSG+SA  D T+  R  FN G +  LG HD  +  +EYS+ TGQVI+GSWDKTL+CWD
Sbjct  71   DSSGYSAGADQTLYSRYDFNTGAETTLGLHDGAITSLEYSHATGQVISGSWDKTLRCWD  129



>ref|XP_001758191.1| predicted protein [Physcomitrella patens]
 gb|EDQ77013.1| predicted protein [Physcomitrella patens]
Length=333

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GREL  PP+D I+ LRFS+ SD+LLVSSWD  +RLYD SA  +R  F   G VLDCCFH+
Sbjct  11   GRELWPPPSDAITKLRFSSFSDRLLVSSWDSKLRLYDVSACVVRAEFSSKGPVLDCCFHN  70

Query  373  DSSGFSASTDNTV-RRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            DSSG+SA  D+ +  R  FN G +  LG HD+ + C++YS  +GQVI+GSWDKTL+CWD
Sbjct  71   DSSGYSAGADHILCSRYDFNTGAETSLGSHDSAITCLDYSNVSGQVISGSWDKTLRCWD  129



>gb|EMT11166.1| hypothetical protein F775_07555 [Aegilops tauschii]
Length=279

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +1

Query  211  PPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASA-NALRGTFVHGGAVLDCCFHDD-SSG  384
            PP DG+SNLRFS HS +LLVSSW+K VRL D  A NAL G F H   VLDCCFHD+ SS 
Sbjct  27   PPRDGVSNLRFSKHSTRLLVSSWEKAVRLLDVDATNALVGAFPHMTPVLDCCFHDNDSSA  86

Query  385  FSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            FSAS+D+ VRRL F+      LG HD PVRCVEYS  TGQVITGSWD+T+KCWD
Sbjct  87   FSASSDHVVRRLSFSAESSYRLGTHDGPVRCVEYSDTTGQVITGSWDRTIKCWD  140



>gb|ABK24912.1| unknown [Picea sitchensis]
Length=328

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            GREL  PP D IS  RFS HS++LLVSSWD +V LYD   N  R  F H    LDCCF D
Sbjct  5    GRELVSPPEDAISRARFSLHSNKLLVSSWDSSVTLYDVDENVARVKFSHPTQPLDCCFLD  64

Query  373  DSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            D +G S  +D TVRR  F+  ++DILGKH+A V  VE+S  TGQ+ITGSWDK L+ WD
Sbjct  65   DFNGLSGDSDGTVRRYNFSTQKEDILGKHEALVNSVEFSEVTGQIITGSWDKNLRFWD  122



>gb|KHN42317.1| Mitotic checkpoint protein BUB3 [Glycine soja]
Length=281

 Score =   132 bits (332),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 80/126 (63%), Gaps = 37/126 (29%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M +A   TGRELS+PP+DGI+NLRFSNHSD LLVSSWDK                     
Sbjct  1    MASAVPATGRELSNPPSDGITNLRFSNHSDHLLVSSWDK---------------------  39

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
                           + DNTVRRLVF+  ++DILG+HDAPVRC+EYSY  GQ+ITGSWDK
Sbjct  40   ---------------AADNTVRRLVFSSNKEDILGRHDAPVRCIEYSYAAGQLITGSWDK  84

Query  526  TLKCWD  543
            TLKCWD
Sbjct  85   TLKCWD  90



>ref|XP_009395198.1| PREDICTED: mitotic checkpoint protein BUB3.2-like, partial [Musa 
acuminata subsp. malaccensis]
Length=187

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 70/85 (82%), Gaps = 3/85 (4%)
 Frame = +1

Query  169  MTAAPLPT---GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVH  339
            +TAA LP    GRELS PP+DGISNLRFSNHSD LLVSSWDK++RLYDA AN L G FVH
Sbjct  20   LTAATLPPTTGGRELSGPPSDGISNLRFSNHSDLLLVSSWDKSLRLYDAGANVLEGEFVH  79

Query  340  GGAVLDCCFHDDSSGFSASTDNTVR  414
             G VLDCCFHDDS+GFSA  D+TVR
Sbjct  80   AGPVLDCCFHDDSAGFSACADHTVR  104



>gb|EEE67502.1| hypothetical protein OsJ_24938 [Oryza sativa Japonica Group]
Length=323

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 79/119 (66%), Gaps = 23/119 (19%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            G+EL +PP+DG+S+LRFS HSD+LLVSSWDKTVRLYDA AN  RG F+H G         
Sbjct  4    GKELREPPSDGVSSLRFSKHSDRLLVSSWDKTVRLYDAEANVPRGVFMHAG---------  54

Query  373  DSSGFSASTDNTVRR-LVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
                        VR  L F+ G +  L +HDA V CVEYSY TGQVITGSWDKT+ CWD
Sbjct  55   ------------VRPGLAFSSGGNYFLVRHDAAVSCVEYSYSTGQVITGSWDKTIMCWD  101



>ref|XP_005089574.1| PREDICTED: mitotic checkpoint protein BUB3-like [Aplysia californica]
Length=327

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +LS+ PNDGIS+++F  +S Q LLVSSWD +VRLYD  A+++R  + H   VLDCC
Sbjct  5    PNEFKLSNMPNDGISSVKFGPNSKQFLLVSSWDDSVRLYDVVADSMRFKYTHSAPVLDCC  64

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCW  540
            F+D    FS   D  ++   FN   D ++G HDAP+RCVEYS     VITGSWD T+K W
Sbjct  65   FYDAVHSFSGGIDKQLKMYDFNSSSDQVVGTHDAPIRCVEYSPDVNLVITGSWDSTVKLW  124

Query  541  D  543
            D
Sbjct  125  D  125



>gb|ELU09330.1| hypothetical protein CAPTEDRAFT_21337 [Capitella teleta]
Length=328

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGG  345
            MTA  LP   +L++PP+DGIS L+F   S Q LLVSSWD TVRL+D S N +R  + H  
Sbjct  1    MTAGELPNESKLNNPPDDGISALKFGPGSSQFLLVSSWDCTVRLFDVSTNFMRMKYNHSA  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWD  522
            AVLDCCF D+   +S   D T++   FN   +  +G HD+ +RCVEY      V+TGSWD
Sbjct  61   AVLDCCFQDNVHAYSGGLDKTLKAYDFNTNSETQVGSHDSAIRCVEYCPEVNVVVTGSWD  120

Query  523  KTLKCWD  543
             T+K WD
Sbjct  121  STVKLWD  127



>ref|XP_006727789.1| PREDICTED: mitotic checkpoint protein BUB3-like [Leptonychotes 
weddellii]
Length=142

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005648737.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24193.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=334

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGA  348
            M A P   GR L  PPNDGIS LRFSN SD LL SSWD +VRLYD   +  +G+F     
Sbjct  1    MAAPPPFLGRPLESPPNDGISGLRFSNTSDLLLCSSWDGSVRLYDPPRSLTKGSFSQQAP  60

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDK  525
            VLD  F +DSS F A  D  V+R  +    + ++G+H A  RCVE+    G V +GSWDK
Sbjct  61   VLDAAFQEDSSIFLAGLDGIVKRYDYFARAETVIGQHAAGARCVEWLPERGLVASGSWDK  120

Query  526  TLKCWD  543
            TL+CWD
Sbjct  121  TLRCWD  126



>ref|XP_008154368.1| PREDICTED: mitotic checkpoint protein BUB3 [Eptesicus fuscus]
Length=328

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN+LR  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSLRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   DN ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDNQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|EDL17720.1| budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae), 
isoform CRA_b [Mus musculus]
Length=195

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_009874299.1| PREDICTED: mitotic checkpoint protein BUB3-like, partial [Apaloderma 
vittatum]
 ref|XP_010176792.1| PREDICTED: mitotic checkpoint protein BUB3-like, partial [Caprimulgus 
carolinensis]
Length=142

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|KFP92054.1| Mitotic checkpoint protein BUB3, partial [Apaloderma vittatum]
 gb|KFZ45964.1| Mitotic checkpoint protein BUB3, partial [Caprimulgus carolinensis]
Length=140

 Score =   118 bits (295),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005880912.1| PREDICTED: mitotic checkpoint protein BUB3 [Myotis brandtii]
Length=326

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN+LR  + H GAVLDC F D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSLRLKYQHSGAVLDCAFXDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   DN ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDNQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|EHH65091.1| hypothetical protein EGM_18435 [Macaca fascicularis]
Length=328

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHYLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010597524.1| PREDICTED: LOW QUALITY PROTEIN: mitotic checkpoint protein BUB3 
[Loxodonta africana]
Length=324

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +D+++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQDNLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004374979.1| PREDICTED: mitotic checkpoint protein BUB3 [Trichechus manatus 
latirostris]
Length=326

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +D+++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQDNLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005671578.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X5 [Sus scrofa]
Length=275

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004700939.1| PREDICTED: mitotic checkpoint protein BUB3 [Echinops telfairi]
Length=328

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +D+++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQDNLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004659326.1| PREDICTED: mitotic checkpoint protein BUB3 [Jaculus jaculus]
Length=328

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++I+G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENIVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004438950.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Ceratotherium 
simum simum]
Length=326

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN+LR  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSLRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004438949.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Ceratotherium 
simum simum]
Length=328

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN+LR  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSLRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006008248.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X1 [Latimeria 
chalumnae]
Length=361

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = +1

Query  175  AAPLPTGR---ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHG  342
            AA + TG    ++S PP DGIS ++FS +S Q LLVSSWD TVRLYD SAN +R  + H 
Sbjct  32   AADIMTGSNEFKISQPPEDGISAVKFSPNSSQFLLVSSWDTTVRLYDVSANTMRLKYQHS  91

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSW  519
            GAV+DC F+D +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGSW
Sbjct  92   GAVVDCAFYDPTHAWSGGLDLQLKTRDLNTDQETVVGTHDAPIRCVEYCPEVNVMVTGSW  151

Query  520  DKTLKCWD  543
            D+T+K WD
Sbjct  152  DQTVKLWD  159



>ref|XP_006008249.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform X2 [Latimeria 
chalumnae]
Length=359

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 5/129 (4%)
 Frame = +1

Query  172  TAAPLPTGR---ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVH  339
             AA + TG    ++S PP DGIS ++FS +S Q LLVSSWD TVRLYD SAN +R  + H
Sbjct  31   VAADIMTGSNEFKISQPPEDGISAVKFSPNSSQFLLVSSWDTTVRLYDVSANTMRLKYQH  90

Query  340  GGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGS  516
             GAV+DC F+D +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGS
Sbjct  91   SGAVVDCAFYDPTHAWSGGLDLQLKTRDLNTDQETVVGTHDAPIRCVEYCPEVNVMVTGS  150

Query  517  WDKTLKCWD  543
            WD+T+K WD
Sbjct  151  WDQTVKLWD  159



>ref|XP_006136163.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pelodiscus 
sinensis]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005305938.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Chrysemys 
picta bellii]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005305939.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Chrysemys 
picta bellii]
Length=324

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006267668.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Alligator 
mississippiensis]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005602229.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Equus 
caballus]
 ref|XP_008536070.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Equus 
przewalskii]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|NP_033904.2| mitotic checkpoint protein BUB3 [Mus musculus]
 ref|NP_001007794.1| mitotic checkpoint protein BUB3 isoform b [Homo sapiens]
 ref|NP_001069645.1| mitotic checkpoint protein BUB3 [Bos taurus]
 ref|NP_001041371.2| mitotic checkpoint protein BUB3 [Rattus norvegicus]
 ref|XP_001161122.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pan troglodytes]
 ref|XP_001928080.1| PREDICTED: mitotic checkpoint protein BUB3 isoformX2 [Sus scrofa]
 ref|XP_002927295.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Ailuropoda 
melanoleuca]
 ref|XP_003255109.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Nomascus 
leucogenys]
 ref|XP_003794128.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Otolemur 
garnettii]
 ref|XP_003816353.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pan paniscus]
 ref|XP_003904415.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Papio 
anubis]
 ref|XP_004050280.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004265787.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Orcinus 
orca]
 ref|XP_004416457.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004474647.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 4 [Dasypus 
novemcinctus]
 ref|XP_004680434.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Condylura 
cristata]
 ref|XP_004804683.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Mustela 
putorius furo]
 ref|XP_004876154.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004838822.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Heterocephalus 
glaber]
 ref|XP_003479869.2| PREDICTED: mitotic checkpoint protein BUB3 [Cavia porcellus]
 ref|XP_005088067.1| PREDICTED: mitotic checkpoint protein BUB3-like [Mesocricetus 
auratus]
 ref|XP_005402018.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005566729.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Macaca 
fascicularis]
 ref|XP_005602228.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Equus 
caballus]
 ref|XP_005698640.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Capra 
hircus]
 ref|XP_005895143.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bos mutus]
 ref|XP_005985537.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_006188784.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Camelus 
ferus]
 ref|XP_006207486.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Vicugna 
pacos]
 ref|XP_006507333.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Mus musculus]
 ref|XP_006912937.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pteropus 
alecto]
 ref|XP_006912938.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pteropus 
alecto]
 ref|XP_006977022.1| PREDICTED: mitotic checkpoint protein BUB3 [Peromyscus maniculatus 
bairdii]
 ref|XP_007073841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Panthera 
tigris altaica]
 ref|XP_007114002.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Physeter 
catodon]
 ref|XP_006080475.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Bubalus 
bubalis]
 ref|XP_007173322.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007451170.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Lipotes 
vexillifer]
 ref|XP_003510583.2| PREDICTED: mitotic checkpoint protein BUB3 [Cricetulus griseus]
 ref|XP_007628780.1| PREDICTED: mitotic checkpoint protein BUB3 [Cricetulus griseus]
 ref|XP_008068778.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Tarsius 
syrichta]
 ref|XP_008536069.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Equus 
przewalskii]
 ref|XP_008577755.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008683647.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Ursus 
maritimus]
 ref|XP_009244152.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pongo 
abelii]
 ref|XP_010355771.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Rhinopithecus 
roxellana]
 ref|XP_010633613.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Fukomys 
damarensis]
 ref|XP_010857477.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bison 
bison bison]
 ref|XP_010951235.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus bactrianus]
 ref|XP_010951242.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus bactrianus]
 ref|XP_010974334.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus dromedarius]
 ref|XP_010974335.1| PREDICTED: mitotic checkpoint protein BUB3 [Camelus dromedarius]
 ref|XP_011285906.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Felis 
catus]
 ref|XP_011363753.1| PREDICTED: mitotic checkpoint protein BUB3 [Pteropus vampyrus]
 ref|XP_011363754.1| PREDICTED: mitotic checkpoint protein BUB3 [Pteropus vampyrus]
 sp|Q1JQB2.1|BUB3_BOVIN RecName: Full=Mitotic checkpoint protein BUB3 [Bos taurus]
 sp|Q9WVA3.2|BUB3_MOUSE RecName: Full=Mitotic checkpoint protein BUB3; AltName: Full=WD 
repeat type I transmembrane protein A72.5 [Mus musculus]
 gb|AAC28439.1| testis mitotic checkpoint BUB3 [Homo sapiens]
 gb|AAH25089.1| Budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae) 
[Mus musculus]
 dbj|BAC40409.1| unnamed protein product [Mus musculus]
 gb|AAH99199.1| Budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae) 
[Rattus norvegicus]
 gb|AAI16091.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Bos 
taurus]
 gb|EAW49284.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_a [Homo sapiens]
 gb|ABQ13019.1| BUB3 budding uninhibited by benzimidazoles 3 [Bos taurus]
 gb|EDM11706.1| budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae), 
isoform CRA_b [Rattus norvegicus]
 tpg|DAA14656.1| TPA: mitotic checkpoint protein BUB3 [Bos taurus]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006136164.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pelodiscus 
sinensis]
Length=324

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006879938.1| PREDICTED: mitotic checkpoint protein BUB3 [Elephantulus edwardii]
Length=328

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +D+++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THSWSGGLDHQLKVHDLNTDQDNLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_002756721.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Callithrix 
jacchus]
Length=326

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006267669.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Alligator 
mississippiensis]
Length=324

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010633595.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Fukomys 
damarensis]
Length=330

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006867487.1| PREDICTED: mitotic checkpoint protein BUB3 [Chrysochloris asiatica]
Length=328

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006188783.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Camelus 
ferus]
Length=328

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|EAW49287.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_c [Homo sapiens]
 dbj|BAG72965.1| BUB3 budding uninhibited by benzimidazoles 3 homolog [synthetic 
construct]
 gb|EFB13014.1| hypothetical protein PANDA_017056 [Ailuropoda melanoleuca]
 gb|EGW10504.1| Mitotic checkpoint protein BUB3 [Cricetulus griseus]
 gb|EHA97530.1| Mitotic checkpoint protein BUB3 [Heterocephalus glaber]
 gb|ELR56861.1| Mitotic checkpoint protein BUB3 [Bos mutus]
Length=324

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006080476.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Bubalus 
bubalis]
Length=325

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010633604.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Fukomys 
damarensis]
Length=328

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|AAD38038.1|AF149822_1 mitotic checkpoint protein BUB3 [Mus musculus]
Length=326

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_007962513.1| PREDICTED: mitotic checkpoint protein BUB3 [Chlorocebus sabaeus]
Length=293

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|AAX43869.1| BUB3 budding uninhibited by benzimidazoles 3-like [synthetic 
construct]
Length=329

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004751814.1| PREDICTED: mitotic checkpoint protein BUB3 [Mustela putorius 
furo]
Length=327

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_008825474.1| PREDICTED: mitotic checkpoint protein BUB3 [Nannospalax galili]
Length=328

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_002722642.2| PREDICTED: mitotic checkpoint protein BUB3 [Oryctolagus cuniculus]
Length=328

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_003734599.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Callithrix 
jacchus]
Length=328

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|NP_004716.1| mitotic checkpoint protein BUB3 isoform a [Homo sapiens]
 ref|NP_001253182.1| mitotic checkpoint protein BUB3 [Macaca mulatta]
 ref|XP_001161211.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pan troglodytes]
 ref|XP_003255108.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Nomascus 
leucogenys]
 ref|XP_001490096.3| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Equus 
caballus]
 ref|XP_003794127.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Otolemur 
garnettii]
 ref|XP_003816352.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pan paniscus]
 ref|XP_003904414.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Papio 
anubis]
 ref|XP_003922172.1| PREDICTED: mitotic checkpoint protein BUB3 [Saimiri boliviensis 
boliviensis]
 ref|XP_003994528.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Felis 
catus]
 ref|XP_004050279.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004265786.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Orcinus 
orca]
 ref|XP_004321909.1| PREDICTED: mitotic checkpoint protein BUB3-like [Tursiops truncatus]
 ref|XP_004416456.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004804682.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Mustela 
putorius furo]
 ref|XP_004876153.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004838821.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Heterocephalus 
glaber]
 ref|XP_005225912.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bos taurus]
 ref|XP_005320805.1| PREDICTED: mitotic checkpoint protein BUB3 [Ictidomys tridecemlineatus]
 ref|XP_005402017.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005566728.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Macaca 
fascicularis]
 ref|XP_005671576.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Sus scrofa]
 ref|XP_005671577.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X4 [Sus scrofa]
 ref|XP_005698639.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Capra 
hircus]
 ref|XP_005895142.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bos mutus]
 ref|XP_005985536.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_006207485.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Vicugna 
pacos]
 ref|XP_006143981.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Tupaia 
chinensis]
 ref|XP_006143982.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Tupaia 
chinensis]
 ref|XP_006143983.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X3 [Tupaia 
chinensis]
 ref|XP_007073840.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007114001.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Physeter 
catodon]
 ref|XP_006080473.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bubalus 
bubalis]
 ref|XP_006080474.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Bubalus 
bubalis]
 ref|XP_007173320.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173321.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007451169.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007935003.1| PREDICTED: mitotic checkpoint protein BUB3 [Orycteropus afer 
afer]
 ref|XP_008068774.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Tarsius 
syrichta]
 ref|XP_008536067.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Equus 
przewalskii]
 ref|XP_008577754.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Galeopterus 
variegatus]
 ref|XP_008683640.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Ursus 
maritimus]
 ref|XP_010355762.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010857476.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Bison 
bison bison]
 ref|XP_011233098.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_011285905.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Felis 
catus]
 sp|O43684.1|BUB3_HUMAN RecName: Full=Mitotic checkpoint protein BUB3 [Homo sapiens]
 gb|AAC28438.1| spleen mitotic checkpoint BUB3 [Homo sapiens]
 gb|AAC06258.1| mitotic checkpoint component Bub3 [Homo sapiens]
 gb|AAC36307.1| kinetochore protein BUB3 [Homo sapiens]
 gb|AAH05138.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Homo 
sapiens]
 gb|AAH22438.1| Budding uninhibited by benzimidazoles 3 homolog (yeast) [Homo 
sapiens]
 gb|AAX32262.1| BUB3 budding uninhibited by benzimidazoles 3-like [synthetic 
construct]
 dbj|BAE91482.1| unnamed protein product [Macaca fascicularis]
 gb|EAW49285.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_b [Homo sapiens]
 gb|EAW49286.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast), 
isoform CRA_b [Homo sapiens]
 gb|ABM82778.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[synthetic construct]
 gb|ABM85968.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[synthetic construct]
 dbj|BAG35444.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20317.1| budding uninhibited by benzimidazoles 3 homolog [synthetic construct]
 gb|AIC50291.1| BUB3, partial [synthetic construct]
 gb|AIC55541.1| BUB3, partial [synthetic construct]
Length=328

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004474644.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004474645.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004474646.1| PREDICTED: mitotic checkpoint protein BUB3 isoform 3 [Dasypus 
novemcinctus]
Length=328

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|EDL17719.1| budding uninhibited by benzimidazoles 3 homolog (S. cerevisiae), 
isoform CRA_a [Mus musculus]
Length=350

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KFO37637.1| Mitotic checkpoint protein BUB3 [Fukomys damarensis]
Length=356

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010633579.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Fukomys 
damarensis]
 ref|XP_010633587.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Fukomys 
damarensis]
Length=353

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_003755337.1| PREDICTED: mitotic checkpoint protein BUB3 [Sarcophilus harrisii]
Length=326

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_006025193.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Alligator 
sinensis]
Length=368

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  50   KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  109

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  110  THAWSGGLDQQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  166



>ref|XP_001367606.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Monodelphis 
domestica]
 ref|XP_007478912.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Monodelphis 
domestica]
Length=324

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005351448.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Microtus 
ochrogaster]
Length=326

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +1

Query  202  LSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDDS  378
            L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D +
Sbjct  9    LNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPT  68

Query  379  SGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
              +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  69   HAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|ELK11851.1| Mitotic checkpoint protein BUB3 [Pteropus alecto]
Length=626

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  247  KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  306

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQV-ITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY     V +TGSWD+T+K WD
Sbjct  307  THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  363



>ref|XP_006025194.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Alligator 
sinensis]
Length=366

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN +R  + H GAVLDC F+D 
Sbjct  50   KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHSGAVLDCAFYDP  109

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  110  THAWSGGLDQQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  166



>ref|XP_005351447.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Microtus 
ochrogaster]
Length=328

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +1

Query  202  LSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDDS  378
            L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D +
Sbjct  9    LNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPT  68

Query  379  SGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
              +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  69   HAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_007519725.1| PREDICTED: mitotic checkpoint protein BUB3 [Erinaceus europaeus]
Length=328

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQESLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004680433.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Condylura 
cristata]
Length=359

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_002608311.1| hypothetical protein BRAFLDRAFT_125481 [Branchiostoma floridae]
 gb|EEN64321.1| hypothetical protein BRAFLDRAFT_125481 [Branchiostoma floridae]
Length=334

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 2/126 (2%)
 Frame = +1

Query  172  TAAPLPTGRELSDPPNDGISNLRFSNHSDQLL-VSSWDKTVRLYDASANALRGTFVHGGA  348
            T A  P   +L++ P DGIS ++FS  S QLL VSSWD +VRLYD + N LR  + H  A
Sbjct  3    TVAETPNEFKLNNCPTDGISAVKFSPTSSQLLLVSSWDCSVRLYDVAGNNLRNKYTHSSA  62

Query  349  VLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDK  525
            VLDCCF D    +S   D  ++    N  ++ ++G HDAP+RCVEY      VITGSWD+
Sbjct  63   VLDCCFFDPVHPYSGGLDQMLKTCDLNTSQETVVGNHDAPIRCVEYCPDVNVVITGSWDQ  122

Query  526  TLKCWD  543
            T+K WD
Sbjct  123  TVKLWD  128



>ref|NP_001125579.1| mitotic checkpoint protein BUB3 [Pongo abelii]
 sp|Q5RB58.1|BUB3_PONAB RecName: Full=Mitotic checkpoint protein BUB3 [Pongo abelii]
 emb|CAH91002.1| hypothetical protein [Pongo abelii]
Length=328

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQVI-TGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY     V+ TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMATGSWDQTVKLWD  124



>ref|XP_004625654.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Octodon 
degus]
Length=326

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LL+SSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLLSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004625653.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Octodon 
degus]
Length=328

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LL+SSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLLSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004579810.1| PREDICTED: mitotic checkpoint protein BUB3 [Ochotona princeps]
Length=328

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRLYD   N++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPTNSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMRDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010209860.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Tinamus 
guttatus]
Length=327

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN LR  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTLRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_007420849.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Python 
bivittatus]
Length=326

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++F+ ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFNPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDRQLKMHDLNTDQENLVGSHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KGL75167.1| Mitotic checkpoint protein BUB3, partial [Tinamus guttatus]
Length=323

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN LR  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTLRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_007420850.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Python 
bivittatus]
Length=324

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++F+ ++ Q LLVSSWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFNPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDRQLKMHDLNTDQENLVGSHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010209861.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Tinamus 
guttatus]
Length=326

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN LR  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTLRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_003218630.1| PREDICTED: mitotic checkpoint protein BUB3 [Anolis carolinensis]
Length=326

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLVSSWD +VRL+D  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLFDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDRQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_009668840.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Struthio 
camelus australis]
Length=326

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010182810.1| PREDICTED: mitotic checkpoint protein BUB3 [Mesitornis unicolor]
Length=327

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDNTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|ETE69240.1| Mitotic checkpoint protein BUB3, partial [Ophiophagus hannah]
Length=344

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 5/128 (4%)
 Frame = +1

Query  175  AAPLPTGR---ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHG  342
            A P  TG    +L+ PP DGIS+++F+ ++ Q LLVSSWD +VRLYD  AN +R  + H 
Sbjct  15   ARPAMTGSNEFKLNQPPEDGISSVKFNPNTSQFLLVSSWDTSVRLYDVPANTMRLKYQHT  74

Query  343  GAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSW  519
            GAVLDC F+D +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSW
Sbjct  75   GAVLDCAFYDPTHAWSGGLDRQLKMHDLNTDQENLVGSHDAPIRCVEYCPEVNVMVTGSW  134

Query  520  DKTLKCWD  543
            D+T+K WD
Sbjct  135  DQTVKLWD  142



>ref|XP_009668841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Struthio 
camelus australis]
Length=324

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KFQ35683.1| Mitotic checkpoint protein BUB3, partial [Mesitornis unicolor]
Length=323

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDNTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KFV79058.1| Mitotic checkpoint protein BUB3, partial [Struthio camelus australis]
Length=323

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005048890.1| PREDICTED: mitotic checkpoint protein BUB3 [Ficedula albicollis]
 ref|XP_005424560.1| PREDICTED: mitotic checkpoint protein BUB3 [Geospiza fortis]
 ref|XP_005528883.1| PREDICTED: mitotic checkpoint protein BUB3 [Pseudopodoces humilis]
 ref|XP_009085363.1| PREDICTED: mitotic checkpoint protein BUB3 [Serinus canaria]
 ref|XP_009276216.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009324149.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Pygoscelis 
adeliae]
 ref|XP_009917389.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_010406195.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Corvus 
cornix cornix]
 ref|XP_010580296.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Haliaeetus 
leucocephalus]
Length=329

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_005232503.1| PREDICTED: mitotic checkpoint protein BUB3 [Falco peregrinus]
 ref|XP_005439296.1| PREDICTED: mitotic checkpoint protein BUB3 [Falco cherrug]
 ref|XP_008638526.1| PREDICTED: mitotic checkpoint protein BUB3 [Corvus brachyrhynchos]
 ref|XP_009080642.1| PREDICTED: mitotic checkpoint protein BUB3 [Acanthisitta chloris]
 ref|XP_009276217.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Aptenodytes 
forsteri]
 ref|XP_009324150.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Pygoscelis 
adeliae]
 ref|XP_009477791.1| PREDICTED: mitotic checkpoint protein BUB3 [Pelecanus crispus]
 ref|XP_009474028.1| PREDICTED: mitotic checkpoint protein BUB3 [Nipponia nippon]
 ref|XP_009558386.1| PREDICTED: mitotic checkpoint protein BUB3 [Cuculus canorus]
 ref|XP_009577954.1| PREDICTED: mitotic checkpoint protein BUB3 [Fulmarus glacialis]
 ref|XP_009639373.1| PREDICTED: mitotic checkpoint protein BUB3 [Egretta garzetta]
 ref|XP_009808573.1| PREDICTED: mitotic checkpoint protein BUB3 [Gavia stellata]
 ref|XP_009908701.1| PREDICTED: mitotic checkpoint protein BUB3 [Picoides pubescens]
 ref|XP_009891033.1| PREDICTED: mitotic checkpoint protein BUB3 [Charadrius vociferus]
 ref|XP_009917397.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009944065.1| PREDICTED: mitotic checkpoint protein BUB3 [Opisthocomus hoazin]
 ref|XP_009956315.1| PREDICTED: mitotic checkpoint protein BUB3 [Leptosomus discolor]
 ref|XP_010017165.1| PREDICTED: mitotic checkpoint protein BUB3 [Nestor notabilis]
 ref|XP_009989710.1| PREDICTED: mitotic checkpoint protein BUB3 [Tauraco erythrolophus]
 ref|XP_009966791.1| PREDICTED: mitotic checkpoint protein BUB3 [Tyto alba]
 ref|XP_010152829.1| PREDICTED: mitotic checkpoint protein BUB3 [Eurypyga helias]
 ref|XP_010116092.1| PREDICTED: mitotic checkpoint protein BUB3 [Chlamydotis macqueenii]
 ref|XP_010206162.1| PREDICTED: mitotic checkpoint protein BUB3 [Colius striatus]
 ref|XP_010294157.1| PREDICTED: mitotic checkpoint protein BUB3 [Phaethon lepturus]
 ref|XP_010307383.1| PREDICTED: mitotic checkpoint protein BUB3 [Balearica regulorum 
gibbericeps]
 ref|XP_010406204.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Corvus 
cornix cornix]
 ref|XP_010580297.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Haliaeetus 
leucocephalus]
Length=327

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_008926745.1| PREDICTED: mitotic checkpoint protein BUB3 [Manacus vitellinus]
Length=324

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDATVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_008947573.1| PREDICTED: mitotic checkpoint protein BUB3 [Merops nubicus]
Length=327

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_008489974.1| PREDICTED: mitotic checkpoint protein BUB3 [Calypte anna]
 ref|XP_009698949.1| PREDICTED: mitotic checkpoint protein BUB3 [Cariama cristata]
Length=324

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KFW84791.1| Mitotic checkpoint protein BUB3, partial [Manacus vitellinus]
Length=323

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDATVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_004020302.1| PREDICTED: mitotic checkpoint protein BUB3 [Ovis aries]
Length=328

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+ PP DGIS+++FS ++ Q LLV SWD +VRLYD  AN++R  + H GAVLDC F+D 
Sbjct  8    KLNQPPEDGISSVKFSPNTSQFLLVCSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>gb|KFM06687.1| Mitotic checkpoint protein BUB3, partial [Aptenodytes forsteri]
 gb|KFO06110.1| Mitotic checkpoint protein BUB3, partial [Balearica regulorum 
gibbericeps]
 gb|KFO64136.1| Mitotic checkpoint protein BUB3, partial [Corvus brachyrhynchos]
 gb|KFO75577.1| Mitotic checkpoint protein BUB3, partial [Cuculus canorus]
 gb|KFO99290.1| Mitotic checkpoint protein BUB3, partial [Calypte anna]
 gb|KFP17868.1| Mitotic checkpoint protein BUB3, partial [Egretta garzetta]
 gb|KFP27096.1| Mitotic checkpoint protein BUB3, partial [Colius striatus]
 gb|KFP34686.1| Mitotic checkpoint protein BUB3, partial [Chlamydotis macqueenii]
 gb|KFP50742.1| Mitotic checkpoint protein BUB3, partial [Cathartes aura]
 gb|KFP65262.1| Mitotic checkpoint protein BUB3, partial [Cariama cristata]
 gb|KFP72694.1| Mitotic checkpoint protein BUB3, partial [Acanthisitta chloris]
 gb|KFP96582.1| Mitotic checkpoint protein BUB3, partial [Haliaeetus albicilla]
 gb|KFQ15505.1| Mitotic checkpoint protein BUB3, partial [Leptosomus discolor]
 gb|KFQ53541.1| Mitotic checkpoint protein BUB3, partial [Nestor notabilis]
 gb|KFQ59646.1| Mitotic checkpoint protein BUB3, partial [Pelecanus crispus]
 gb|KFQ69989.1| Mitotic checkpoint protein BUB3, partial [Phaethon lepturus]
 gb|KFQ80157.1| Mitotic checkpoint protein BUB3, partial [Phoenicopterus ruber 
ruber]
 gb|KFQ92037.1| Mitotic checkpoint protein BUB3, partial [Nipponia nippon]
 gb|KFR05456.1| Mitotic checkpoint protein BUB3, partial [Opisthocomus hoazin]
 gb|KFV05939.1| Mitotic checkpoint protein BUB3, partial [Tauraco erythrolophus]
 gb|KFV52344.1| Mitotic checkpoint protein BUB3, partial [Gavia stellata]
 gb|KFV53214.1| Mitotic checkpoint protein BUB3, partial [Tyto alba]
 gb|KFV62881.1| Mitotic checkpoint protein BUB3, partial [Picoides pubescens]
 gb|KFV94398.1| Mitotic checkpoint protein BUB3, partial [Eurypyga helias]
 gb|KFW06516.1| Mitotic checkpoint protein BUB3, partial [Fulmarus glacialis]
 gb|KFW68420.1| Mitotic checkpoint protein BUB3, partial [Pygoscelis adeliae]
 gb|KFZ62516.1| Mitotic checkpoint protein BUB3, partial [Podiceps cristatus]
 gb|KGL99443.1| Mitotic checkpoint protein BUB3, partial [Charadrius vociferus]
Length=323

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010713168.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Meleagris 
gallopavo]
Length=327

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGGHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|KFQ16715.1| Mitotic checkpoint protein BUB3, partial [Merops nubicus]
Length=323

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|NP_001006506.1| mitotic checkpoint protein BUB3 [Gallus gallus]
 ref|XP_010713167.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Meleagris 
gallopavo]
 emb|CAG32680.1| hypothetical protein RCJMB04_32k7 [Gallus gallus]
Length=329

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN++R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANSMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGGHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_004989752.1| mitotic checkpoint protein BUB3 [Salpingoeca rosetta]
 gb|EGD78076.1| mitotic checkpoint protein BUB3 [Salpingoeca rosetta]
Length=323

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 75/119 (63%), Gaps = 1/119 (1%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFH  369
            T  EL  PP DGIS++ FS  S+ LLV+SWDKT RLYD  +N L+ TF H   VLDC F 
Sbjct  2    TDTELVSPPQDGISSVVFSPTSNLLLVASWDKTCRLYDVDSNTLKFTFSHDAPVLDCAFL  61

Query  370  DDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYT-GQVITGSWDKTLKCWD  543
            DD++ F A  D  + +     G+  ++G H   ++CVE S   G VITGSWDKT+K W+
Sbjct  62   DDTTAFGAGIDKQLHKYDLTTGKSSVVGSHSEAIKCVECSIKHGVVITGSWDKTIKLWN  120



>ref|XP_002192609.2| PREDICTED: mitotic checkpoint protein BUB3 [Taeniopygia guttata]
 ref|XP_005505841.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Columba 
livia]
Length=329

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQESLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>ref|XP_005505842.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Columba 
livia]
 ref|XP_009510307.1| PREDICTED: mitotic checkpoint protein BUB3 [Phalacrocorax carbo]
Length=327

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQESLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|EMC88322.1| Mitotic checkpoint protein BUB3 [Columba livia]
Length=324

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  ++ ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQESLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005494903.1| PREDICTED: mitotic checkpoint protein BUB3 [Zonotrichia albicollis]
Length=329

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDLQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|ESA02941.1| hypothetical protein GLOINDRAFT_67599 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52975.1| Gle2p [Rhizophagus irregularis DAOM 197198w]
Length=332

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFS-NHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            EL DPP+D IS++ FS   S+ LLVSSWDKTVRLYD + N+LR +F H  +VLDCCF D 
Sbjct  7    ELVDPPSDAISSVVFSPTTSNHLLVSSWDKTVRLYDINENSLRASFQHKASVLDCCFSDG  66

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQ-VITGSWDKTLKCWD  543
               FS   D+ ++    N   + I+G HD  V+CVEYS     +++GSWD T++ WD
Sbjct  67   VHIFSGGLDHCIKSFDINSTNESIVGLHDKAVKCVEYSLEKHMIVSGSWDCTIRLWD  123



>ref|XP_005023233.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Anas platyrhynchos]
 gb|EOA98647.1| Mitotic checkpoint protein BUB3, partial [Anas platyrhynchos]
Length=324

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H G VLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGGHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_005023232.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Anas platyrhynchos]
Length=326

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H G VLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGGHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_010085772.1| PREDICTED: mitotic checkpoint protein BUB3 [Pterocles gutturalis]
Length=327

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DG S+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGTSSVKFSPNTSQFLLVSSWDTTVRLYDVPANTVRLKYQHSGAVLDCAFYDP  70

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  127



>gb|KFV05300.1| Mitotic checkpoint protein BUB3, partial [Pterocles gutturalis]
Length=323

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DG S+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGTSSVKFSPNTSQFLLVSSWDTTVRLYDVPANTVRLKYQHSGAVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_002738187.1| PREDICTED: mitotic checkpoint protein BUB3-like [Saccoglossus 
kowalevskii]
Length=324

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +1

Query  181  PLPTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLD  357
            P P   +LS  P+DGIS ++F  ++ Q LLVSSWD +VRLYD +AN +R  + H   VLD
Sbjct  2    PEPNEYKLSQCPDDGISAVKFGPNTSQFLLVSSWDSSVRLYDINANIMRTKYTHPEPVLD  61

Query  358  CCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLK  534
            CCFHD +  +S   D  ++    N   +  +G HDAP+RCVE+      +++GSWD+T+K
Sbjct  62   CCFHDQTHTYSGGFDRNLKMFDLNSNTETNVGSHDAPIRCVEFCPEVNVIVSGSWDQTVK  121

Query  535  CWD  543
             WD
Sbjct  122  LWD  124



>dbj|GAN04134.1| mitotic checkpoint protein BUB3-like [Mucor ambiguus]
Length=676

 Score =   118 bits (295),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRF-SNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            PT  EL +PP DGISN+ F     D LLVSSWDKT+RLY+   N L  TF    A+LDCC
Sbjct  353  PTQIELKNPPKDGISNVCFHPTDPDCLLVSSWDKTLRLYNVEKNELLQTFNTDAAILDCC  412

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCW  540
            F DD+  +    D  V+ +  N   + ++G+HDAPV CV Y S T +V TGSWD TL+ W
Sbjct  413  FGDDNVVYFGGLDRKVKMIDLNTNEESVIGEHDAPVSCVCYGSVTKRVYTGSWDMTLRVW  472

Query  541  D  543
            D
Sbjct  473  D  473



>gb|AAK12629.1|AF119790_1 WD repeat protein Bub3 [Xenopus laevis]
 gb|AAH73086.1| Xbub3 protein [Xenopus laevis]
Length=324

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS ++ Q LLVSSWD +VRLYD  AN +R  + H G VLDC F+D 
Sbjct  8    KLNQAPEDGISAVKFSPNTSQFLLVSSWDSSVRLYDVPANTMRLKYQHAGPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N   D ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDGDTVVGSHDAPIRCVEYCPEVNVIVTGSWDQTVKLWD  124



>ref|NP_001083768.1| mitotic checkpoint protein BUB3 [Xenopus laevis]
 sp|Q9YGY3.1|BUB3_XENLA RecName: Full=Mitotic checkpoint protein BUB3; Short=xbub3; AltName: 
Full=WD repeat protein Bub3 [Xenopus laevis]
 dbj|BAA34999.1| mitotic checkpoint [Xenopus laevis]
Length=330

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS ++ Q LLVSSWD +VRLYD  AN +R  + H G VLDC F+D 
Sbjct  14   KLNQAPEDGISAVKFSPNTSQFLLVSSWDSSVRLYDVPANTMRLKYQHAGPVLDCAFYDP  73

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N   D ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  74   THAWSGGLDHQLKMHDLNTDGDTVVGSHDAPIRCVEYCPEVNVIVTGSWDQTVKLWD  130



>gb|EPB85009.1| hypothetical protein HMPREF1544_08212 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=327

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRF-SNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            PT  EL +PP DGISN+ F     D LLVSSWDKT+RLY+   N L  TF    A+LDCC
Sbjct  4    PTQIELKNPPKDGISNVCFHPTDPDCLLVSSWDKTLRLYNVEKNELLQTFNTESAILDCC  63

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCW  540
            F DD+  +    D  V+ +  +   + ++G+H+APV CV Y S T +V TGSWD TL+ W
Sbjct  64   FGDDNVVYFGGLDRKVKMINLDTNEESVIGEHEAPVSCVCYGSVTKKVYTGSWDTTLRVW  123

Query  541  D  543
            D
Sbjct  124  D  124



>ref|NP_001007498.1| BUB3 mitotic checkpoint protein [Xenopus (Silurana) tropicalis]
 gb|AAH79934.1| bub3 protein [Xenopus (Silurana) tropicalis]
Length=324

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS ++ Q LLVSSWD +VRLYD  AN LR  + H G VLDC F+D 
Sbjct  8    KLNQAPEDGISAVKFSPNTSQFLLVSSWDSSVRLYDVPANTLRLKYQHAGPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N   + ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVNVIVTGSWDQTVKLWD  124



>emb|CEG76501.1| hypothetical protein RMATCC62417_11393 [Rhizopus microsporus]
Length=326

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   EL++PP DGI+N+ F+  + + LL SSWDKT+RLYD + N L   F +  A+LDCC
Sbjct  4    PNQFELAEPPLDGITNICFNQENPKYLLASSWDKTLRLYDTAVNHLVCKFENEAALLDCC  63

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCW  540
            F DDS  FS   D+ V++   N   D +LG+H   VRCVE+ S T  + TGSWD TL+ W
Sbjct  64   FMDDSVAFSGGVDHKVKKYDLNTKTDIVLGEHGGGVRCVEWSSLTNCLYTGSWDTTLQLW  123

Query  541  D  543
            D
Sbjct  124  D  124



>emb|CAJ81358.1| BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast) 
[Xenopus (Silurana) tropicalis]
Length=330

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS ++ Q LLVSSWD +VRLYD  AN LR  + H G VLDC F+D 
Sbjct  14   KLNQAPEDGISAVKFSPNTSQFLLVSSWDSSVRLYDVPANTLRLKYQHAGPVLDCAFYDP  73

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N   + ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  74   THAWSGGLDHQLKMHDLNTDGESVVGSHDAPIRCVEYCPEVNVIVTGSWDQTVKLWD  130



>ref|XP_007902124.1| PREDICTED: mitotic checkpoint protein BUB3 [Callorhinchus milii]
Length=324

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS ++ Q LLVSSWD TVRLYD ++N +R  + H  AVLDC FHD 
Sbjct  8    KLNQCPEDGISAIKFSPNTSQFLLVSSWDSTVRLYDITSNNMRLKYQHSAAVLDCAFHDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D +++    N  ++ ++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THSWSGGLDLSLKMHDLNTDQESVVGSHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  124



>ref|XP_011433685.1| PREDICTED: mitotic checkpoint protein BUB3-like [Crassostrea 
gigas]
 gb|EKC21138.1| Mitotic checkpoint protein BUB3 [Crassostrea gigas]
Length=326

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 74/123 (60%), Gaps = 1/123 (1%)
 Frame = +1

Query  178  APLPTGRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLD  357
            A  P   +L + P DGIS ++F   +  LL SSWD+TVRLYD  +N LR  + H   VLD
Sbjct  2    AETPNEFKLKNAPEDGISAVKFGTTNQFLLASSWDQTVRLYDVISNNLRIKYSHSEPVLD  61

Query  358  CCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLK  534
            CCF+D    +S   D T++   FN   +  +G+HD P+RCVEY      +ITGSWD T+K
Sbjct  62   CCFYDAVHSYSGGLDCTLKMFDFNTSTEQNVGQHDDPIRCVEYCPEVNVIITGSWDSTVK  121

Query  535  CWD  543
             WD
Sbjct  122  LWD  124



>ref|XP_780636.1| PREDICTED: mitotic checkpoint protein BUB3-like isoform 1 [Strongylocentrotus 
purpuratus]
Length=326

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L  PP DGIS ++F  +S Q LLVSSWD+TVRLYD  AN LR  + H   VLDCCF D 
Sbjct  9    KLDQPPEDGISAVKFGPNSSQFLLVSSWDETVRLYDVQANQLRAKYKHDRPVLDCCFCDQ  68

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   DN ++    N   +++LG H+  ++CVE+      V+TGSWD+T+K WD
Sbjct  69   THTYSGGLDNMLKLYDINTSTENVLGNHEDAIKCVEFCPEVNVVVTGSWDQTVKLWD  125



>ref|XP_001658374.1| AAEL007469-PA [Aedes aegypti]
 gb|EAT40825.1| AAEL007469-PA [Aedes aegypti]
Length=327

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ++ + P+D IS+++FS +++Q LLVSSWD +VRLYD   N LR  + H   VLDC FHD 
Sbjct  8    QIQNAPSDIISSVKFSPNTNQFLLVSSWDSSVRLYDVVNNTLRQKYYHDAPVLDCAFHDS  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQ-VITGSWDKTLKCWD  543
                SA  DN V+    N   + ILG HDA V+CVEYS     ++TGSWDKT++ WD
Sbjct  68   VRTVSAGLDNLVKLYDLNTHAESILGSHDAGVKCVEYSSKANGILTGSWDKTVRLWD  124



>ref|XP_005851317.1| hypothetical protein CHLNCDRAFT_33942 [Chlorella variabilis]
 gb|EFN59215.1| hypothetical protein CHLNCDRAFT_33942 [Chlorella variabilis]
Length=352

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 72/118 (61%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  GRELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHD  372
            G EL  PP DG++ LRF   +  LL SSWD T R+YD +AN L+GTF  G  VLD  F  
Sbjct  5    GAELPSPPTDGVTALRFFADTPLLLASSWDGTARVYDTAANVLQGTFAAGAPVLDAVFES  64

Query  373  DSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            D   ++A  D  V+R  F  G + +LG H+  V+CVE+    G +++GSWD +L+ WD
Sbjct  65   DGVVYTAGLDGAVKRYDFFRGAEAVLGSHEGAVKCVEWLPAQGLLVSGSWDSSLRLWD  122



>ref|XP_001866784.1| mitotic checkpoint protein BUB3 [Culex quinquefasciatus]
 gb|EDS43901.1| mitotic checkpoint protein BUB3 [Culex quinquefasciatus]
Length=327

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ++ + P+D IS+ +FS +++Q LLVSSWD +VRLYD   N LR  + H   VLDC FHD 
Sbjct  8    QIQNAPSDIISSCKFSPNTNQFLLVSSWDSSVRLYDVVNNTLRQKYYHDAPVLDCAFHDS  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQ-VITGSWDKTLKCWD  543
                SA  DN V+    N   + ILG HDA V+CVEYS     ++TGSWDKT+K WD
Sbjct  68   VRTVSAGLDNLVKLYDLNTHAESILGNHDAGVKCVEYSSKANGILTGSWDKTVKLWD  124



>ref|XP_009067387.1| hypothetical protein LOTGIDRAFT_223691 [Lottia gigantea]
 gb|ESO81944.1| hypothetical protein LOTGIDRAFT_223691 [Lottia gigantea]
Length=327

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P+  +L +PP+DGIS ++F   S Q LLVSSWD TVRLYD  +N  R  + H   VLDCC
Sbjct  5    PSEFKLKNPPSDGISAIKFGPTSSQFLLVSSWDTTVRLYDIISNNQRMIYSHTDPVLDCC  64

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCW  540
            F D    FS   D T++   FN   + ++G HD  V+CVE+      ++TGSWD T+K W
Sbjct  65   FQDSVHSFSGGIDKTLKMYDFNTQTETVVGTHDRAVKCVEFGADVNVIVTGSWDSTVKLW  124

Query  541  D  543
            D
Sbjct  125  D  125



>ref|XP_001512314.2| PREDICTED: mitotic checkpoint protein BUB3 [Ornithorhynchus anatinus]
Length=345

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 87/137 (64%), Gaps = 13/137 (9%)
 Frame = +1

Query  172  TAAPLPTGREL-----SDPP------NDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASAN  315
            TA  + TG ++     + PP       DGIS+++FS ++ Q LLVSSWD +VRLYD  AN
Sbjct  7    TAVRISTGSKMLFGHVNSPPCSNTEFRDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPAN  66

Query  316  ALRGTFVHGGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SY  492
             +R  + H GAVLDC F+D +  +S   D+ ++    N  +++++G HDAP+RCVEY   
Sbjct  67   TMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPE  126

Query  493  TGQVITGSWDKTLKCWD  543
               ++TGSWD+T+K WD
Sbjct  127  VNVMVTGSWDQTVKLWD  143



>ref|XP_010141872.1| PREDICTED: mitotic checkpoint protein BUB3 [Buceros rhinoceros 
silvestris]
Length=329

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  11   KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  70

Query  376  SSGF--SASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +      D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  71   THAWRGGGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  129



>gb|KFO94368.1| Mitotic checkpoint protein BUB3, partial [Buceros rhinoceros 
silvestris]
Length=325

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 80/119 (67%), Gaps = 4/119 (3%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+D 
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHSGAVLDCAFYDP  67

Query  376  SSGF--SASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +      D  ++    N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   THAWRGGGGLDQQLKMHDLNTDQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  126



>ref|XP_008780968.1| PREDICTED: mitotic checkpoint protein BUB3.3 [Phoenix dactylifera]
Length=326

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDDS  378
            EL +P  D IS +RF+  S+ LL+SSWD  +RLYD   +  R      GA+LDCCF D+ 
Sbjct  7    ELGEPIGDAISRIRFAPRSNNLLISSWDSVLRLYDVDRSVRRLAAPSEGALLDCCFQDEM  66

Query  379  SGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            +  SA +D  VRR     G  D++GKHD    C+EYS  TGQVIT   DKTL  WD
Sbjct  67   AALSAGSDGCVRRYNLCSGAQDVVGKHDDSATCIEYSEETGQVITAGLDKTLMFWD  122



>ref|XP_002109375.1| hypothetical protein TRIADDRAFT_53336 [Trichoplax adhaerens]
 gb|EDV27541.1| hypothetical protein TRIADDRAFT_53336 [Trichoplax adhaerens]
Length=326

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 3/117 (3%)
 Frame = +1

Query  202  LSDPPNDGISNLRFSNHSDQ--LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            L + P DGIS+L FS+ +D   LLVSSWDK+VRLYD  +N+L+G       VLDCCF+D 
Sbjct  9    LKESPTDGISSLTFSSATDSNALLVSSWDKSVRLYDVDSNSLQGIHNANMPVLDCCFYDK  68

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            S  +S   D  V    FN   + ++GKH+  VRCVEY    G +I+GSWDK +K WD
Sbjct  69   SRAYSGGLDCKVICYDFNSSFEKVMGKHEDAVRCVEYCPEVGVIISGSWDKNVKVWD  125



>emb|CEP12087.1| hypothetical protein [Parasitella parasitica]
Length=328

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRF-SNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            PT  EL +PPNDGISN+ F  N  D LLVSSWDKT+R+Y+   N L   +    A+LDCC
Sbjct  4    PTQIELKNPPNDGISNVCFHPNDPDCLLVSSWDKTLRVYNVGTNELLQKYNTDSAILDCC  63

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCW  540
            F  D+  +    D  V+ +      + ++G+HDA V CV Y S T +V TGSWD TL+ W
Sbjct  64   FGSDNIVYFGGLDKKVKMINLKTNEESVIGQHDAAVSCVCYSSITNKVYTGSWDTTLRVW  123

Query  541  D  543
            D
Sbjct  124  D  124



>ref|XP_002129118.1| PREDICTED: mitotic checkpoint protein BUB3-like [Ciona intestinalis]
Length=330

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L++ P DGIS+++FS  + Q LL SSWD +VRLYD + N+ R  + H   VLDCCF D 
Sbjct  6    KLNNCPTDGISSVKFSPSTSQFLLASSWDMSVRLYDVTENSQRFKYEHKSPVLDCCFSDS  65

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
               +S   D +V     N GR+ ++G+H+  +RCVEY S T  V+TGSWD+T+K WD
Sbjct  66   VHSWSGGLDGSVMMYDLNTGRETVVGRHNNSIRCVEYCSDTNVVVTGSWDQTIKLWD  122



>gb|KFM75540.1| Mitotic checkpoint protein BUB3, partial [Stegodyphus mimosarum]
Length=326

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGG  345
            MT A  P   +L + P D +S ++F   S+Q LL SSWD TVRLYD + N +R  + H  
Sbjct  1    MTLADTPNEFKLDNLPRDLVSAVKFGPTSNQFLLASSWDATVRLYDVTNNTMRLKYNHQA  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWD  522
             VLDCCF D    +S   D  V+   FN   +  +G HDAP++CVEY      VITGSWD
Sbjct  61   PVLDCCFQDAVHAWSGGLDCQVKTFDFNSTTETHVGSHDAPIKCVEYCPEVNVVITGSWD  120

Query  523  KTLKCWD  543
            +T+K WD
Sbjct  121  RTVKMWD  127



>ref|XP_005154549.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Melopsittacus 
undulatus]
Length=321

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 81/118 (69%), Gaps = 7/118 (6%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+DGIS+++FS ++ Q LLVSSWD TVRLYD  AN +R  + H GAVLDC F+  
Sbjct  8    KLNQTPDDGISSVKFSPNTSQFLLVSSWDTTVRLYDVPANTMRLKYQHTGAVLDCAFYVS  67

Query  376  S-SGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            + SGF      T+    +N  +++++G HDAP+RCVEY      ++TGSWD+T+K WD
Sbjct  68   AGSGFLF----TIILWTYNTEQENLVGAHDAPIRCVEYCPEVNVMVTGSWDQTVKLWD  121



>gb|KDQ54325.1| hypothetical protein JAAARDRAFT_38492 [Jaapia argillacea MUCL 
33604]
Length=331

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFS-NHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ELS PP D IS +RFS  + DQLLVSSWD TVR YD   N  +  F H  AVL CCF ++
Sbjct  8    ELSSPPFDSISAVRFSPTNPDQLLVSSWDTTVRFYDVVKNEQKCKFDHRAAVLSCCFAEE  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
            + G+S   D +VR+L  +  +  +LG+HD  V  + +S  T  +ITGSWD+T++ WD
Sbjct  68   TKGYSGGLDTSVRQLQLDTEKSTVLGQHDNAVSGLVWSKNTNALITGSWDRTIRFWD  124



>ref|XP_970295.1| PREDICTED: mitotic checkpoint protein BUB3 [Tribolium castaneum]
 gb|EEZ97704.1| budding uninhibited by benzimidazoles 3 [Tribolium castaneum]
Length=331

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCF  366
            T  ++  PP D IS+++F  +++Q LLVSSWD TVRLYD + N LR  + H   VLDCCF
Sbjct  5    TEYKVKSPPEDAISSVKFGPNTNQFLLVSSWDGTVRLYDVTTNNLRHKYAHDAPVLDCCF  64

Query  367  HDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
             D    +S   DNT++   FN   ++ +G H   ++CVEY S    ++TGSWD  +K WD
Sbjct  65   TDAVHSYSGGLDNTLKSFDFNTTTENTVGAHANAIKCVEYCSEVNGILTGSWDHHIKLWD  124



>ref|XP_002070172.1| GK11174 [Drosophila willistoni]
 gb|EDW81158.1| GK11174 [Drosophila willistoni]
Length=326

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP+D IS ++F   S+Q +  SSWD T+R YD +AN +R  FV    +LDC 
Sbjct  3    PPEFKLNNPPDDLISAVKFGPKSNQYMAASSWDGTLRFYDVAANQMRQKFVQDVPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DNT+R    N   + ++G HD P+RCVE++ Y   ++TGSWDK +K W
Sbjct  63   FMDIVHVASGSLDNTLRLFDVNTQTETVVGSHDEPIRCVEHAEYVNGILTGSWDKNVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_002055851.1| GJ10544 [Drosophila virilis]
 gb|EDW58963.1| GJ10544 [Drosophila virilis]
Length=326

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P+  +L++PP D IS ++F + S+Q +  SSWD T+R YD +AN++R  FV    +LDC 
Sbjct  3    PSEFKLNNPPEDLISAVKFGSKSNQYMAASSWDGTLRFYDVAANSMRQKFVQDAPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F +     S   DN +R    N   + ++G HD P+RCVE++ Y   ++TGSWDKT+K W
Sbjct  63   FMNIVHVVSGGLDNQLRMYDVNTQAETLVGAHDEPIRCVEHAEYVNGILTGSWDKTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_005169562.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Danio 
rerio]
Length=338

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +1

Query  163  GIMTAAPLPTGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVH  339
            G MT A      +L+  P D +S ++FS  S Q LLVSSWD +VRLYDASAN++R  + H
Sbjct  11   GTMTGA---NEFKLAQGPEDSVSAVKFSPSSSQFLLVSSWDGSVRLYDASANSMRMKYQH  67

Query  340  GGAVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGS  516
               VLDC F D +  +S   D+ ++    N  +D I+G HDAP+RCVE+      ++TGS
Sbjct  68   LAPVLDCAFSDPTHAWSGGLDSQLKTHDLNTDQDTIVGTHDAPIRCVEFCPEVNVLVTGS  127

Query  517  WDKTLKCWD  543
            WD++++ WD
Sbjct  128  WDQSVRLWD  136



>ref|XP_001998848.1| GI24196 [Drosophila mojavensis]
 gb|EDW14309.1| GI24196 [Drosophila mojavensis]
Length=326

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P+  +L++PP D IS ++F + S+Q +  SSWD T+R YD +AN++R  FV    +LDC 
Sbjct  3    PSEFKLNNPPEDLISAVKFGSKSNQYMAASSWDGTLRFYDVAANSMRQKFVQDAPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F +     S   DN +R    N   + ++G HD P+RCVE++ Y   ++TGSWDKT+K W
Sbjct  63   FMNIVHVVSGGLDNQLRMYDVNTQAETLVGSHDEPIRCVEHAEYVNGILTGSWDKTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_005185274.1| PREDICTED: mitotic checkpoint protein BUB3 [Musca domestica]
 ref|XP_005185275.1| PREDICTED: mitotic checkpoint protein BUB3 [Musca domestica]
 ref|XP_011293245.1| PREDICTED: mitotic checkpoint protein BUB3 [Musca domestica]
Length=330

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 2/127 (2%)
 Frame = +1

Query  169  MTAAPLPTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGG  345
            MT    PT  +LS+PP D IS +RF   S+Q L+ SSWD TVR YD +A      FV   
Sbjct  1    MTKKMRPTEVKLSNPPEDWISTVRFGPKSNQYLIASSWDGTVRFYDVNAVRQVIKFVQDS  60

Query  346  AVLDCCFHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYT-GQVITGSWD  522
             VLD  F D     S S DN +R    N   ++I+G H+ P+RCVEY+ +   ++TGSWD
Sbjct  61   PVLDATFMDVVHVVSGSLDNQLRLYDVNTHTENIVGSHEEPIRCVEYAESVNGILTGSWD  120

Query  523  KTLKCWD  543
            KTLK WD
Sbjct  121  KTLKLWD  127



>ref|XP_010938832.1| PREDICTED: mitotic checkpoint protein BUB3.3 [Elaeis guineensis]
Length=326

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 69/116 (59%), Gaps = 1/116 (1%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDDS  378
            EL +P  D IS +RF+  S+ LL+SSWD  +RLYD   +  R       A+LDCCF D+ 
Sbjct  7    ELGEPIGDAISRIRFAPRSNNLLISSWDSVLRLYDVDGSERRLEAPSEAALLDCCFQDEK  66

Query  379  SGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
            S  SA +D  +RR     G  D++GKHD    C+EYS  TGQV+T   DKTL  WD
Sbjct  67   SALSAGSDGCIRRYNLCSGAQDVVGKHDDSAICIEYSEETGQVVTAGLDKTLMFWD  122



>gb|AAD44035.1|AF088846_1 mitotic checkpoint control protein [Drosophila melanogaster]
 gb|AAD13398.1| mitotic checkpoint control protein Bub3 [Drosophila melanogaster]
Length=327

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD  AN LR  FV    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKFVQDAPLLDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   + I+G H+ P+RCVE++ Y   ++TGSWD T+K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVNGILTGSWDNTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_002037219.1| GM12232 [Drosophila sechellia]
 ref|XP_002105367.1| GD17697 [Drosophila simulans]
 gb|EDW53378.1| GM12232 [Drosophila sechellia]
 gb|EDX14870.1| GD17697 [Drosophila simulans]
Length=326

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD  AN LR  F+    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKFLQDAPLLDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   + I+G HD P+RCVE++ Y   ++TGSWD T+K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHDEPIRCVEHAEYVNGILTGSWDNTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|NP_991272.1| mitotic checkpoint protein BUB3 [Danio rerio]
 gb|AAQ91223.1| BUB3 budding uninhibited by benzimidazoles 3-like protein [Danio 
rerio]
Length=326

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 77/117 (66%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P D +S ++FS  S Q LLVSSWD +VRLYDASAN++R  + H   VLDC F D 
Sbjct  8    KLAQGPEDSVSAVKFSPSSSQFLLVSSWDGSVRLYDASANSMRMKYQHLAPVLDCAFSDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D+ ++    N  +D I+G HDAP+RCVE+      ++TGSWD++++ WD
Sbjct  68   THAWSGGLDSQLKTHDLNTDQDTIVGTHDAPIRCVEFCPEVNVLVTGSWDQSVRLWD  124



>ref|XP_007260980.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Astyanax 
mexicanus]
Length=326

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+D IS ++FS  + Q LLVSSWD TVRLYD   N++R  + H   VLDC F+D 
Sbjct  8    KLNQLPDDSISAVKFSPTTSQFLLVSSWDSTVRLYDVGGNSMRMKYQHLAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   DN ++    N  +D I+G HDAP+RCVEY      ++TGSWD +++ WD
Sbjct  68   THAWSGGLDNQLKMHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDMSVRLWD  124



>ref|XP_007260981.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Astyanax 
mexicanus]
Length=324

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P+D IS ++FS  + Q LLVSSWD TVRLYD   N++R  + H   VLDC F+D 
Sbjct  8    KLNQLPDDSISAVKFSPTTSQFLLVSSWDSTVRLYDVGGNSMRMKYQHLAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   DN ++    N  +D I+G HDAP+RCVEY      ++TGSWD +++ WD
Sbjct  68   THAWSGGLDNQLKMHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDMSVRLWD  124



>ref|NP_477381.1| Bub3, isoform A [Drosophila melanogaster]
 ref|NP_001287587.1| Bub3, isoform B [Drosophila melanogaster]
 gb|AAF56914.1| Bub3, isoform A [Drosophila melanogaster]
 gb|ACQ99842.1| FI07632p [Drosophila melanogaster]
 gb|AHN57586.1| Bub3, isoform B [Drosophila melanogaster]
Length=326

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD  AN LR  FV    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKFVQDAPLLDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   + I+G H+ P+RCVE++ Y   ++TGSWD T+K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVNGILTGSWDNTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_001989641.1| GH18686 [Drosophila grimshawi]
 gb|EDV92703.1| GH18686 [Drosophila grimshawi]
Length=326

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (63%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P+  +L++PP D IS ++F + S+Q +  SSWD T+R YD +AN++R  FV    +LDC 
Sbjct  3    PSEFKLNNPPEDLISAVKFGSKSNQYMAASSWDGTLRFYDVAANSMRQKFVQEAPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F +     S   DN +R    N   + ++G HD P+RCVE++ Y   ++TGSWD+T+K W
Sbjct  63   FMNIVHVVSGGLDNQLRLYDVNTQAESLIGSHDEPIRCVEHAEYVNGILTGSWDRTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_001964758.1| GF22876 [Drosophila ananassae]
 gb|EDV30554.1| GF22876 [Drosophila ananassae]
Length=326

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD S+N +R  F+    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQFMAASSWDGTLRFYDVSSNQMRQKFLQDAPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   D I+G H+ P+RCVE++ Y   ++TGSWD+ +K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQTDSIVGAHEEPIRCVEHAEYVNGILTGSWDRNVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>ref|XP_008478721.1| PREDICTED: mitotic checkpoint protein BUB3 [Diaphorina citri]
 ref|XP_008478722.1| PREDICTED: mitotic checkpoint protein BUB3 [Diaphorina citri]
Length=327

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCF  366
            T   L+ PP DGI+ ++F+ +S+Q LL SSWD  V LYD + N LR  + H   VLDCCF
Sbjct  6    TEYSLNSPPEDGITAVKFAPNSNQFLLASSWDCNVSLYDITNNNLRLKYAHSDPVLDCCF  65

Query  367  HDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
             D    FS   D T++   FN   + ++G HD P+R VEYS     ++TGSWD ++K WD
Sbjct  66   QDAVHSFSGGLDCTLKMFDFNTQTETVIGTHDQPIRAVEYSDEVNCILTGSWDTSVKMWD  125



>gb|AAM49895.1| LD23540p [Drosophila melanogaster]
Length=323

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD  AN LR  FV    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKFVQDAPLLDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   + I+G H+ P+RCVE++ Y   ++TGSWD T+K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRCVEHAEYVNGILTGSWDNTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>gb|ACO09248.1| Mitotic checkpoint protein BUB3 [Osmerus mordax]
Length=324

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P D IS ++FS  + Q LLVSSWD TVRLYD   N++R  + H   VLDC F+D 
Sbjct  8    KLNQGPEDSISAVKFSPSTAQFLLVSSWDSTVRLYDVGGNSMRMKYQHSAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +D I+G HDAP+RCVEY      ++TGSWD++++ WD
Sbjct  68   THSWSGGLDTQLKTHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDRSVRLWD  124



>ref|XP_002098566.1| GE10441 [Drosophila yakuba]
 gb|EDW98278.1| GE10441 [Drosophila yakuba]
Length=326

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 2/121 (2%)
 Frame = +1

Query  187  PTGRELSDPPNDGISNLRFSNHSDQLLV-SSWDKTVRLYDASANALRGTFVHGGAVLDCC  363
            P   +L++PP D IS ++F   S+Q +  SSWD T+R YD  AN LR  F+    +LDC 
Sbjct  3    PPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKFLQDAPILDCA  62

Query  364  FHDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCW  540
            F D     S S DN +R    N   + I+G H+ P+RCVE++ Y   ++TGSWD T+K W
Sbjct  63   FMDIVHVVSGSLDNQLRLFDVNTQAESIVGAHEEPIRCVEHAEYVNGILTGSWDNTVKLW  122

Query  541  D  543
            D
Sbjct  123  D  123



>gb|KDR15933.1| Mitotic checkpoint protein BUB3 [Zootermopsis nevadensis]
Length=331

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = +1

Query  190  TGRELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCF  366
            T  +L  PP DGIS+++F  +S Q LLVSSWD TVRLYD   N +R  + H   VLD CF
Sbjct  6    TEFKLKTPPEDGISSVKFGPNSAQFLLVSSWDSTVRLYDVITNNMRLKYTHDRPVLDVCF  65

Query  367  HDDSSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYS-YTGQVITGSWDKTLKCWD  543
             D    +S   DNT++   FN   + ++G HD  +R VEYS     ++TGSWD T K WD
Sbjct  66   QDAVHSYSGGLDNTLKMYDFNSNTETVVGTHDNAIRAVEYSPEVNGILTGSWDATAKLWD  125



>emb|CDQ93187.1| unnamed protein product [Oncorhynchus mykiss]
Length=250

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 75/117 (64%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P D IS ++FS  + Q LLVSSWD TVRLYD + N++R  + H   VLDC F+D 
Sbjct  63   KLNQGPEDSISAVKFSPSTGQFLLVSSWDCTVRLYDVAGNSMRIKYSHLAPVLDCAFYDP  122

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +D I+G HDAP+RCVEY      ++TGSWD++++ WD
Sbjct  123  THAWSGGLDTQLKTHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDRSVRLWD  179



>ref|XP_008288658.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X1 [Stegastes 
partitus]
Length=326

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS  + Q LLVSSWD TVRLYD   N +R  + H   VLDC F+D 
Sbjct  8    KLNQGPEDGISAVKFSPSTAQFLLVSSWDCTVRLYDVVGNTMRMKYQHTAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +D I+G HDAP+RCVEY      ++TGSWD++++ WD
Sbjct  68   THSWSGGLDAQLKTHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDRSVRLWD  124



>ref|XP_008288659.1| PREDICTED: mitotic checkpoint protein BUB3 isoform X2 [Stegastes 
partitus]
Length=324

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P DGIS ++FS  + Q LLVSSWD TVRLYD   N +R  + H   VLDC F+D 
Sbjct  8    KLNQGPEDGISAVKFSPSTAQFLLVSSWDCTVRLYDVVGNTMRMKYQHTAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +D I+G HDAP+RCVEY      ++TGSWD++++ WD
Sbjct  68   THSWSGGLDAQLKTHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDRSVRLWD  124



>gb|KFB42019.1| AGAP010544-PA-like protein [Anopheles sinensis]
Length=327

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ++ +PP D IS +RFS  +++ LLVSSWD  VRLYD  +N+LR  F H   VLDC F D 
Sbjct  8    QILNPPGDAISAVRFSPQTNKFLLVSSWDSCVRLYDVVSNSLRHKFYHTAPVLDCAFLDS  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
                S   DNTV+    N   +++LG H+A V+CVE       ++TGSWDK++K WD
Sbjct  68   MKTVSGGLDNTVKLYDLNSHTENVLGSHNAGVKCVESCKLLNAILTGSWDKSVKMWD  124



>emb|CBN81549.1| Mitotic checkpoint protein BUB3 [Dicentrarchus labrax]
Length=324

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHSDQ-LLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            +L+  P D IS ++FS+ + Q LLVSSWD TVRLYD ++N +R  + H   VLDC F+D 
Sbjct  8    KLNQGPEDSISAVKFSSSTTQFLLVSSWDCTVRLYDVASNTMRMKYQHTAPVLDCAFYDP  67

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEY-SYTGQVITGSWDKTLKCWD  543
            +  +S   D  ++    N  +D I+G HDAP+RCVEY      ++TGSWD++++ WD
Sbjct  68   THSWSGGLDAQLKTHDLNTDQDTIVGTHDAPIRCVEYCPEVNVMVTGSWDRSVRLWD  124



>gb|KIP03100.1| hypothetical protein PHLGIDRAFT_111262 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=330

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 72/117 (62%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFSNHS-DQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ELS PP DGIS++RFS  S  QLLV+SWD TVRLYD  AN  +  F H  AVL  CF D+
Sbjct  6    ELSSPPFDGISSVRFSPSSPSQLLVASWDTTVRLYDVDANEQKAKFDHRAAVLATCFGDN  65

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSY-TGQVITGSWDKTLKCWD  543
               +S   D +VR L  N  + + LG+H   +  + YS     +ITGSWD+TL+ WD
Sbjct  66   EHAYSGGLDTSVRELELNTEKINNLGQHSDSITSMNYSRDLNSLITGSWDRTLRFWD  122



>ref|XP_007314228.1| hypothetical protein SERLADRAFT_379618 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO04069.1| hypothetical protein SERLA73DRAFT_130698 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO29986.1| hypothetical protein SERLADRAFT_379618 [Serpula lacrymans var. 
lacrymans S7.9]
Length=329

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 2/117 (2%)
 Frame = +1

Query  199  ELSDPPNDGISNLRFS-NHSDQLLVSSWDKTVRLYDASANALRGTFVHGGAVLDCCFHDD  375
            ELS PP D +S++RFS  + D LLVS+WD TVRLYD ++N  +  F H  AVL CCF D 
Sbjct  6    ELSSPPFDSVSSVRFSPTNPDHLLVSAWDTTVRLYDVASNEQKAKFDHRAAVLACCFSDA  65

Query  376  SSGFSASTDNTVRRLVFNYGRDDILGKHDAPVRCVEYSYTGQV-ITGSWDKTLKCWD  543
            +  +S   D  +R L  +  +  +LG+HD  + C+ +S    V +TGSWD+T++ WD
Sbjct  66   AHAYSGGLDTCIRELDLSTEKATVLGQHDNAISCMSHSQELNVTMTGSWDQTVRFWD  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490