BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF032C12

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783706.1|  PREDICTED: uncharacterized protein LOC104232253    146   5e-38   Nicotiana sylvestris
ref|XP_009627765.1|  PREDICTED: uncharacterized protein LOC104118259    142   2e-36   Nicotiana tomentosiformis
ref|XP_006366207.1|  PREDICTED: uncharacterized protein LOC102587...    139   2e-35   Solanum tuberosum [potatoes]
ref|XP_006366208.1|  PREDICTED: uncharacterized protein LOC102587...    139   2e-35   Solanum tuberosum [potatoes]
ref|XP_004245262.1|  PREDICTED: uncharacterized protein LOC101258883    137   1e-34   Solanum lycopersicum
ref|XP_009791161.1|  PREDICTED: uncharacterized protein LOC104238494    137   2e-34   Nicotiana sylvestris
ref|XP_006340268.1|  PREDICTED: uncharacterized protein LOC102587334    136   3e-34   Solanum tuberosum [potatoes]
ref|XP_009623066.1|  PREDICTED: uncharacterized protein LOC104114346    134   9e-34   Nicotiana tomentosiformis
ref|XP_010313606.1|  PREDICTED: uncharacterized protein LOC101255958    133   3e-33   Solanum lycopersicum
ref|XP_011081835.1|  PREDICTED: uncharacterized protein LOC105164774    117   1e-27   Sesamum indicum [beniseed]
gb|EYU21883.1|  hypothetical protein MIMGU_mgv1a005504mg                113   3e-26   Erythranthe guttata [common monkey flower]
gb|EYU21882.1|  hypothetical protein MIMGU_mgv1a005504mg                113   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_010249715.1|  PREDICTED: uncharacterized protein LOC104592187    110   5e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002309560.2|  hypothetical protein POPTR_0006s25880g             108   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010254104.1|  PREDICTED: uncharacterized protein LOC104595187    107   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006450629.1|  hypothetical protein CICLE_v10008167mg             104   7e-23   Citrus clementina [clementine]
ref|XP_006476094.1|  PREDICTED: uncharacterized protein LOC102623437    103   1e-22   Citrus sinensis [apfelsine]
ref|XP_002324818.2|  hypothetical protein POPTR_0018s00770g             101   2e-22   
ref|XP_002516571.1|  conserved hypothetical protein                     102   3e-22   
emb|CDP16156.1|  unnamed protein product                                101   9e-22   Coffea canephora [robusta coffee]
ref|XP_008347683.1|  PREDICTED: uncharacterized protein LOC103410796  96.3    3e-21   
ref|XP_011019654.1|  PREDICTED: uncharacterized protein LOC105122312    100   3e-21   Populus euphratica
gb|KDP34212.1|  hypothetical protein JCGZ_07783                       99.8    4e-21   Jatropha curcas
ref|XP_011026589.1|  PREDICTED: uncharacterized protein LOC105127137  99.4    4e-21   Populus euphratica
ref|XP_002284175.1|  PREDICTED: uncharacterized protein LOC100267889  98.6    1e-20   Vitis vinifera
emb|CAN61520.1|  hypothetical protein VITISV_033969                   95.9    3e-20   Vitis vinifera
ref|XP_008795085.1|  PREDICTED: uncharacterized protein LOC103710932  95.9    4e-20   
ref|XP_008347633.1|  PREDICTED: uncharacterized protein LOC103410...  96.7    5e-20   
ref|XP_008799063.1|  PREDICTED: uncharacterized protein LOC103713782  96.3    6e-20   Phoenix dactylifera
ref|XP_008220035.1|  PREDICTED: uncharacterized protein LOC103320179  95.9    9e-20   Prunus mume [ume]
ref|XP_010915823.1|  PREDICTED: uncharacterized protein LOC105040818  95.5    1e-19   Elaeis guineensis
ref|XP_006833308.1|  hypothetical protein AMTR_s00109p00049700        94.4    3e-19   Amborella trichopoda
ref|XP_007222835.1|  hypothetical protein PRUPE_ppa005114mg           91.7    2e-18   Prunus persica
ref|XP_009367912.1|  PREDICTED: uncharacterized protein LOC103957476  91.7    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_010049082.1|  PREDICTED: uncharacterized protein LOC104437756  91.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_010526182.1|  PREDICTED: uncharacterized protein LOC104803...  90.9    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_010526181.1|  PREDICTED: uncharacterized protein LOC104803...  90.9    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_002324817.1|  hypothetical protein POPTR_0018s00760g           90.9    5e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008393890.1|  PREDICTED: uncharacterized protein LOC103456039  90.5    8e-18   
ref|XP_011026588.1|  PREDICTED: uncharacterized protein LOC105127135  89.7    1e-17   Populus euphratica
gb|EPS70854.1|  hypothetical protein M569_03904                       89.7    1e-17   Genlisea aurea
ref|XP_002284423.1|  PREDICTED: uncharacterized protein LOC100266912  88.2    5e-17   Vitis vinifera
gb|KHG04871.1|  hypothetical protein F383_28778                       87.0    7e-17   Gossypium arboreum [tree cotton]
gb|KJB54847.1|  hypothetical protein B456_009G051700                  87.0    9e-17   Gossypium raimondii
gb|KJB54850.1|  hypothetical protein B456_009G051700                  87.0    9e-17   Gossypium raimondii
gb|KJB54846.1|  hypothetical protein B456_009G051700                  87.0    1e-16   Gossypium raimondii
gb|KJB54849.1|  hypothetical protein B456_009G051700                  87.0    1e-16   Gossypium raimondii
ref|XP_010109461.1|  hypothetical protein L484_001800                 85.5    4e-16   
ref|XP_004291206.1|  PREDICTED: uncharacterized protein LOC101310663  84.7    7e-16   Fragaria vesca subsp. vesca
ref|XP_006405251.1|  hypothetical protein EUTSA_v10000151mg           84.7    8e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008228542.1|  PREDICTED: uncharacterized protein LOC103327945  84.7    8e-16   Prunus mume [ume]
ref|XP_010429580.1|  PREDICTED: uncharacterized protein LOC104714041  84.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010249713.1|  PREDICTED: uncharacterized protein LOC104592186  83.6    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_004501773.1|  PREDICTED: uncharacterized protein LOC101498079  82.8    3e-15   
ref|XP_007012055.1|  Sulfite exporter TauE/SafE family protein        82.8    4e-15   
ref|XP_010417351.1|  PREDICTED: uncharacterized protein LOC104703106  82.8    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010667904.1|  PREDICTED: uncharacterized protein LOC104884...  82.4    5e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008380922.1|  PREDICTED: uncharacterized protein LOC103443804  81.6    9e-15   Malus domestica [apple tree]
ref|XP_002878880.1|  hypothetical protein ARALYDRAFT_481426           81.6    9e-15   
gb|KJB07538.1|  hypothetical protein B456_001G028700                  81.3    9e-15   Gossypium raimondii
ref|XP_007216108.1|  hypothetical protein PRUPE_ppa018715mg           81.3    1e-14   
gb|KJB07537.1|  hypothetical protein B456_001G028700                  81.3    1e-14   Gossypium raimondii
ref|XP_010472594.1|  PREDICTED: uncharacterized protein LOC104752...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010472595.1|  PREDICTED: uncharacterized protein LOC104752...  80.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009353619.1|  PREDICTED: uncharacterized protein LOC103944866  80.1    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_003523730.1|  PREDICTED: uncharacterized protein LOC100809318  80.1    3e-14   Glycine max [soybeans]
ref|XP_007137180.1|  hypothetical protein PHAVU_009G106400g           79.7    4e-14   Phaseolus vulgaris [French bean]
ref|XP_006833307.1|  hypothetical protein AMTR_s00109p00047950        79.3    5e-14   
gb|KDP37239.1|  hypothetical protein JCGZ_06295                       79.3    5e-14   Jatropha curcas
emb|CDX77007.1|  BnaC04g38020D                                        79.0    7e-14   
ref|NP_850068.1|  Sulfite exporter TauE/SafE family protein           78.6    9e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35338.1|  BnaA04g15090D                                        77.8    2e-13   Brassica napus [oilseed rape]
ref|XP_009140696.1|  PREDICTED: uncharacterized protein LOC103864686  77.8    2e-13   Brassica rapa
ref|XP_010048102.1|  PREDICTED: uncharacterized protein LOC104436...  77.8    2e-13   
ref|XP_010048101.1|  PREDICTED: uncharacterized protein LOC104436...  77.8    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010062471.1|  PREDICTED: uncharacterized protein LOC104449877  77.4    2e-13   Eucalyptus grandis [rose gum]
ref|XP_006294138.1|  hypothetical protein CARUB_v10023132mg           76.6    4e-13   Capsella rubella
ref|XP_008466240.1|  PREDICTED: uncharacterized protein LOC103503714  76.6    5e-13   Cucumis melo [Oriental melon]
gb|KEH35985.1|  sulfite exporter TauE/SafE family protein             76.6    5e-13   Medicago truncatula
ref|XP_009409059.1|  PREDICTED: uncharacterized protein LOC103991...  76.6    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409060.1|  PREDICTED: uncharacterized protein LOC103991...  76.6    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003636476.1|  hypothetical protein MTR_042s0018                76.6    5e-13   
gb|KEH35984.1|  sulfite exporter TauE/SafE family protein             76.3    5e-13   Medicago truncatula
ref|XP_003527825.1|  PREDICTED: uncharacterized protein LOC100810784  76.6    5e-13   Glycine max [soybeans]
ref|XP_003636475.1|  hypothetical protein MTR_042s0018                76.3    5e-13   
ref|XP_010048100.1|  PREDICTED: uncharacterized protein LOC104436943  75.9    9e-13   Eucalyptus grandis [rose gum]
gb|KHN42580.1|  hypothetical protein glysoja_042801                   75.5    1e-12   Glycine soja [wild soybean]
emb|CDO98032.1|  unnamed protein product                              75.1    2e-12   Coffea canephora [robusta coffee]
ref|XP_010691331.1|  PREDICTED: uncharacterized protein LOC104904681  74.7    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136295.1|  PREDICTED: uncharacterized protein LOC101214783  74.7    2e-12   
emb|CDY70121.1|  BnaC03g72820D                                        74.7    2e-12   Brassica napus [oilseed rape]
ref|XP_004168635.1|  PREDICTED: uncharacterized LOC101214783          74.7    2e-12   
ref|XP_007161546.1|  hypothetical protein PHAVU_001G078500g           73.2    5e-12   Phaseolus vulgaris [French bean]
ref|XP_003611976.1|  Membrane protein-like protein                    72.4    1e-11   Medicago truncatula
ref|XP_008792340.1|  PREDICTED: uncharacterized protein LOC103708984  72.0    2e-11   Phoenix dactylifera
ref|XP_004512029.1|  PREDICTED: uncharacterized protein LOC101496...  71.6    3e-11   Cicer arietinum [garbanzo]
ref|XP_004512031.1|  PREDICTED: uncharacterized protein LOC101496...  71.6    3e-11   Cicer arietinum [garbanzo]
ref|XP_004512028.1|  PREDICTED: uncharacterized protein LOC101496...  71.6    3e-11   Cicer arietinum [garbanzo]
ref|XP_004512030.1|  PREDICTED: uncharacterized protein LOC101496...  71.6    3e-11   Cicer arietinum [garbanzo]
gb|KJB43509.1|  hypothetical protein B456_007G203800                  71.2    3e-11   Gossypium raimondii
gb|KDO79723.1|  hypothetical protein CISIN_1g011811mg                 70.9    3e-11   Citrus sinensis [apfelsine]
ref|XP_009403528.1|  PREDICTED: uncharacterized protein LOC103987...  70.5    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403527.1|  PREDICTED: uncharacterized protein LOC103987...  70.1    6e-11   
ref|XP_006596174.1|  PREDICTED: uncharacterized protein LOC100781...  69.7    8e-11   
ref|XP_006596173.1|  PREDICTED: uncharacterized protein LOC100781...  69.7    8e-11   Glycine max [soybeans]
ref|XP_008338104.1|  PREDICTED: uncharacterized protein LOC103401...  69.7    9e-11   Malus domestica [apple tree]
ref|XP_009371583.1|  PREDICTED: uncharacterized protein LOC103960...  69.7    9e-11   Pyrus x bretschneideri [bai li]
ref|XP_008338105.1|  PREDICTED: uncharacterized protein LOC103401...  69.7    9e-11   Malus domestica [apple tree]
gb|KHN04837.1|  hypothetical protein glysoja_047520                   69.7    1e-10   Glycine soja [wild soybean]
ref|XP_009371582.1|  PREDICTED: uncharacterized protein LOC103960...  69.7    1e-10   Pyrus x bretschneideri [bai li]
gb|ACU18117.1|  unknown                                               65.9    1e-10   Glycine max [soybeans]
ref|XP_009381051.1|  PREDICTED: uncharacterized protein LOC103969282  69.7    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW58608.1|  hypothetical protein EUGRSUZ_H01268                   68.6    1e-10   Eucalyptus grandis [rose gum]
ref|XP_002521607.1|  conserved hypothetical protein                   69.3    1e-10   Ricinus communis
ref|XP_002516035.1|  conserved hypothetical protein                   69.3    1e-10   Ricinus communis
ref|XP_008241663.1|  PREDICTED: uncharacterized protein LOC103340075  69.3    1e-10   Prunus mume [ume]
ref|XP_007202022.1|  hypothetical protein PRUPE_ppa004997mg           69.3    2e-10   Prunus persica
gb|KHN36120.1|  hypothetical protein glysoja_003243                   68.6    2e-10   Glycine soja [wild soybean]
gb|KDP38300.1|  hypothetical protein JCGZ_05186                       68.6    2e-10   Jatropha curcas
gb|KJB40205.1|  hypothetical protein B456_007G050900                  68.2    2e-10   Gossypium raimondii
ref|XP_003517231.1|  PREDICTED: uncharacterized protein LOC100801441  68.6    3e-10   Glycine max [soybeans]
ref|XP_010070053.1|  PREDICTED: uncharacterized protein LOC104456870  68.6    3e-10   Eucalyptus grandis [rose gum]
gb|KJB40204.1|  hypothetical protein B456_007G050900                  68.2    3e-10   Gossypium raimondii
gb|KHG02837.1|  ATP synthase subunit delta                            68.2    3e-10   Gossypium arboreum [tree cotton]
ref|XP_010924740.1|  PREDICTED: uncharacterized protein LOC105047500  68.2    3e-10   Elaeis guineensis
ref|XP_010113488.1|  hypothetical protein L484_026823                 68.2    3e-10   
gb|KHM98753.1|  hypothetical protein glysoja_030806                   68.2    3e-10   Glycine soja [wild soybean]
ref|XP_003546436.1|  PREDICTED: uncharacterized protein LOC100816528  68.2    3e-10   
gb|KHN32619.1|  hypothetical protein glysoja_022301                   68.2    3e-10   Glycine soja [wild soybean]
ref|XP_009388715.1|  PREDICTED: uncharacterized protein LOC103975470  67.8    4e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN10230.1|  hypothetical protein glysoja_017834                   67.4    6e-10   Glycine soja [wild soybean]
ref|XP_006659358.1|  PREDICTED: uncharacterized protein LOC102716712  67.0    7e-10   Oryza brachyantha
ref|XP_008363110.1|  PREDICTED: uncharacterized protein LOC103426...  67.0    8e-10   Malus domestica [apple tree]
ref|XP_010649158.1|  PREDICTED: uncharacterized protein LOC100253061  67.0    8e-10   Vitis vinifera
ref|XP_008363111.1|  PREDICTED: uncharacterized protein LOC103426...  67.0    8e-10   Malus domestica [apple tree]
ref|XP_002303288.2|  hypothetical protein POPTR_0003s05180g           67.0    8e-10   
ref|XP_006383214.1|  hypothetical protein POPTR_0005s12570g           67.0    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_003542098.1|  PREDICTED: uncharacterized protein LOC100789...  67.0    9e-10   Glycine max [soybeans]
ref|XP_006595132.1|  PREDICTED: uncharacterized protein LOC100789...  66.6    1e-09   Glycine max [soybeans]
ref|XP_011001600.1|  PREDICTED: uncharacterized protein LOC105108...  66.6    1e-09   Populus euphratica
ref|XP_011001598.1|  PREDICTED: uncharacterized protein LOC105108...  66.6    1e-09   Populus euphratica
ref|XP_009356692.1|  PREDICTED: uncharacterized protein LOC103947...  66.6    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_009356691.1|  PREDICTED: uncharacterized protein LOC103947...  66.6    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_007156932.1|  hypothetical protein PHAVU_002G029400g           66.6    1e-09   Phaseolus vulgaris [French bean]
gb|KDO56903.1|  hypothetical protein CISIN_1g0454882mg                65.5    1e-09   Citrus sinensis [apfelsine]
emb|CDP02034.1|  unnamed protein product                              66.2    1e-09   Coffea canephora [robusta coffee]
gb|AEI98632.1|  hypothetical protein 111018.19                        66.2    2e-09   Coffea canephora [robusta coffee]
gb|ACJ85296.1|  unknown                                               66.2    2e-09   Medicago truncatula
dbj|BAJ87419.1|  predicted protein                                    65.9    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007046968.1|  DNA-directed RNA polymerase isoform 2            65.5    2e-09   
ref|XP_004235668.1|  PREDICTED: uncharacterized protein LOC101262796  65.5    3e-09   
ref|XP_007046967.1|  Sulfite exporter TauE/SafE family protein, p...  65.5    3e-09   
ref|XP_010999980.1|  PREDICTED: uncharacterized protein LOC105107666  65.5    3e-09   Populus euphratica
ref|XP_009592783.1|  PREDICTED: uncharacterized protein LOC104089...  65.1    3e-09   Nicotiana tomentosiformis
ref|XP_007216479.1|  hypothetical protein PRUPE_ppa024737mg           65.1    3e-09   Prunus persica
ref|XP_007024175.1|  Sulfite exporter TauE/SafE family protein, p...  64.7    3e-09   
ref|XP_006343068.1|  PREDICTED: uncharacterized protein LOC102587...  65.1    3e-09   Solanum tuberosum [potatoes]
ref|XP_009592781.1|  PREDICTED: uncharacterized protein LOC104089...  65.1    4e-09   Nicotiana tomentosiformis
ref|XP_004302906.1|  PREDICTED: uncharacterized protein LOC101294...  65.1    4e-09   Fragaria vesca subsp. vesca
ref|XP_009592782.1|  PREDICTED: uncharacterized protein LOC104089...  64.7    4e-09   Nicotiana tomentosiformis
ref|XP_008228544.1|  PREDICTED: uncharacterized protein LOC103327946  64.7    4e-09   Prunus mume [ume]
ref|XP_007024174.1|  Sulfite exporter TauE/SafE family protein, p...  64.7    4e-09   
ref|XP_006425694.1|  hypothetical protein CICLE_v10025446mg           64.7    4e-09   
ref|XP_006425693.1|  hypothetical protein CICLE_v10025446mg           64.3    6e-09   Citrus clementina [clementine]
ref|XP_007217721.1|  hypothetical protein PRUPE_ppa005105mg           64.3    6e-09   
ref|XP_010680798.1|  PREDICTED: uncharacterized protein LOC104895...  64.3    7e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56897.1|  hypothetical protein CISIN_1g0116822mg                60.8    7e-09   Citrus sinensis [apfelsine]
ref|XP_011011433.1|  PREDICTED: uncharacterized protein LOC105116...  64.3    7e-09   Populus euphratica
ref|XP_010680799.1|  PREDICTED: uncharacterized protein LOC104895...  64.3    7e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO79521.1|  hypothetical protein CISIN_1g011797mg                 63.9    7e-09   Citrus sinensis [apfelsine]
gb|KDO56896.1|  hypothetical protein CISIN_1g022146mg                 62.8    9e-09   Citrus sinensis [apfelsine]
ref|XP_010098073.1|  hypothetical protein L484_026205                 63.5    1e-08   
ref|XP_002310222.2|  hypothetical protein POPTR_0007s12700g           63.2    2e-08   Populus trichocarpa [western balsam poplar]
gb|EEE69518.1|  hypothetical protein OsJ_28979                        62.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062933.1|  Os09g0344800                                     62.8    2e-08   
ref|XP_006465610.1|  PREDICTED: uncharacterized protein LOC102613...  62.8    2e-08   
ref|XP_006426964.1|  hypothetical protein CICLE_v10025511mg           62.8    2e-08   Citrus clementina [clementine]
gb|EEC84400.1|  hypothetical protein OsI_30977                        62.8    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011011435.1|  PREDICTED: uncharacterized protein LOC105116...  62.8    2e-08   Populus euphratica
gb|ABR16391.1|  unknown                                               59.7    2e-08   Picea sitchensis
ref|XP_009800426.1|  PREDICTED: uncharacterized protein LOC104246...  62.4    2e-08   Nicotiana sylvestris
dbj|BAK01650.1|  predicted protein                                    62.4    3e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22888.1|  hypothetical protein F775_28607                       62.4    3e-08   
ref|XP_009800425.1|  PREDICTED: uncharacterized protein LOC104246...  62.4    3e-08   Nicotiana sylvestris
ref|XP_003523605.1|  PREDICTED: uncharacterized protein LOC100816633  62.4    3e-08   Glycine max [soybeans]
dbj|BAD05342.1|  unknown protein                                      59.3    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ABC47842.1|  membrane protein-like protein                         62.4    3e-08   Glycine max [soybeans]
ref|XP_003578003.1|  PREDICTED: uncharacterized protein LOC100827421  62.0    4e-08   Brachypodium distachyon [annual false brome]
gb|KJB56746.1|  hypothetical protein B456_009G134400                  62.0    4e-08   Gossypium raimondii
ref|XP_010263696.1|  PREDICTED: uncharacterized protein LOC104601887  62.0    4e-08   Nelumbo nucifera [Indian lotus]
gb|EAZ06861.1|  hypothetical protein OsI_29096                        62.0    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002299704.2|  hypothetical protein POPTR_0001s18300g           62.0    4e-08   
ref|XP_004287906.1|  PREDICTED: uncharacterized protein LOC101304510  61.6    5e-08   Fragaria vesca subsp. vesca
ref|XP_008228546.1|  PREDICTED: uncharacterized protein LOC103327...  61.6    5e-08   Prunus mume [ume]
ref|XP_008228549.1|  PREDICTED: uncharacterized protein LOC103327...  61.2    5e-08   Prunus mume [ume]
ref|XP_010254876.1|  PREDICTED: uncharacterized protein LOC104595...  61.2    6e-08   Nelumbo nucifera [Indian lotus]
ref|XP_007161342.1|  hypothetical protein PHAVU_001G061000g           61.2    6e-08   Phaseolus vulgaris [French bean]
ref|XP_008228548.1|  PREDICTED: uncharacterized protein LOC103327...  61.2    6e-08   Prunus mume [ume]
gb|AET03944.2|  sulfite exporter TauE/SafE family protein             60.8    7e-08   Medicago truncatula
ref|XP_003629468.1|  hypothetical protein MTR_8g077830                60.8    7e-08   
gb|AFK35007.1|  unknown                                               60.8    8e-08   Medicago truncatula
ref|XP_007150626.1|  hypothetical protein PHAVU_005G168100g           60.8    8e-08   Phaseolus vulgaris [French bean]
ref|XP_011025767.1|  PREDICTED: uncharacterized protein LOC105126564  60.8    9e-08   Populus euphratica
gb|EPS70855.1|  hypothetical protein M569_03905                       60.5    9e-08   Genlisea aurea
ref|XP_010526118.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_006426963.1|  hypothetical protein CICLE_v10025503mg           60.5    1e-07   Citrus clementina [clementine]
ref|XP_006465615.1|  PREDICTED: uncharacterized protein LOC102614...  60.5    1e-07   Citrus sinensis [apfelsine]
ref|XP_006465614.1|  PREDICTED: uncharacterized protein LOC102614...  60.5    1e-07   Citrus sinensis [apfelsine]
ref|NP_001061719.1|  Os08g0389700                                     60.1    1e-07   
gb|EEC83519.1|  hypothetical protein OsI_29108                        59.7    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002516037.1|  conserved hypothetical protein                   59.7    2e-07   
gb|ABR16333.1|  unknown                                               59.3    3e-07   Picea sitchensis
ref|XP_006340601.1|  PREDICTED: uncharacterized protein LOC102601548  58.9    3e-07   Solanum tuberosum [potatoes]
ref|XP_009788571.1|  PREDICTED: uncharacterized protein LOC104236361  58.9    3e-07   Nicotiana sylvestris
ref|NP_001145740.1|  uncharacterized protein LOC100279247             58.2    4e-07   
ref|XP_006585193.1|  PREDICTED: uncharacterized protein LOC100802321  58.9    4e-07   Glycine max [soybeans]
ref|XP_004956625.1|  PREDICTED: uncharacterized protein LOC101768056  58.5    4e-07   Setaria italica
ref|XP_008651296.1|  PREDICTED: uncharacterized protein LOC100279...  58.5    5e-07   
ref|XP_009346009.1|  PREDICTED: uncharacterized protein LOC103937781  58.2    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_008342687.1|  PREDICTED: uncharacterized protein LOC103405461  58.2    7e-07   
gb|EMT12794.1|  hypothetical protein F775_19997                       57.8    8e-07   
ref|XP_004302905.1|  PREDICTED: uncharacterized protein LOC101293605  57.8    1e-06   Fragaria vesca subsp. vesca
ref|XP_004232395.1|  PREDICTED: uncharacterized protein LOC101255155  57.4    1e-06   Solanum lycopersicum
ref|XP_006580198.1|  PREDICTED: uncharacterized protein LOC100819316  57.4    1e-06   Glycine max [soybeans]
ref|XP_007156036.1|  hypothetical protein PHAVU_003G253000g           57.4    1e-06   Phaseolus vulgaris [French bean]
ref|XP_009133962.1|  PREDICTED: uncharacterized protein LOC103858367  57.0    2e-06   Brassica rapa
ref|XP_009611257.1|  PREDICTED: uncharacterized protein LOC104104...  57.0    2e-06   
emb|CDX83221.1|  BnaA03g22850D                                        57.0    2e-06   
ref|XP_009611258.1|  PREDICTED: uncharacterized protein LOC104104...  56.6    2e-06   
ref|XP_009611253.1|  PREDICTED: uncharacterized protein LOC104104...  56.6    2e-06   Nicotiana tomentosiformis
ref|XP_002516570.1|  conserved hypothetical protein                   56.6    2e-06   Ricinus communis
ref|XP_009611256.1|  PREDICTED: uncharacterized protein LOC104104...  56.6    2e-06   
ref|XP_010935066.1|  PREDICTED: uncharacterized protein LOC105055061  56.2    3e-06   Elaeis guineensis
ref|XP_006660551.1|  PREDICTED: uncharacterized protein LOC102715329  56.2    3e-06   Oryza brachyantha
gb|KHN48052.1|  hypothetical protein glysoja_015522                   55.8    3e-06   Glycine soja [wild soybean]
ref|XP_006660104.1|  PREDICTED: uncharacterized protein LOC102707608  55.8    3e-06   
ref|XP_009396550.1|  PREDICTED: uncharacterized protein LOC103981523  55.8    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003527721.1|  PREDICTED: uncharacterized protein LOC100789748  55.8    4e-06   Glycine max [soybeans]
ref|XP_002460084.1|  hypothetical protein SORBIDRAFT_02g022510        55.5    4e-06   Sorghum bicolor [broomcorn]
ref|XP_009631525.1|  PREDICTED: uncharacterized protein LOC104121277  55.5    5e-06   
gb|KJB18684.1|  hypothetical protein B456_003G065000                  55.5    5e-06   Gossypium raimondii
gb|KJB18685.1|  hypothetical protein B456_003G065000                  55.5    6e-06   Gossypium raimondii
gb|ACU23197.1|  unknown                                               54.7    6e-06   Glycine max [soybeans]
ref|XP_009784620.1|  PREDICTED: uncharacterized protein LOC104233...  55.1    6e-06   Nicotiana sylvestris
ref|NP_001061712.1|  Os08g0387200                                     55.1    7e-06   
ref|XP_004504240.1|  PREDICTED: uncharacterized protein LOC101507...  54.7    9e-06   
ref|XP_004504239.1|  PREDICTED: uncharacterized protein LOC101507...  54.7    1e-05   Cicer arietinum [garbanzo]
gb|KHN06459.1|  hypothetical protein glysoja_010803                   54.3    1e-05   Glycine soja [wild soybean]
ref|XP_006369186.1|  hypothetical protein POPTR_0001s18380g           54.3    1e-05   
ref|XP_004509250.1|  PREDICTED: uncharacterized protein LOC101512581  53.9    1e-05   Cicer arietinum [garbanzo]
gb|KDO79522.1|  hypothetical protein CISIN_1g011797mg                 53.9    2e-05   Citrus sinensis [apfelsine]
ref|XP_004498483.1|  PREDICTED: uncharacterized protein LOC101508...  53.5    2e-05   
ref|XP_004498484.1|  PREDICTED: uncharacterized protein LOC101508...  53.5    2e-05   Cicer arietinum [garbanzo]
ref|XP_006359451.1|  PREDICTED: uncharacterized protein LOC102590...  53.5    2e-05   Solanum tuberosum [potatoes]
ref|XP_006359480.1|  PREDICTED: uncharacterized protein LOC102600300  53.5    2e-05   
ref|XP_011072363.1|  PREDICTED: uncharacterized protein LOC105157640  53.1    3e-05   Sesamum indicum [beniseed]
ref|XP_009613204.1|  PREDICTED: uncharacterized protein LOC104106373  52.8    4e-05   Nicotiana tomentosiformis
ref|XP_007159528.1|  hypothetical protein PHAVU_002G2450000g          52.4    5e-05   Phaseolus vulgaris [French bean]
ref|XP_010314281.1|  PREDICTED: uncharacterized protein LOC101268...  52.0    7e-05   
ref|XP_008783526.1|  PREDICTED: uncharacterized protein LOC103702749  51.2    1e-04   
ref|XP_002298219.2|  hypothetical protein POPTR_0001s18390g           50.4    2e-04   
ref|XP_007159523.1|  hypothetical protein PHAVU_002G244700g           50.4    3e-04   Phaseolus vulgaris [French bean]
gb|EYU21457.1|  hypothetical protein MIMGU_mgv1a005411mg              50.4    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_007159577.1|  hypothetical protein PHAVU_002G249100g           50.1    3e-04   Phaseolus vulgaris [French bean]
ref|XP_004305285.1|  PREDICTED: uncharacterized protein LOC101291...  50.1    3e-04   Fragaria vesca subsp. vesca
ref|XP_009777896.1|  PREDICTED: uncharacterized protein LOC104227...  50.1    3e-04   Nicotiana sylvestris
ref|XP_009777900.1|  PREDICTED: uncharacterized protein LOC104227...  50.1    3e-04   Nicotiana sylvestris
ref|XP_009777901.1|  PREDICTED: uncharacterized protein LOC104227...  49.7    4e-04   Nicotiana sylvestris
ref|XP_009777905.1|  PREDICTED: uncharacterized protein LOC104227...  49.7    4e-04   Nicotiana sylvestris
ref|XP_011466694.1|  PREDICTED: uncharacterized protein LOC101294...  49.7    4e-04   Fragaria vesca subsp. vesca
ref|XP_011009831.1|  PREDICTED: uncharacterized protein LOC105114838  49.3    5e-04   Populus euphratica
ref|XP_009353615.1|  PREDICTED: uncharacterized protein LOC103944864  49.3    6e-04   
ref|XP_008342674.1|  PREDICTED: uncharacterized protein LOC103405448  48.9    8e-04   
gb|KHN06457.1|  hypothetical protein glysoja_010801                   48.5    0.001   Glycine soja [wild soybean]



>ref|XP_009783706.1| PREDICTED: uncharacterized protein LOC104232253 [Nicotiana sylvestris]
Length=478

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 81/94 (86%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAGV GK ++LRPL+SISWSFLLAA+FVSAERSLK+EAI   N T+ SD DYLS   NFL
Sbjct  1    MAGVGGKLKILRPLLSISWSFLLAAIFVSAERSLKREAIA-QNATELSDADYLSTVVNFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P+ESGY HVWP+MKF W+IV+G+IIGFLGAAF
Sbjct  60   WKPNESGYHHVWPDMKFGWQIVVGTIIGFLGAAF  93



>ref|XP_009627765.1| PREDICTED: uncharacterized protein LOC104118259 [Nicotiana tomentosiformis]
Length=478

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 80/94 (85%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAGV GK ++ RPL+SISWSFLLAA+FVSAERSL++EAI  S  T+ SD DYLS   NFL
Sbjct  1    MAGVGGKLKIFRPLLSISWSFLLAAIFVSAERSLRREAIAQS-ATELSDADYLSTVVNFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P+ESGY HVWP+MKF W+IVLG++IGFLGAAF
Sbjct  60   WKPNESGYHHVWPDMKFGWQIVLGTLIGFLGAAF  93



>ref|XP_006366207.1| PREDICTED: uncharacterized protein LOC102587808 isoform X1 [Solanum 
tuberosum]
Length=476

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAGV  +W++ RPL+SISWSFLLAA+FVSAERSLKKE +   N T  SD D L++   FL
Sbjct  1    MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P+ESGY+HVWPEMKF W+I++GSIIGFLGAAF
Sbjct  60   WKPNESGYQHVWPEMKFGWQIIVGSIIGFLGAAF  93



>ref|XP_006366208.1| PREDICTED: uncharacterized protein LOC102587808 isoform X2 [Solanum 
tuberosum]
Length=474

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAGV  +W++ RPL+SISWSFLLAA+FVSAERSLKKE +   N T  SD D L++   FL
Sbjct  1    MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P+ESGY+HVWPEMKF W+I++GSIIGFLGAAF
Sbjct  60   WKPNESGYQHVWPEMKFGWQIIVGSIIGFLGAAF  93



>ref|XP_004245262.1| PREDICTED: uncharacterized protein LOC101258883 [Solanum lycopersicum]
Length=476

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAGV  +W++ RPL+SISWSFLLAA+FVSAERSLKKE +   N T  SD D L++   FL
Sbjct  1    MAGVGSRWKVFRPLLSISWSFLLAAIFVSAERSLKKEIVA-QNATHQSDADLLTSVVQFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P ESGY+HVWP+MKF W+I++GSIIGFLGAAF
Sbjct  60   WKPDESGYQHVWPDMKFGWEIIVGSIIGFLGAAF  93



>ref|XP_009791161.1| PREDICTED: uncharacterized protein LOC104238494 [Nicotiana sylvestris]
Length=483

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAI-GGSNVTDYSDVDYLSAFTNF  432
            MAGV  +W++ RPL+SISWSFLLAA+FVSAERSLK+E I   +     SD +YL+   NF
Sbjct  1    MAGVGTRWKIFRPLLSISWSFLLAAIFVSAERSLKREQIYNNATHQQQSDANYLTDVVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LW+P+ESGY+HVWP+MKF WKIV+GSIIGFLGAAF
Sbjct  61   LWKPNESGYQHVWPDMKFGWKIVVGSIIGFLGAAF  95



>ref|XP_006340268.1| PREDICTED: uncharacterized protein LOC102587334 [Solanum tuberosum]
Length=477

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAG  GK ++LRP++SI WSFLLAA+FVSAER +K+E I   N  + SD DYLSA  NFL
Sbjct  1    MAGFGGKLKILRPVLSILWSFLLAAIFVSAERRIKREVIE-QNAAELSDADYLSAVANFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P+ESGY+HVWP+MKF W+IVLGS IGFLGAAF
Sbjct  60   WKPNESGYQHVWPDMKFGWQIVLGSTIGFLGAAF  93



>ref|XP_009623066.1| PREDICTED: uncharacterized protein LOC104114346 [Nicotiana tomentosiformis]
Length=483

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAI-GGSNVTDYSDVDYLSAFTNF  432
            MAGV  +W++ RPL+SISWSFLLAA+FVSAERSLK+E     +     SD +YL+   NF
Sbjct  1    MAGVGTRWKIFRPLLSISWSFLLAAIFVSAERSLKREQTYNNATHQQQSDANYLTDVVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LW+P+ESGY+HVWP+MKF WKI++GSIIGFLGAAF
Sbjct  61   LWKPNESGYQHVWPDMKFGWKIIVGSIIGFLGAAF  95



>ref|XP_010313606.1| PREDICTED: uncharacterized protein LOC101255958 [Solanum lycopersicum]
Length=477

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M G  GK+++LRP++SI WSFLLAAVFVSAER +K+E I   N  + SD DYLSA  NFL
Sbjct  1    MEGFGGKFKILRPVLSILWSFLLAAVFVSAERRIKREVIE-QNAAELSDADYLSAVANFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P++SGY+HVWP+MKF W+IVLGS IGFLGAAF
Sbjct  60   WRPNKSGYQHVWPDMKFGWQIVLGSTIGFLGAAF  93



>ref|XP_011081835.1| PREDICTED: uncharacterized protein LOC105164774 [Sesamum indicum]
Length=480

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    KW+   P  ++ WSFLLA++FVSAERSLK+E++  S   D SD D+LS F NF+
Sbjct  1    MARNLEKWKAFGPFFTVLWSFLLASIFVSAERSLKQESLSRSAAHD-SDSDFLSTFVNFI  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ ++SGY HVWP++KF+W+IV+GSIIGF GAAF
Sbjct  60   WQANKSGYHHVWPDLKFNWQIVVGSIIGFFGAAF  93



>gb|EYU21883.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=477

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNV-TDYSDVDYLSAFTNF  432
            MAG   +W+   P  ++ WSFLLA++FVSAERSLKKE      + T  SD D L++  NF
Sbjct  1    MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKEYSSRIAIETRDSDSDILTSVVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQ + SGY HVWP++KF+WKIV+GSIIGFLGAAF
Sbjct  61   LWQGNNSGYHHVWPDLKFNWKIVVGSIIGFLGAAF  95



>gb|EYU21882.1| hypothetical protein MIMGU_mgv1a005504mg [Erythranthe guttata]
Length=481

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNV-TDYSDVDYLSAFTNF  432
            MAG   +W+   P  ++ WSFLLA++FVSAERSLKKE      + T  SD D L++  NF
Sbjct  1    MAGNLERWKAFGPFFTVVWSFLLASIFVSAERSLKKEYSSRIAIETRDSDSDILTSVVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQ + SGY HVWP++KF+WKIV+GSIIGFLGAAF
Sbjct  61   LWQGNNSGYHHVWPDLKFNWKIVVGSIIGFLGAAF  95



>ref|XP_010249715.1| PREDICTED: uncharacterized protein LOC104592187 [Nelumbo nucifera]
Length=481

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    KW+ LR +  ++ SFLLA+VF SAERSLK  A  G+N T   + DYL    NFL
Sbjct  1    MAEAGAKWQGLRSVAMVALSFLLASVFASAERSLKHGA-SGNNGTRDGESDYLLKIINFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY+HVWPEMKF WK+++G+IIGF GAAF
Sbjct  60   WQSGESGYQHVWPEMKFGWKVIVGTIIGFCGAAF  93



>ref|XP_002309560.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
 gb|EEE93083.2| hypothetical protein POPTR_0006s25880g [Populus trichocarpa]
Length=479

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS-NVTDYSDVDYLSAFTNF  432
            MA   GKWR LR ++ +  +FLLA VFVSAER LK+EA     N T  S   Y+    NF
Sbjct  1    MAEFGGKWRGLRSVLMVLLNFLLAFVFVSAERGLKREATSTRMNETGDSVSSYVLKAVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQP   GY+HVWPEMKF W+IVLGSIIGF GAAF
Sbjct  61   LWQPDHKGYQHVWPEMKFGWQIVLGSIIGFFGAAF  95



>ref|XP_010254104.1| PREDICTED: uncharacterized protein LOC104595187 [Nelumbo nucifera]
Length=481

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 67/95 (71%), Gaps = 2/95 (2%)
 Frame = +1

Query  256  MAGVRGKWRL-LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            MAG   +W+  LR    IS  FLLA+VFVSAERSLK EA   SN T+ S  +YL    NF
Sbjct  1    MAGTGARWQAPLRMATMISLGFLLASVFVSAERSLKDEA-SRSNDTEVSLSNYLHKVANF  59

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQ   SGY+HVWP+MKF W+IVLG+IIGF GAAF
Sbjct  60   LWQSDVSGYQHVWPDMKFGWQIVLGTIIGFFGAAF  94



>ref|XP_006450629.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
 gb|ESR63869.1| hypothetical protein CICLE_v10008167mg [Citrus clementina]
Length=477

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  KW++LR +M I  +F LA V V AER LK E +   N T+  D +YL    NFL
Sbjct  1    MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLS-FNGTERQDSNYLLKAVNFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQP  SGY HVWPE+KF W+IVLG+IIGF GAAF
Sbjct  60   WQPEGSGYHHVWPELKFGWEIVLGTIIGFFGAAF  93



>ref|XP_006476094.1| PREDICTED: uncharacterized protein LOC102623437 [Citrus sinensis]
 gb|KDO79724.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=477

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  KW++LR +M I  +F LA V V AER LK E +   N T+  D +YL    NFL
Sbjct  1    MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLR-FNGTERQDSNYLLKAVNFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQP  SGY HVWPE+KF W+IVLG+IIGF GAAF
Sbjct  60   WQPEGSGYHHVWPELKFGWEIVLGTIIGFFGAAF  93



>ref|XP_002324818.2| hypothetical protein POPTR_0018s00770g [Populus trichocarpa]
 gb|EEF03383.2| hypothetical protein POPTR_0018s00770g [Populus trichocarpa]
Length=294

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGG-SNVTDYSDVDYLSAFTNF  432
            MA   GKWR L+ ++ +  +FLLA VFVSAER L +EA    ++ T  S   Y+    + 
Sbjct  1    MAEFGGKWRGLKSVLMVLINFLLAFVFVSAERGLTREATSARTDETGDSVSSYVLKAVSC  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQP + GY+HVWPEMKF W+IVLGSIIGFLGAAF
Sbjct  61   LWQPDQRGYQHVWPEMKFGWQIVLGSIIGFLGAAF  95



>ref|XP_002516571.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45912.1| conserved hypothetical protein [Ricinus communis]
Length=476

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +1

Query  271  GKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSE  450
            GKWR LR ++ +S +FLLA V VSAER +++E  G           Y     +FLWQP +
Sbjct  7    GKWRGLRSVLMVSLNFLLAFVLVSAERGMRREFTGTPQTEGEGLSTYFVKAVDFLWQPDQ  66

Query  451  SGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +GY HVWPEM+F W+IVLG+IIGF GAAF
Sbjct  67   TGYRHVWPEMRFGWQIVLGTIIGFFGAAF  95



>emb|CDP16156.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  256  MAGVRGKWRLL-RPLMSISWSFLLAAVFVSAERSLKKEA-IGGSNVTDYSDVDYLSAFTN  429
            MAG  GKW ++ RPL+ I  +FLLA++ VSAERS + EA     N T        S   N
Sbjct  1    MAGRGGKWDVVFRPLLPIVCNFLLASILVSAERSFRNEASASAQNSTGNPASANFSKLLN  60

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  +SGY+HVWPE+KF W+IV+G+IIGF GAAF
Sbjct  61   FLWQADKSGYQHVWPEIKFGWQIVVGTIIGFFGAAF  96



>ref|XP_008347683.1| PREDICTED: uncharacterized protein LOC103410796 [Malus domestica]
Length=175

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS--NVTDYSDVDYLSAFTN  429
            MA    KW+ LR +  + + F  A VFVSAER L+ E   GS  N T+ S+ +YL    N
Sbjct  1    MAAFGAKWQGLRSVAMVMFHFAAAFVFVSAERGLRHE---GSRFNGTEGSESNYLLKAVN  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  +SGY HVWPEMKF W+I++GSI+GF GAAF
Sbjct  58   FLWQSEKSGYHHVWPEMKFGWQIIVGSIVGFCGAAF  93



>ref|XP_011019654.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
 ref|XP_011019655.1| PREDICTED: uncharacterized protein LOC105122312 [Populus euphratica]
Length=479

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS-NVTDYSDVDYLSAFTNF  432
            MA   GKWR LR ++ +  +FLLA VFVSAER LK+EA     N T  S   Y+    NF
Sbjct  1    MAEFGGKWRGLRSVLVVLLNFLLAFVFVSAERGLKREATSTRMNETGDSVSSYVLKAVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQP + GY+HVWPEMKF W+IVLGSIIGF GAAF
Sbjct  61   LWQPDQKGYQHVWPEMKFGWQIVLGSIIGFFGAAF  95



>gb|KDP34212.1| hypothetical protein JCGZ_07783 [Jatropha curcas]
Length=477

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVT--DYSDVDYLSAFTN  429
            MA   GKWR LR ++ +S++ L+A + VSA+R LK+E I G  VT  + S   YL    +
Sbjct  1    MAEFGGKWRGLRSVLMVSFNILVAFMLVSADRGLKRE-ISGVQVTQEEASLSSYLVKAVD  59

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQP ++ Y+HVWP+MKF W+IVLG+IIGF GAAF
Sbjct  60   FLWQPDQTSYKHVWPDMKFGWQIVLGTIIGFFGAAF  95



>ref|XP_011026589.1| PREDICTED: uncharacterized protein LOC105127137 [Populus euphratica]
Length=479

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGG-SNVTDYSDVDYLSAFTNF  432
            MA   GKWR L+ ++ +  +FLLA VFVSAER L +EA    ++ T  S   Y     +F
Sbjct  1    MAEFGGKWRGLKSVLMVLINFLLAFVFVSAERGLTREATSARTDETGDSVSSYALKAVSF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQP + GY+HVWPEMKF W+IVLGS IGFL AAF
Sbjct  61   LWQPDQQGYQHVWPEMKFGWQIVLGSTIGFLSAAF  95



>ref|XP_002284175.1| PREDICTED: uncharacterized protein LOC100267889 [Vitis vinifera]
 emb|CBI20891.3| unnamed protein product [Vitis vinifera]
Length=478

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 65/96 (68%), Gaps = 7/96 (7%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYS--DVDYLSAFTN  429
            MAG   KW +L     I  SF+LA+ FVS ERS+K EA    NVT  +  + +YLS   N
Sbjct  1    MAGFATKWLMLM----ILCSFMLASAFVSGERSIKHEA-STFNVTKEAGFNSNYLSKVVN  55

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ   SGY+HVWPEM+F W+IV+GS+IGF GAAF
Sbjct  56   FLWQSDRSGYQHVWPEMEFGWQIVVGSVIGFFGAAF  91



>emb|CAN61520.1| hypothetical protein VITISV_033969 [Vitis vinifera]
Length=382

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYS--DVDYLSAFTNFLWQPSESGYEHVWPE  477
            I WSF+LA+ FVS ERS+K EA    NVT  +  + +YLS   NFLWQ   SGY+HVWPE
Sbjct  76   IIWSFMLASAFVSGERSIKHEA-STFNVTKEAGFNSNYLSKVVNFLWQSDRSGYQHVWPE  134

Query  478  MKFDWKIVLGSIIGFLGAAF  537
            M+F W+IV+GSIIGF GAAF
Sbjct  135  MEFGWQIVVGSIIGFFGAAF  154



>ref|XP_008795085.1| PREDICTED: uncharacterized protein LOC103710932 [Phoenix dactylifera]
Length=411

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +1

Query  265  VRGKWRL--LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDV---DYLSAFTN  429
            + GKWR   L P++ I  SFLL A   SAER  K EA  G +V+   ++   DYL    N
Sbjct  1    MEGKWRKKWLWPVVVICLSFLLTAAMASAERGPKSEA-SGDDVSVEEEMGASDYLLKAVN  59

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQP+ES Y HVWP M+F WKI++GSIIGF GAAF
Sbjct  60   FLWQPNESSYHHVWPPMRFGWKIIMGSIIGFFGAAF  95



>ref|XP_008347633.1| PREDICTED: uncharacterized protein LOC103410743 isoform X1 [Malus 
domestica]
Length=476

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS--NVTDYSDVDYLSAFTN  429
            MA    KW+ LR +  + + F  A VFVSAER L+ E   GS  N T+ S+ +YL    N
Sbjct  1    MAAFGAKWQGLRSVAMVMFHFAAAFVFVSAERGLRXE---GSRFNGTEGSESNYLLKAVN  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  +SGY HVWPEMKF W+I++GSI+GF GAAF
Sbjct  58   FLWQSEKSGYHHVWPEMKFGWQIIVGSIVGFCGAAF  93



>ref|XP_008799063.1| PREDICTED: uncharacterized protein LOC103713782 [Phoenix dactylifera]
Length=477

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +1

Query  268  RGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTD--YSDVDYLSAFTNFLWQ  441
            R KW  L P + +S SFLL A   SAER  K EA+G  +  +      DY+    NFLWQ
Sbjct  6    RNKW--LWPAVVMSLSFLLTAAMASAERGPKSEALGDDSFVEEEMGASDYVLKVANFLWQ  63

Query  442  PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            P+ES Y+HVWP MKF WKI++GSIIGF GAAF
Sbjct  64   PNESSYQHVWPPMKFGWKIIVGSIIGFFGAAF  95



>ref|XP_008220035.1| PREDICTED: uncharacterized protein LOC103320179 [Prunus mume]
Length=476

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  K R LR +  +  +F LA VFVSAER LK EA    N T+ S+ DYL     F 
Sbjct  1    MAVLGAKLRGLRSVSMVVLNFALAFVFVSAERGLKLEA-SRFNGTEGSESDYLLRVVTFF  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ   SGY+HVWPEMKF W+I++GSI+GF GAAF
Sbjct  60   WQSERSGYQHVWPEMKFGWQIIVGSIVGFCGAAF  93



>ref|XP_010915823.1| PREDICTED: uncharacterized protein LOC105040818 [Elaeis guineensis]
Length=475

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +1

Query  265  VRGKWRL--LRPLMSISWSFLLAAVFVSAERSLKKEAIGG--SNVTDYSDVDYLSAFTNF  432
            + GKWR   L P++ I  S LL A   SA+R  K EA+G   S   +    DYL    NF
Sbjct  1    MEGKWRKKWLWPVVVICLSVLLTAAMASADRGQKSEALGDDVSVEEEMGASDYLLKVVNF  60

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQP+ES Y+HVWP M F WKI++GSIIGFLGAAF
Sbjct  61   LWQPNESSYQHVWPPMTFGWKIIVGSIIGFLGAAF  95



>ref|XP_006833308.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
 gb|ERM98586.1| hypothetical protein AMTR_s00109p00049700 [Amborella trichopoda]
Length=477

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 62/99 (63%), Gaps = 14/99 (14%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSL-----KKEAIGGSNVTDYSDVDYLSA  420
            MA     WR  R    I + FLLA+VFVSAER+L     +KE + G         ++   
Sbjct  1    MAQTENIWRRSRDFAVILFGFLLASVFVSAERNLVLRSPEKEEMHG---------NFALK  51

Query  421  FTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
              NFLWQP++S YEHVWPEM+F W+IVLG+IIGF GAAF
Sbjct  52   LVNFLWQPNQSNYEHVWPEMEFGWRIVLGTIIGFFGAAF  90



>ref|XP_007222835.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
 gb|EMJ24034.1| hypothetical protein PRUPE_ppa005114mg [Prunus persica]
Length=476

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  K + LR +  +  +F +A VFVSAER LK EA    N T+ S+ DYL     F 
Sbjct  1    MAVLGAKLQGLRSVSMVMLNFAVAFVFVSAERGLKLEA-SRFNGTEGSESDYLLRVVTFF  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ   SGY+HVWPEMKF W+I+ GSI+GF GAAF
Sbjct  60   WQSERSGYQHVWPEMKFGWQIIAGSIVGFCGAAF  93



>ref|XP_009367912.1| PREDICTED: uncharacterized protein LOC103957476 [Pyrus x bretschneideri]
Length=475

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS--NVTDYSDVDYLSAFTN  429
            M     KW  LR +  +   F +A VFVSAER L+ E   GS  N T+ S+ +Y     N
Sbjct  1    MVAFGAKWHGLRSVAMVMLHFGVAFVFVSAERGLRLE---GSRFNGTEGSESNYFFKAVN  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  +SGY HVWPEMKF W+IV+GSI+GF GAAF
Sbjct  58   FLWQSEKSGYHHVWPEMKFGWQIVVGSIVGFCGAAF  93



>ref|XP_010049082.1| PREDICTED: uncharacterized protein LOC104437756 [Eucalyptus grandis]
 gb|KCW81533.1| hypothetical protein EUGRSUZ_C02892 [Eucalyptus grandis]
Length=477

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA  R KW   R L  +++  LLA  F SA+RS K E    S        ++LS   +FL
Sbjct  1    MASFRAKWVTCR-LSVVAFHLLLAFFFASAQRSFKHEVPALSRSEQGPLPNFLSRAVDFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ++GY+HVWPEMKF W+IV+G++IGFLGAAF
Sbjct  60   WQSDQTGYQHVWPEMKFGWQIVVGTVIGFLGAAF  93



>ref|XP_010526182.1| PREDICTED: uncharacterized protein LOC104803812 isoform X2 [Tarenaya 
hassleriana]
Length=477

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAG   KWR++R ++ I+ +F LA  FVSAER+L+ EA    +       +Y     NFL
Sbjct  1    MAGFGSKWRVMRSVVVIAVNFALAFAFVSAERNLRGEASSVDSEMQGVFHNYFLRAVNFL  60

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+    GY HVWPEM+F+W+IV+G+++GF GAAF
Sbjct  61   WKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAF  94



>ref|XP_010526181.1| PREDICTED: uncharacterized protein LOC104803812 isoform X1 [Tarenaya 
hassleriana]
Length=478

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MAG   KWR++R ++ I+ +F LA  FVSAER+L+ EA    +       +Y     NFL
Sbjct  1    MAGFGSKWRVMRSVVVIAVNFALAFAFVSAERNLRGEASSVDSEMQGVFHNYFLRAVNFL  60

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+    GY HVWPEM+F+W+IV+G+++GF GAAF
Sbjct  61   WKSDGRGYHHVWPEMEFNWEIVVGTLVGFFGAAF  94



>ref|XP_002324817.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
 gb|EEF03382.1| hypothetical protein POPTR_0018s00760g [Populus trichocarpa]
Length=474

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 67/96 (70%), Gaps = 5/96 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--YLSAFTN  429
            MA +  K+  LRP   + ++F+LA+ F+SAERS+K    G S +++  +++  YL    +
Sbjct  1    MAFLGAKFLSLRPAAILFFTFMLASAFISAERSIKH---GVSRLSEAEELEPNYLVKIIS  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  ESGY+HVWPE+ F+W+ V+G+IIGF GAAF
Sbjct  58   FLWQSDESGYQHVWPELSFNWQAVIGTIIGFFGAAF  93



>ref|XP_008393890.1| PREDICTED: uncharacterized protein LOC103456039 [Malus domestica]
 ref|XP_008352023.1| PREDICTED: uncharacterized protein LOC103415470 [Malus domestica]
Length=489

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGS--NVTDYSDVDYLSAFTN  429
            M     KW  LR +  +   F  A VFVSAER L+ E   GS  N T+ S+ +Y     N
Sbjct  1    MVAFGAKWHGLRSVAMVMLHFGAAFVFVSAERGLRLE---GSRFNGTEGSESNYFFKAVN  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ  +SGY HVWPEMKF W+IV+GSI+GF GAAF
Sbjct  58   FLWQSEKSGYHHVWPEMKFGWQIVVGSIVGFCGAAF  93



>ref|XP_011026588.1| PREDICTED: uncharacterized protein LOC105127135 [Populus euphratica]
Length=475

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  ++  LRP   + + F+LA+VF+SAERS+K E    S   +  + +YL    +FL
Sbjct  1    MAFLGARFLSLRPSAILFFIFMLASVFISAERSIKHEVSRLSEAEEL-EPNYLVKIISFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY+HVWPE+ F W+ V+G+IIGF GAAF
Sbjct  60   WQSDESGYQHVWPELSFSWQAVIGTIIGFFGAAF  93



>gb|EPS70854.1| hypothetical protein M569_03904, partial [Genlisea aurea]
Length=479

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 63/93 (68%), Gaps = 8/93 (9%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAF-----TNFLW  438
            KW+   P +++ WSFL A+++VSAERSL+    G  +  D + +    +       +FLW
Sbjct  7    KWKAFAPCLTVLWSFLCASIYVSAERSLRA---GSYSSRDSAGISSSDSDLSSSLVDFLW  63

Query  439  QPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +P ESGY HVWP+++ +WK+V+GS+IGFLGAAF
Sbjct  64   RPQESGYHHVWPDLELNWKLVVGSMIGFLGAAF  96



>ref|XP_002284423.1| PREDICTED: uncharacterized protein LOC100266912 [Vitis vinifera]
 emb|CBI36119.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFL-LAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            MAG+  KW  LR +  I  +FL +A+V VSAER+LK+E+    + +   +   ++   NF
Sbjct  1    MAGIGSKWWGLRRVALILVTFLGVASVLVSAERTLKQES-SSHDGSREVEPGLMTKIVNF  59

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LW P+ S YEHVWP+MKF W+I++G+IIGF GAAF
Sbjct  60   LWDPNLSAYEHVWPDMKFGWQIIVGTIIGFFGAAF  94



>gb|KHG04871.1| hypothetical protein F383_28778 [Gossypium arboreum]
Length=413

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +LR +M   ++F +A + VSAERSL+    G S     ++ +Y     NFL
Sbjct  1    MAKFGVKPSVLRSIMLNFFNFGVAFMLVSAERSLRN---GESVKESETNNNYFLKAINFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY HVWPEM+F+W+IVLGSIIGF GAAF
Sbjct  58   WQSDESGYHHVWPEMEFNWQIVLGSIIGFFGAAF  91



>gb|KJB54847.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
 gb|KJB54848.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=456

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +LR +M   ++F +A + VSAERSL+    G S     ++ +Y     NFL
Sbjct  1    MAKFGVKPSVLRSIMLNFFNFGVAFMLVSAERSLRN---GESVKESETNNNYFLKAINFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY HVWPEM+F+W+IVLGSIIGF GAAF
Sbjct  58   WQSDESGYHHVWPEMEFNWQIVLGSIIGFFGAAF  91



>gb|KJB54850.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=450

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +LR +M   ++F +A + VSAERSL+    G S     ++ +Y     NFL
Sbjct  1    MAKFGVKPSVLRSIMLNFFNFGVAFMLVSAERSLRN---GESVKESETNNNYFLKAINFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY HVWPEM+F+W+IVLGSIIGF GAAF
Sbjct  58   WQSDESGYHHVWPEMEFNWQIVLGSIIGFFGAAF  91



>gb|KJB54846.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=475

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +LR +M   ++F +A + VSAERSL+    G S     ++ +Y     NFL
Sbjct  1    MAKFGVKPSVLRSIMLNFFNFGVAFMLVSAERSLRN---GESVKESETNNNYFLKAINFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY HVWPEM+F+W+IVLGSIIGF GAAF
Sbjct  58   WQSDESGYHHVWPEMEFNWQIVLGSIIGFFGAAF  91



>gb|KJB54849.1| hypothetical protein B456_009G051700 [Gossypium raimondii]
Length=474

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +LR +M   ++F +A + VSAERSL+    G S     ++ +Y     NFL
Sbjct  1    MAKFGVKPSVLRSIMLNFFNFGVAFMLVSAERSLRN---GESVKESETNNNYFLKAINFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  ESGY HVWPEM+F+W+IVLGSIIGF GAAF
Sbjct  58   WQSDESGYHHVWPEMEFNWQIVLGSIIGFFGAAF  91



>ref|XP_010109461.1| hypothetical protein L484_001800 [Morus notabilis]
 gb|EXC22697.1| hypothetical protein L484_001800 [Morus notabilis]
Length=478

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M  +  + R  R    +  + LLA VFVSAER LK E     +  + S  ++L    NFL
Sbjct  1    MDAIGARRRGQRSTSMVLLNILLAFVFVSAERGLKSE-FSRLDGKEGSQSNFLQKAANFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ   SGY+HVWP+MKF W+IVLG+IIGF GAAF
Sbjct  60   WQSDASGYQHVWPDMKFGWQIVLGTIIGFFGAAF  93



>ref|XP_004291206.1| PREDICTED: uncharacterized protein LOC101310663 [Fragaria vesca 
subsp. vesca]
Length=473

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    KWR +R +  + ++F +A V + AER L+ E+    +    S  DYL    NFL
Sbjct  1    MAVFGAKWRGVRSVCMVLFNFAVAFVCIKAERGLRLES-ARFDEDSVSGNDYLFRAVNFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  + GY HVWPEMKF W+IV+GS IGF GAAF
Sbjct  60   WQSDKVGYRHVWPEMKFGWQIVVGSAIGFFGAAF  93



>ref|XP_006405251.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
 gb|ESQ46704.1| hypothetical protein EUTSA_v10000151mg [Eutrema salsugineum]
Length=478

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--YLSAFTN  429
            MA +R   R LR L+ +  +  LA  FVSAERS K +++   + T  SD    +L A  N
Sbjct  1    MAELRSNRRSLRSLIVLFLNLALAFAFVSAERSFKGKSLKFYSQTRESDEPSFFLRA-AN  59

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLW+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  60   FLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  95



>ref|XP_008228542.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
 ref|XP_008228543.1| PREDICTED: uncharacterized protein LOC103327945 [Prunus mume]
Length=479

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +1

Query  277  WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            W L R    +   FLLAA  V++ +   ++     + +D    DY     NFLWQP   G
Sbjct  9    WSLRRRAAMVVIGFLLAASVVASAQETSEQDASSYSGSDKFQPDYFDRVLNFLWQPGRLG  68

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            YEHVWPE+KFDWKIV+ ++IGF+GAAF
Sbjct  69   YEHVWPELKFDWKIVVCTVIGFIGAAF  95



>ref|XP_010429580.1| PREDICTED: uncharacterized protein LOC104714041 [Camelina sativa]
Length=475

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 8/97 (8%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSL---KKEAIGGSNVTDYSDVDYLSAFT  426
            MA ++ KW  LR ++ +  +F LA  FVSAERSL   K +  G +  + +    +L A  
Sbjct  1    MAELKSKWLGLRSVLLVFLNFALAFAFVSAERSLIKGKAQRFGSNESSSF----FLRA-V  55

Query  427  NFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            NFLW+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  56   NFLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  92



>ref|XP_010249713.1| PREDICTED: uncharacterized protein LOC104592186 [Nelumbo nucifera]
Length=480

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M+G   KW+ L+ + ++  S LL +VF SAER+LK +A       +    +YL     F+
Sbjct  1    MSGTEAKWKTLQWVATVVLSLLLVSVFASAERTLKDDASRNKGTAEVHS-NYLVQIKTFI  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ  +SGY HVWP MKF W+IVLG+IIGF GAAF
Sbjct  60   WQAGKSGYHHVWPPMKFGWEIVLGTIIGFCGAAF  93



>ref|XP_004501773.1| PREDICTED: uncharacterized protein LOC101498079 [Cicer arietinum]
Length=484

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 10/100 (10%)
 Frame = +1

Query  262  GVRGKWRLLRPLMSISWSFLLAAVFVSA------ERSLKKEAIGGSNVT--DYSDVDYLS  417
            GVR  WR ++ + SI W  LL   FVS+      ER L K  +   NVT   +   ++L+
Sbjct  5    GVR-LWRCVK-MGSILWMLLLLFCFVSSFGIVSGERRLMKIEVSSFNVTTQKHEQHNFLT  62

Query  418  AFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
               NFLWQ   SGY+HVWP+MKF W++VLGS IGF GAAF
Sbjct  63   KAVNFLWQTDGSGYQHVWPDMKFGWQLVLGSFIGFCGAAF  102



>ref|XP_007012055.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
 gb|EOY29674.1| Sulfite exporter TauE/SafE family protein [Theobroma cacao]
Length=483

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 61/94 (65%), Gaps = 5/94 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  +L+ +M    +F LA + VSAERSLK     G +  + S+ ++     NFL
Sbjct  1    MARFGVKRSVLKSIMLNLLNFALAFMLVSAERSLKN----GDSAKE-SETNFFLKAINFL  55

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  +SGY+HVWPEM+F W+IVLGSIIGF GAAF
Sbjct  56   WRSDQSGYQHVWPEMEFGWQIVLGSIIGFFGAAF  89



>ref|XP_010417351.1| PREDICTED: uncharacterized protein LOC104703106 [Camelina sativa]
Length=481

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 14/103 (14%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD---------  408
            MA ++ KW  LR ++ +  SF LA  FVSAERS  K      ++  YSD           
Sbjct  1    MAELKSKWLGLRSVILVFLSFALAFAFVSAERSFIKR----KDLRFYSDETRENNESSSF  56

Query  409  YLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +L A  NFLW+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  57   FLKA-VNFLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  98



>ref|XP_010667904.1| PREDICTED: uncharacterized protein LOC104884897 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 7/89 (8%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAE-RSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSE  450
            KW++L  +  ++ SFLL A   SAE R+L  +    S++T  +  D L+ F NF W   +
Sbjct  16   KWKILISISMVALSFLLLA---SAEKRTLNSD---NSSITTSTADDLLAQFANFFWNSDQ  69

Query  451  SGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            SGY HVWP+MKF W+IV+GS+IGF GAAF
Sbjct  70   SGYHHVWPDMKFGWQIVVGSLIGFCGAAF  98



>ref|XP_008380922.1| PREDICTED: uncharacterized protein LOC103443804 [Malus domestica]
Length=474

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 9/89 (10%)
 Frame = +1

Query  274  KWRLLR-PLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSE  450
            ++R LR   + ++   +LA++  SA+ +L+++        D +   YL+   NFLWQ   
Sbjct  8    RFRDLRWAAIVVTGVLVLASIAASAQETLQQD--------DSATQHYLNRMLNFLWQRGR  59

Query  451  SGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             GYEHVWPEMKFDW+IV+G+IIGF+GAAF
Sbjct  60   LGYEHVWPEMKFDWRIVVGTIIGFIGAAF  88



>ref|XP_002878880.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55139.1| hypothetical protein ARALYDRAFT_481426 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSL--KKEAIGGSNVTDYSDVDYLSAFTN  429
            MA +R KW  LR ++ +  +F LA  FVSAER +   K     S+ T  ++  +     N
Sbjct  1    MAKLRSKWLGLRSVIMVLINFSLAFAFVSAERRIIKGKSLRLNSDETRENESSFFLKAVN  60

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLW+  + GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  61   FLWESDQIGYRHVWPEFEFNWQIVLGTLVGFFGAAF  96



>gb|KJB07538.1| hypothetical protein B456_001G028700 [Gossypium raimondii]
Length=420

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  + R +M    +F LA + VSAERSLK    G S+    ++ +Y     +FL
Sbjct  1    MARFGIKRDVARSIMLNFINFGLAFILVSAERSLKN---GESSEESKTNDNYFVKAIHFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P +SGY HVWPEM+F+W+ VLG+ IGF GAAF
Sbjct  58   WKPDQSGYHHVWPEMEFNWQSVLGTCIGFCGAAF  91



>ref|XP_007216108.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
 gb|EMJ17307.1| hypothetical protein PRUPE_ppa018715mg [Prunus persica]
Length=439

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  277  WRLLRPLMSISWSFLLAA-VFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            W L R    +   FLLAA V  SA+ +L+++A   S  +D     Y     NFLWQP   
Sbjct  9    WSLRRRAAMVVIGFLLAASVVASAQETLEQDASSYSG-SDKFQPYYFDRVLNFLWQPGRL  67

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            GYEHVWPE+KFDW IV+G++IGF+GA+F
Sbjct  68   GYEHVWPELKFDWIIVVGTVIGFIGASF  95



>gb|KJB07537.1| hypothetical protein B456_001G028700 [Gossypium raimondii]
Length=475

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 3/94 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA    K  + R +M    +F LA + VSAERSLK    G S+    ++ +Y     +FL
Sbjct  1    MARFGIKRDVARSIMLNFINFGLAFILVSAERSLKN---GESSEESKTNDNYFVKAIHFL  57

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P +SGY HVWPEM+F+W+ VLG+ IGF GAAF
Sbjct  58   WKPDQSGYHHVWPEMEFNWQSVLGTCIGFCGAAF  91



>ref|XP_010472594.1| PREDICTED: uncharacterized protein LOC104752213 isoform X1 [Camelina 
sativa]
Length=475

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--YLSAFTN  429
            MA ++ KW  LR ++ +  +F LA  FVSAER   K   G +   D ++    +L A  N
Sbjct  1    MAELKSKWLGLRSVILVFLNFALAFAFVSAERRFIK---GKAQRFDSNESSSFFLKA-VN  56

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLW+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  57   FLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  92



>ref|XP_010472595.1| PREDICTED: uncharacterized protein LOC104752213 isoform X2 [Camelina 
sativa]
Length=472

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 6/96 (6%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--YLSAFTN  429
            MA ++ KW  LR ++ +  +F LA  FVSAER   K   G +   D ++    +L A  N
Sbjct  1    MAELKSKWLGLRSVILVFLNFALAFAFVSAERRFIK---GKAQRFDSNESSSFFLKA-VN  56

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLW+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  57   FLWESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  92



>ref|XP_009353619.1| PREDICTED: uncharacterized protein LOC103944866 [Pyrus x bretschneideri]
Length=474

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = +1

Query  277  WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            W L R  + ++   ++A++  SA+ +L+++        D +   YL+   NFLWQ    G
Sbjct  10   WGLRRAAIVVTGVLVIASIAASAQETLQQD--------DSATQHYLNRMLNFLWQKGRLG  61

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAA  534
            YEHVWPEMKF W+IV+G+IIGF+GAA
Sbjct  62   YEHVWPEMKFGWRIVVGTIIGFIGAA  87



>ref|XP_003523730.1| PREDICTED: uncharacterized protein LOC100809318 [Glycine max]
Length=472

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +1

Query  316  FLLAAVF--VSAERSLKKEAIGGSNVTDYS-DVDYLSAFTNFLWQPSESGYEHVWPEMKF  486
            F  A+VF  VSAERS+ K  +   NVT       +L+   NFLWQ  ESGY+HVWP+M+F
Sbjct  16   FCFASVFAIVSAERSIVKMEVPRFNVTSREPQQSFLTKALNFLWQSGESGYQHVWPDMEF  75

Query  487  DWKIVLGSIIGFLGAAF  537
             W+IVLG+ +GF GAAF
Sbjct  76   GWEIVLGTFVGFCGAAF  92



>ref|XP_007137180.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
 gb|ESW09174.1| hypothetical protein PHAVU_009G106400g [Phaseolus vulgaris]
Length=468

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 4/81 (5%)
 Frame = +1

Query  295  LMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWP  474
            L   +W F +A    SAERS+ K      NVT+    ++L    NFLWQ  ESGY HVWP
Sbjct  8    LFCFAWIFAMA----SAERSIMKMEGASFNVTENHAENFLMRAVNFLWQSQESGYRHVWP  63

Query  475  EMKFDWKIVLGSIIGFLGAAF  537
            ++KF W+IV+G+ +GF GAAF
Sbjct  64   DLKFGWEIVVGTFVGFCGAAF  84



>ref|XP_006833307.1| hypothetical protein AMTR_s00109p00047950 [Amborella trichopoda]
 gb|ERM98585.1| hypothetical protein AMTR_s00109p00047950 [Amborella trichopoda]
Length=451

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 56/98 (57%), Gaps = 14/98 (14%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSL-----KKEAIGGSNVTDYSDVDYLSA  420
            MA     WR  R    I + FLL ++FVSAER+L     +KE + G+      D      
Sbjct  1    MAQTENIWRRSRYFAVILFGFLLVSLFVSAERNLVHRTPEKEEMHGNLALKLID------  54

Query  421  FTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
               FLWQ + + YEHVWPEM F W+I+LGSIIGF GAA
Sbjct  55   ---FLWQQNVTNYEHVWPEMDFGWRIILGSIIGFFGAA  89



>gb|KDP37239.1| hypothetical protein JCGZ_06295 [Jatropha curcas]
Length=482

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = +1

Query  256  MAGVRGKW--RLLRPLMSISWSFL-LAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFT  426
            MAGVR +W     R L ++   FL +A++ V AE  L +E +  +N ++  +  ++    
Sbjct  1    MAGVRLQWWGLNFRSLGAVFICFLGVASIIVVAETRLNREGLV-ANESEEVESGFMLRVI  59

Query  427  NFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            NFLWQ  + GY HVWP+MKF W+IV+G+IIGF GAAF
Sbjct  60   NFLWQEGQLGYTHVWPDMKFGWRIVVGTIIGFFGAAF  96



>emb|CDX77007.1| BnaC04g38020D [Brassica napus]
Length=470

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 60/94 (64%), Gaps = 7/94 (7%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M+ +R K R LR ++ +  +F LA  FVSAER +       S+       +  S F +FL
Sbjct  1    MSELRWKCRGLRSVIVLFTNFALAFAFVSAERGIFDSKARESD-------EPPSFFLDFL  53

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  54   WEPDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  87



>ref|NP_850068.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
 gb|AAM97053.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72117.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC42374.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63445.1| At2g25737 [Arabidopsis thaliana]
 gb|AEC07746.1| Sulfite exporter TauE/SafE family protein [Arabidopsis thaliana]
Length=476

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 1/94 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M  +R KW  LR +     +F LA  FVSAER  K   +      +     +L A  NFL
Sbjct  1    MTKLRSKWLGLRSVTIFLINFSLAFAFVSAERRGKSLRLSTDETRENESSFFLKAI-NFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  + GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  60   WESDQIGYRHVWPEFEFNWQIVLGTLVGFFGAAF  93



>emb|CDY35338.1| BnaA04g15090D [Brassica napus]
Length=470

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M+ +R K R LR ++ +  +F LA  FVSAER         S+       +  S F +FL
Sbjct  1    MSELRWKCRGLRSVIVLFTNFALAFAFVSAERGFFYSKARESD-------EPPSFFLDFL  53

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  54   WEPDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  87



>ref|XP_009140696.1| PREDICTED: uncharacterized protein LOC103864686 [Brassica rapa]
Length=470

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 7/94 (7%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M+ +R K R LR ++ +  +F LA  FVSAER         S+       +  S F +FL
Sbjct  1    MSELRWKCRGLRSVIVLFTNFALAFAFVSAERGFFYSKARESD-------EPPSFFLDFL  53

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+P ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  54   WEPDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  87



>ref|XP_010048102.1| PREDICTED: uncharacterized protein LOC104436944 isoform X2 [Eucalyptus 
grandis]
Length=472

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +1

Query  268  RGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPS  447
            R +    R ++ + +  L+A VFVSA+RSL+ E++G   + +  + +Y     ++LW+ +
Sbjct  5    RTRSESFRLVLMVLFQVLVAMVFVSADRSLRLESMGLGGM-EKPESNYFLRAVDYLWKLN  63

Query  448  ESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +S Y+HVWPEM F W+IV+G++IG  GAAF
Sbjct  64   QSSYQHVWPEMSFGWRIVVGTVIGIFGAAF  93



>ref|XP_010048101.1| PREDICTED: uncharacterized protein LOC104436944 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80235.1| hypothetical protein EUGRSUZ_C01582 [Eucalyptus grandis]
Length=474

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +1

Query  268  RGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPS  447
            R +    R ++ + +  L+A VFVSA+RSL+ E++G   + +  + +Y     ++LW+ +
Sbjct  5    RTRSESFRLVLMVLFQVLVAMVFVSADRSLRLESMGLGGM-EKPESNYFLRAVDYLWKLN  63

Query  448  ESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +S Y+HVWPEM F W+IV+G++IG  GAAF
Sbjct  64   QSSYQHVWPEMSFGWRIVVGTVIGIFGAAF  93



>ref|XP_010062471.1| PREDICTED: uncharacterized protein LOC104449877 [Eucalyptus grandis]
 gb|KCW69612.1| hypothetical protein EUGRSUZ_F03030 [Eucalyptus grandis]
Length=480

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 55/87 (63%), Gaps = 4/87 (5%)
 Frame = +1

Query  277  WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            WR    ++ IS   + A+VFVSA+   +KE  G S+    S +D   A  NFLWQ  + G
Sbjct  11   WRCFAMIVIIS--LVGASVFVSAKEDGRKE--GPSSRKSESKMDLAKAVLNFLWQKGKLG  66

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y  VWPEM+F WKIV+GSIIGF GAAF
Sbjct  67   YTRVWPEMEFGWKIVVGSIIGFFGAAF  93



>ref|XP_006294138.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
 gb|EOA27036.1| hypothetical protein CARUB_v10023132mg [Capsella rubella]
Length=472

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVSAERSLKKEA---IGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            LR ++     F LA   VSAERS  KE     G S+ T   +  +L    NFLW+ ++ G
Sbjct  6    LRSVILGFLCFALAFALVSAERSFIKEKAQRFGDSDETREKESSFLIKAVNFLWESNQIG  65

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y HVWPE +F+W+IVLG+++GF GAAF
Sbjct  66   YHHVWPEFEFNWQIVLGTLVGFFGAAF  92



>ref|XP_008466240.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
 ref|XP_008466242.1| PREDICTED: uncharacterized protein LOC103503714 [Cucumis melo]
Length=471

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 52/83 (63%), Gaps = 7/83 (8%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHV  468
            R +M   ++F +    VS ER +K E   GS+     D++      NFLWQ  ++GY HV
Sbjct  13   RSMMLTMFNFAVVLALVSGERKMKLE---GSS----EDLNLFRGALNFLWQSDKTGYHHV  65

Query  469  WPEMKFDWKIVLGSIIGFLGAAF  537
            WPEM F W+IV+GS+IGF+GAAF
Sbjct  66   WPEMVFGWQIVVGSVIGFMGAAF  88



>gb|KEH35985.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=456

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  295  LMSISWSFLL---AAVFVSAERSLKKEAIGGSNVT---DYSDVDYLSAFTNFLWQPSESG  456
            + SI W  LL   + + VS ER L K  +   NVT      +  +L+   NFLW+   SG
Sbjct  6    MRSILWMMLLLFGSFLIVSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSG  65

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y+HVWPEM+F W+IVLGS IGF GAAF
Sbjct  66   YQHVWPEMEFGWQIVLGSFIGFCGAAF  92



>ref|XP_009409059.1| PREDICTED: uncharacterized protein LOC103991359 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=499

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +1

Query  346  ERSLKKEAIGGSNV-TDYSDV-DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIG  519
            +R L+ EA G   V T+   V DY+    NFLW+P ES Y+HVWP MKF W+IV+G+IIG
Sbjct  27   DRGLRPEAAGAEAVETEEVGVSDYVLKVVNFLWRPDESSYQHVWPSMKFGWEIVVGTIIG  86

Query  520  FLGAAF  537
            FLG+AF
Sbjct  87   FLGSAF  92



>ref|XP_009409060.1| PREDICTED: uncharacterized protein LOC103991359 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 2/66 (3%)
 Frame = +1

Query  346  ERSLKKEAIGGSNV-TDYSDV-DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIG  519
            +R L+ EA G   V T+   V DY+    NFLW+P ES Y+HVWP MKF W+IV+G+IIG
Sbjct  27   DRGLRPEAAGAEAVETEEVGVSDYVLKVVNFLWRPDESSYQHVWPSMKFGWEIVVGTIIG  86

Query  520  FLGAAF  537
            FLG+AF
Sbjct  87   FLGSAF  92



>ref|XP_003636476.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
Length=480

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  295  LMSISWSFLL---AAVFVSAERSLKKEAIGGSNVT---DYSDVDYLSAFTNFLWQPSESG  456
            + SI W  LL   + + VS ER L K  +   NVT      +  +L+   NFLW+   SG
Sbjct  6    MRSILWMMLLLFGSFLIVSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSG  65

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y+HVWPEM+F W+IVLGS IGF GAAF
Sbjct  66   YQHVWPEMEFGWQIVLGSFIGFCGAAF  92



>gb|KEH35984.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=419

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  295  LMSISWSFLL---AAVFVSAERSLKKEAIGGSNVTDYS---DVDYLSAFTNFLWQPSESG  456
            + SI W  LL   + + VS ER L K  +   NVT      +  +L+   NFLW+   SG
Sbjct  6    MRSILWMMLLLFGSFLIVSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSG  65

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y+HVWPEM+F W+IVLGS IGF GAAF
Sbjct  66   YQHVWPEMEFGWQIVLGSFIGFCGAAF  92



>ref|XP_003527825.1| PREDICTED: uncharacterized protein LOC100810784 [Glycine max]
 gb|KHN18202.1| hypothetical protein glysoja_025092 [Glycine soja]
Length=477

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +1

Query  301  SISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--YLSAFTNFLWQPSESGYEHVWP  474
            ++ + F      V++ERS+ K  +   NVT   +    +L+   NFLWQ  ESGY+HVWP
Sbjct  13   TVLFCFASVVAIVASERSIMKMEVARFNVTTSREPQQSFLTKALNFLWQSGESGYQHVWP  72

Query  475  EMKFDWKIVLGSIIGFLGAAF  537
            +M+F W+IV+G+ +GF GAAF
Sbjct  73   DMEFGWQIVVGTFVGFCGAAF  93



>ref|XP_003636475.1| hypothetical protein MTR_042s0018 [Medicago truncatula]
 gb|KEH35983.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  295  LMSISWSFLL---AAVFVSAERSLKKEAIGGSNVT---DYSDVDYLSAFTNFLWQPSESG  456
            + SI W  LL   + + VS ER L K  +   NVT      +  +L+   NFLW+   SG
Sbjct  6    MRSILWMMLLLFGSFLIVSGERKLVKIQLPSFNVTTQPQKHEQSFLTKAVNFLWKSDGSG  65

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Y+HVWPEM+F W+IVLGS IGF GAAF
Sbjct  66   YQHVWPEMEFGWQIVLGSFIGFCGAAF  92



>ref|XP_010048100.1| PREDICTED: uncharacterized protein LOC104436943 [Eucalyptus grandis]
 gb|KCW80234.1| hypothetical protein EUGRSUZ_C01581 [Eucalyptus grandis]
Length=480

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 1/89 (1%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD-YLSAFTNFLWQPSE  450
            +WR LR +  I  +   A +  SAER LK +    S V D   V  +LS   NFLWQ   
Sbjct  8    QWRGLRSVAVIFVNLAFALLLASAERGLKLKDEPSSRVVDGPPVPGFLSRAANFLWQSDG  67

Query  451  SGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             GY+HVWPEM+  W+IV+GSI+GFLGAAF
Sbjct  68   GGYQHVWPEMELGWQIVVGSIVGFLGAAF  96



>gb|KHN42580.1| hypothetical protein glysoja_042801 [Glycine soja]
Length=469

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +1

Query  331  VFVSAERSLKKEAIGGSNVTDYSDV---DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIV  501
            VFV  +R++ K  + G  + D S      ++S   NFLWQP ESGY+HVWP+M+F W+I+
Sbjct  17   VFVWGDRTILK--VEGPMLLDNSQRYEGSFISKAVNFLWQPGESGYQHVWPDMEFGWQII  74

Query  502  LGSIIGFLGAAF  537
            LG+I+GF GAAF
Sbjct  75   LGTIVGFFGAAF  86



>emb|CDO98032.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 7/88 (8%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            KW+ LRP+  ++  +L+AAV VSAE  + ++ I  +N T           +N+LWQ    
Sbjct  8    KWKNLRPIAGVAIVYLVAAVVVSAEH-IPEQVISENNGTAKVYA------SNYLWQNGVM  60

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             Y HVWPEMKF W+IV+G++IGF  AA 
Sbjct  61   NYRHVWPEMKFSWQIVVGTVIGFFAAAL  88



>ref|XP_010691331.1| PREDICTED: uncharacterized protein LOC104904681 [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
            FLL  VFVSA     KE        +  +V  L    NFLWQ  ++ YEHVWPE++FDW+
Sbjct  19   FLL--VFVSANEETLKEVASAEIEMEEIEVSLLRKTINFLWQSGQNTYEHVWPELEFDWR  76

Query  496  IVLGSIIGFLGAAF  537
            IV+GS+IGF GA+F
Sbjct  77   IVVGSLIGFFGASF  90



>ref|XP_004136295.1| PREDICTED: uncharacterized protein LOC101214783 [Cucumis sativus]
 gb|KGN60205.1| hypothetical protein Csa_3G889130 [Cucumis sativus]
Length=471

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHV  468
            R +    ++F +    VS ER +K E   GS+     D++      NFLWQ  ++GY HV
Sbjct  13   RSMALTMFNFAVVLALVSGERKMKLE---GSS----EDLNLFQGALNFLWQSDKTGYHHV  65

Query  469  WPEMKFDWKIVLGSIIGFLGAAF  537
            WPEM F W+IV+GS+IGF+GAAF
Sbjct  66   WPEMAFGWQIVVGSVIGFMGAAF  88



>emb|CDY70121.1| BnaC03g72820D [Brassica napus]
Length=463

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M+ +R   R LR +  +  +  LA  FVSAER LK               D  +  T+FL
Sbjct  1    MSQIRCNSRGLRSVTVLFLNLALAFAFVSAERILK--------------FDSQTRETSFL  46

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  ++GY HVWPE +F+W+IVLG+++GF GAAF
Sbjct  47   WESDQTGYHHVWPEFEFNWQIVLGTLVGFFGAAF  80



>ref|XP_004168635.1| PREDICTED: uncharacterized LOC101214783 [Cucumis sativus]
Length=471

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHV  468
            R +    ++F +    VS ER +K E   GS+     D++      NFLWQ  ++GY HV
Sbjct  13   RSMALTMFNFAVVLALVSGERKMKLE---GSS----EDLNLFQGALNFLWQSDKTGYHHV  65

Query  469  WPEMKFDWKIVLGSIIGFLGAAF  537
            WPEM F W+IV+GS+IGF+GAAF
Sbjct  66   WPEMAFGWQIVVGSVIGFMGAAF  88



>ref|XP_007161546.1| hypothetical protein PHAVU_001G078500g [Phaseolus vulgaris]
 gb|ESW33540.1| hypothetical protein PHAVU_001G078500g [Phaseolus vulgaris]
Length=376

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDW  492
             F    VFV  +R ++       N   Y +  + +   NFLWQ  ESGY+HVWPE++F W
Sbjct  11   QFASVMVFVWGDRGIRMV----ENTQKYEEDSFFNKAMNFLWQSGESGYQHVWPEIEFGW  66

Query  493  KIVLGSIIGFLGAAF  537
            +I+LG+IIGF GAAF
Sbjct  67   RIILGTIIGFFGAAF  81



>ref|XP_003611976.1| Membrane protein-like protein [Medicago truncatula]
 ref|XP_003636269.1| Membrane protein-like protein [Medicago truncatula]
 gb|AES94934.1| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=470

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 6/85 (7%)
 Frame = +1

Query  295  LMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYE  462
            +++ +W  +   V +     AER LK++    +   +     +L A  +FLW+  +S YE
Sbjct  13   VIAATWLIMCILVMICNVSLAERVLKEKE--PAKFVEKETKGFLKAMVDFLWESGKSSYE  70

Query  463  HVWPEMKFDWKIVLGSIIGFLGAAF  537
             VWPEMKFDWKI++GSIIGFLGAA 
Sbjct  71   PVWPEMKFDWKIIVGSIIGFLGAAL  95



>ref|XP_008792340.1| PREDICTED: uncharacterized protein LOC103708984 [Phoenix dactylifera]
Length=478

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 12/96 (13%)
 Frame = +1

Query  271  GKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD-------YLSAFTN  429
            G+WR L   +  ++ F LA+  VSAER LK   IGG  + D    D       YL     
Sbjct  3    GRWRRLGTWVVGAFGFFLASAVVSAERGLK---IGG--LLDDVSADGETFVFSYLLKAVG  57

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            FLWQ   S Y HVWP M+F W++V+GS+IGF GAAF
Sbjct  58   FLWQADGSYYHHVWPPMEFGWRLVIGSLIGFFGAAF  93



>ref|XP_004512029.1| PREDICTED: uncharacterized protein LOC101496928 isoform X2 [Cicer 
arietinum]
Length=523

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK++    +N  +      L A  +FLW+   S YE VWPEMKFDWKI++GSI+GF
Sbjct  85   AERVLKEKE-QSANFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  523  LGAAF  537
            LGAA 
Sbjct  144  LGAAL  148



>ref|XP_004512031.1| PREDICTED: uncharacterized protein LOC101496928 isoform X4 [Cicer 
arietinum]
Length=522

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK++    +N  +      L A  +FLW+   S YE VWPEMKFDWKI++GSI+GF
Sbjct  85   AERVLKEKE-QSANFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  523  LGAAF  537
            LGAA 
Sbjct  144  LGAAL  148



>ref|XP_004512028.1| PREDICTED: uncharacterized protein LOC101496928 isoform X1 [Cicer 
arietinum]
Length=524

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK++    +N  +      L A  +FLW+   S YE VWPEMKFDWKI++GSI+GF
Sbjct  85   AERVLKEKE-QSANFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  523  LGAAF  537
            LGAA 
Sbjct  144  LGAAL  148



>ref|XP_004512030.1| PREDICTED: uncharacterized protein LOC101496928 isoform X3 [Cicer 
arietinum]
Length=523

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK++    +N  +      L A  +FLW+   S YE VWPEMKFDWKI++GSI+GF
Sbjct  85   AERVLKEKE-QSANFVEKERQGVLKAMIDFLWENGRSSYEPVWPEMKFDWKIIVGSIVGF  143

Query  523  LGAAF  537
            LGAA 
Sbjct  144  LGAAL  148



>gb|KJB43509.1| hypothetical protein B456_007G203800 [Gossypium raimondii]
Length=469

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVS---AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            LR L  ++W   L  V      AER LK +     N  +           NFLWQ  +S 
Sbjct  8    LRGLAMVAWILFLVLVMSDVGIAERQLKHK----RNQENEETQGLFVRVANFLWQDGKSA  63

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            YE VWPEMKF WKIV+GSI+GFLGAA 
Sbjct  64   YEPVWPEMKFGWKIVVGSIVGFLGAAL  90



>gb|KDO79723.1| hypothetical protein CISIN_1g011811mg [Citrus sinensis]
Length=425

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA +  KW++LR +M I  +F LA V V AER LK E +   N T+  D +YL    NFL
Sbjct  1    MADLGAKWKILRSVMMIFLNFALAFVCVKAERGLKIETLR-FNGTERQDSNYLLKAVNFL  59

Query  436  WQPSESGYEHVWP  474
            WQP  SGY HVWP
Sbjct  60   WQPEGSGYHHVWP  72



>ref|XP_009403528.1| PREDICTED: uncharacterized protein LOC103987063 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = +1

Query  346  ERSLKKEAIGGSNVTDYSDV---DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSII  516
            +R LK E    ++V    +V   DY+    +FLWQP +S Y+HVWP MK  W+IV+G+II
Sbjct  27   DRGLKPEE-AAADVVAVEEVGLSDYVLKVVDFLWQPDKSSYQHVWPPMKLGWQIVVGTII  85

Query  517  GFLGAAF  537
            GFLG+AF
Sbjct  86   GFLGSAF  92



>ref|XP_009403527.1| PREDICTED: uncharacterized protein LOC103987063 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=475

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (6%)
 Frame = +1

Query  346  ERSLKKEAIGGSNVTDYSDV---DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSII  516
            +R LK E    ++V    +V   DY+    +FLWQP +S Y+HVWP MK  W+IV+G+II
Sbjct  27   DRGLKPEE-AAADVVAVEEVGLSDYVLKVVDFLWQPDKSSYQHVWPPMKLGWQIVVGTII  85

Query  517  GFLGAAF  537
            GFLG+AF
Sbjct  86   GFLGSAF  92



>ref|XP_006596174.1| PREDICTED: uncharacterized protein LOC100781779 isoform X2 [Glycine 
max]
Length=416

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEH  465
            +R ++  S++FLL  VF+SA  S K E    S+  +     Y      F+W+    GY+H
Sbjct  1    MRHVVIFSFNFLLLCVFISAITSTKSEV---SSTNEEQSFSYHIKALEFIWK--HLGYQH  55

Query  466  VWPEMKFDWKIVLGSIIGFLGAAF  537
            VWPEM+F W+IV+G++IG LGAAF
Sbjct  56   VWPEMEFSWRIVVGTLIGILGAAF  79



>ref|XP_006596173.1| PREDICTED: uncharacterized protein LOC100781779 isoform X1 [Glycine 
max]
Length=433

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEH  465
            +R ++  S++FLL  VF+SA  S K E    S+  +     Y      F+W+    GY+H
Sbjct  1    MRHVVIFSFNFLLLCVFISAITSTKSEV---SSTNEEQSFSYHIKALEFIWK--HLGYQH  55

Query  466  VWPEMKFDWKIVLGSIIGFLGAAF  537
            VWPEM+F W+IV+G++IG LGAAF
Sbjct  56   VWPEMEFSWRIVVGTLIGILGAAF  79



>ref|XP_008338104.1| PREDICTED: uncharacterized protein LOC103401168 isoform X1 [Malus 
domestica]
Length=486

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGG-SNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFD  489
            + L+     SA+R L+ E I    +V   +   +     NFLWQ   S Y+ VWPEMKFD
Sbjct  29   NLLIITEVASADRPLRDEIIKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  490  WKIVLGSIIGFLGAAF  537
            WKIV+GSI+GF GAA 
Sbjct  89   WKIVVGSIVGFFGAAL  104



>ref|XP_009371583.1| PREDICTED: uncharacterized protein LOC103960817 isoform X2 [Pyrus 
x bretschneideri]
Length=484

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 3/77 (4%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDV--DYLSAFTNFLWQPSESGYEHVWPEMKF  486
            + L+     SA+R L+ E I         D+   +     NFLWQ   S Y+ VWPEMKF
Sbjct  29   NLLIITEVASADRPLRDEIIKPEKFVQ-KDIHESFFVRVVNFLWQAGGSSYQPVWPEMKF  87

Query  487  DWKIVLGSIIGFLGAAF  537
            DWKIVLGSI+GF GAA 
Sbjct  88   DWKIVLGSIVGFFGAAL  104



>ref|XP_008338105.1| PREDICTED: uncharacterized protein LOC103401168 isoform X2 [Malus 
domestica]
Length=484

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGG-SNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFD  489
            + L+     SA+R L+ E I    +V   +   +     NFLWQ   S Y+ VWPEMKFD
Sbjct  29   NLLIITEVASADRPLRDEIIKPEKSVQKDTHESFFVRVVNFLWQAGGSSYQPVWPEMKFD  88

Query  490  WKIVLGSIIGFLGAAF  537
            WKIV+GSI+GF GAA 
Sbjct  89   WKIVVGSIVGFFGAAL  104



>gb|KHN04837.1| hypothetical protein glysoja_047520 [Glycine soja]
Length=448

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEH  465
            +R ++  S++FLL  VF+SA  S K E    S+  +     Y      F+W+    GY+H
Sbjct  1    MRHVVIFSFNFLLLCVFISAITSTKSEV---SSTNEEQSFSYHIKALEFIWK--HLGYQH  55

Query  466  VWPEMKFDWKIVLGSIIGFLGAAF  537
            VWPEM+F W+IV+G++IG LGAAF
Sbjct  56   VWPEMEFSWRIVVGTLIGILGAAF  79



>ref|XP_009371582.1| PREDICTED: uncharacterized protein LOC103960817 isoform X1 [Pyrus 
x bretschneideri]
Length=486

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 3/77 (4%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDV--DYLSAFTNFLWQPSESGYEHVWPEMKF  486
            + L+     SA+R L+ E I         D+   +     NFLWQ   S Y+ VWPEMKF
Sbjct  29   NLLIITEVASADRPLRDEIIKPEKFVQ-KDIHESFFVRVVNFLWQAGGSSYQPVWPEMKF  87

Query  487  DWKIVLGSIIGFLGAAF  537
            DWKIVLGSI+GF GAA 
Sbjct  88   DWKIVLGSIVGFFGAAL  104



>gb|ACU18117.1| unknown [Glycine max]
Length=114

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  328  AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLG  507
            +V VSA + +  + I  + V + +   +L    NFLW  S SGY+H WP+++F W+I+ G
Sbjct  24   SVSVSALQHVSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  508  SIIGFLGAAF  537
            +IIGFLG+AF
Sbjct  83   TIIGFLGSAF  92



>ref|XP_009381051.1| PREDICTED: uncharacterized protein LOC103969282 [Musa acuminata 
subsp. malaccensis]
Length=475

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            DY+    +FLW+P ES Y HVWP MKF W+IV+GSIIGFLG+AF
Sbjct  50   DYVLKVVDFLWRPDESSYRHVWPPMKFGWEIVVGSIIGFLGSAF  93



>gb|KCW58608.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=319

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  310  WSFLLAAVFVS-----AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWP  474
            W  L  ++ +S     AER L  + +    V D +   +L    NFLWQ  +S YE VWP
Sbjct  21   WFLLFTSLIISGHAARAERPLLHDKVLEVPVEDTARPGFLVRAVNFLWQIGKSSYEPVWP  80

Query  475  EMKFDWKIVLGSIIGFLGAAF  537
            EM+F WK+V+GSIIGF GAA 
Sbjct  81   EMEFGWKLVVGSIIGFFGAAL  101



>ref|XP_002521607.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40878.1| conserved hypothetical protein [Ricinus communis]
Length=478

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 1/69 (1%)
 Frame = +1

Query  334  FVSAERSLKKEAIGGSNVTDY-SDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGS  510
            F SAER L KE      + D+  +  +L    +FLWQ  +S YE VWPEM+F++KIV+G+
Sbjct  32   FTSAERLLFKEQNHTKVLVDHEKEKSFLQKAAHFLWQSGKSSYEPVWPEMEFNYKIVVGT  91

Query  511  IIGFLGAAF  537
            I+GFLGAA 
Sbjct  92   IVGFLGAAL  100



>ref|XP_002516035.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46455.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +1

Query  376  GSNVTDYSDVD--YLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            GS+  +  DV+  +L    NFLWQ  + GY HVWP+MKF W+IV+GSIIGF GAAF
Sbjct  41   GSSDRNSEDVESAFLMRVVNFLWQKGQLGYTHVWPDMKFGWQIVVGSIIGFFGAAF  96



>ref|XP_008241663.1| PREDICTED: uncharacterized protein LOC103340075 [Prunus mume]
Length=482

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAF----TNFLWQPSESGYEHVWPEM  480
            + L+ +   SAER LK E       T + + D   AF     NFLWQ   S Y+ VWPEM
Sbjct  29   NLLMTSEVASAERPLKDE-----KPTKFIEQDIHEAFFVKVVNFLWQAGGSSYQPVWPEM  83

Query  481  KFDWKIVLGSIIGFLGAAF  537
            KF WKIV+GSI+GF GAA 
Sbjct  84   KFGWKIVVGSIVGFFGAAL  102



>ref|XP_007202022.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
 gb|EMJ03221.1| hypothetical protein PRUPE_ppa004997mg [Prunus persica]
Length=482

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAF----TNFLWQPSESGYEHVWPEM  480
            + L+ +   SAER LK E       T + + D   AF     NFLWQ   S Y+ VWPEM
Sbjct  29   NLLMTSEVASAERPLKDE-----KPTKFIEQDIHEAFFVKVVNFLWQAGGSSYQPVWPEM  83

Query  481  KFDWKIVLGSIIGFLGAAF  537
            KF WKIV+GSI+GF GAA 
Sbjct  84   KFGWKIVVGSIVGFFGAAL  102



>gb|KHN36120.1| hypothetical protein glysoja_003243 [Glycine soja]
Length=441

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            A+R LK++ +G     +   +  L A  NFLW+  +S YE VWP MKF W+I++GSIIGF
Sbjct  32   ADRILKEKELGNDVPKERQGI--LKAIVNFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  523  LGAAF  537
            LGAA 
Sbjct  90   LGAAL  94



>gb|KDP38300.1| hypothetical protein JCGZ_05186 [Jatropha curcas]
Length=469

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +1

Query  298  MSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPE  477
            M I +  ++   F +AER LK++      V    +  +L    +FLWQ  +S Y+ VWPE
Sbjct  14   MVIFFGLMVMGSFTNAERLLKEQK-PKILVEKEMEPSFLQKMAHFLWQSGKSSYDPVWPE  72

Query  478  MKFDWKIVLGSIIGFLGAAF  537
            M+F WKIV+GSI+GFLGAA 
Sbjct  73   MEFGWKIVVGSIVGFLGAAL  92



>gb|KJB40205.1| hypothetical protein B456_007G050900 [Gossypium raimondii]
Length=404

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            R L  ++W+  +  V ++    AER LK E     +  +      L    +FLWQ  +S 
Sbjct  9    RGLAMVAWTVFMVLVMMTNVGLAERLLKDERNHQVSKENEKTRGLLLKVVSFLWQGGKSA  68

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            YE VWPEM+F WKIV+G+I+GFLGAA 
Sbjct  69   YEPVWPEMEFGWKIVVGTIVGFLGAAL  95



>ref|XP_003517231.1| PREDICTED: uncharacterized protein LOC100801441 [Glycine max]
Length=470

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            A+R LK++ +G     +   +  L A  NFLW+  +S YE VWP MKF W+I++GSIIGF
Sbjct  32   ADRILKEKELGNDVPKERQGI--LKAIVNFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  523  LGAAF  537
            LGAA 
Sbjct  90   LGAAL  94



>ref|XP_010070053.1| PREDICTED: uncharacterized protein LOC104456870 [Eucalyptus grandis]
 gb|KCW58607.1| hypothetical protein EUGRSUZ_H01268 [Eucalyptus grandis]
Length=481

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  310  WSFLLAAVFVS-----AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWP  474
            W  L  ++ +S     AER L  + +    V D +   +L    NFLWQ  +S YE VWP
Sbjct  21   WFLLFTSLIISGHAARAERPLLHDKVLEVPVEDTARPGFLVRAVNFLWQIGKSSYEPVWP  80

Query  475  EMKFDWKIVLGSIIGFLGAAF  537
            EM+F WK+V+GSIIGF GAA 
Sbjct  81   EMEFGWKLVVGSIIGFFGAAL  101



>gb|KJB40204.1| hypothetical protein B456_007G050900 [Gossypium raimondii]
Length=475

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            R L  ++W+  +  V ++    AER LK E     +  +      L    +FLWQ  +S 
Sbjct  9    RGLAMVAWTVFMVLVMMTNVGLAERLLKDERNHQVSKENEKTRGLLLKVVSFLWQGGKSA  68

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            YE VWPEM+F WKIV+G+I+GFLGAA 
Sbjct  69   YEPVWPEMEFGWKIVVGTIVGFLGAAL  95



>gb|KHG02837.1| ATP synthase subunit delta [Gossypium arboreum]
Length=469

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 46/87 (53%), Gaps = 7/87 (8%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVS---AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            LR L  ++W   L  V      AER LK       N  +           NFLWQ  +S 
Sbjct  8    LRGLAMVAWILSLVLVMSDVGIAERLLKHR----RNQENEETQGLFLRVANFLWQDGKSA  63

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            YE VWPEMKF WKIV+GSI+GFLGAA 
Sbjct  64   YEPVWPEMKFGWKIVVGSIVGFLGAAL  90



>ref|XP_010924740.1| PREDICTED: uncharacterized protein LOC105047500 [Elaeis guineensis]
Length=478

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 8/94 (9%)
 Frame = +1

Query  271  GKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTD-----YSDVDYLSAFTNFL  435
            G+WR +   +  ++ F LA+  VSAER  K   +      D     +SD   L     FL
Sbjct  3    GRWRRVGTSVVSAFGFFLASAVVSAERGFKIGGLLDDVSADGETFVFSD---LLKVVGFL  59

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            WQ   S Y HVWP M+F W++V+GS+IGF GAAF
Sbjct  60   WQADGSHYHHVWPPMEFGWRLVIGSLIGFFGAAF  93



>ref|XP_010113488.1| hypothetical protein L484_026823 [Morus notabilis]
 gb|EXC35515.1| hypothetical protein L484_026823 [Morus notabilis]
Length=460

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 9/81 (11%)
 Frame = +1

Query  310  WSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVD-----YLSAFTNFLWQPSESGYEHVWP  474
            +  L+    VS ER LK +     N  ++ DV+      L    +FLWQ  +S Y+HVWP
Sbjct  23   FCLLIMNEVVSGERILKDKL----NPENFVDVEEKQQGVLMRVAHFLWQSGKSSYQHVWP  78

Query  475  EMKFDWKIVLGSIIGFLGAAF  537
            EM+F WKIV+GSI+GF GAA 
Sbjct  79   EMEFGWKIVVGSIVGFFGAAL  99



>gb|KHM98753.1| hypothetical protein glysoja_030806 [Glycine soja]
Length=479

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +1

Query  298  MSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPE  477
            + +++S LL +  VSA   +  + I  +     ++  +L    NFLW  S SGYEH WPE
Sbjct  14   LVLTFSLLLISASVSALEHVNHKKIDPTT----AETSFLGKVMNFLWSSSGSGYEHTWPE  69

Query  478  MKFDWKIVLGSIIGFLGAAF  537
            ++F W+I+ G+IIGF+G+AF
Sbjct  70   IEFGWRIITGTIIGFVGSAF  89



>ref|XP_003546436.1| PREDICTED: uncharacterized protein LOC100816528 [Glycine max]
Length=476

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +1

Query  298  MSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPE  477
            + +++S LL +  VSA   +  + I  +     ++  +L    NFLW  S SGYEH WPE
Sbjct  14   LVLTFSLLLISASVSALEHVNHKKIDPTT----AETSFLGKVMNFLWSSSGSGYEHTWPE  69

Query  478  MKFDWKIVLGSIIGFLGAAF  537
            ++F W+I+ G+IIGF+G+AF
Sbjct  70   IEFGWRIITGTIIGFVGSAF  89



>gb|KHN32619.1| hypothetical protein glysoja_022301 [Glycine soja]
Length=490

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  328  AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLG  507
            +V VSA + L  + I  + V + +   +L    NFLW  S SGY+H WP+++F W+I+ G
Sbjct  24   SVSVSALQHLSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  508  SIIGFLGAAF  537
            +IIGFLG+AF
Sbjct  83   TIIGFLGSAF  92



>ref|XP_009388715.1| PREDICTED: uncharacterized protein LOC103975470 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  406  DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            DYL    +FLWQ   S Y+HVWP+MKF W+IV+GSIIGFLG+AF
Sbjct  49   DYLLKVVDFLWQSDGSSYQHVWPDMKFGWEIVVGSIIGFLGSAF  92



>gb|KHN10230.1| hypothetical protein glysoja_017834 [Glycine soja]
Length=439

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  388  TDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            T      +L+   NFLWQ  ESGY+HVWP+M+F W+IVLG+ +GF GAAF
Sbjct  10   TREPQQSFLTKALNFLWQSGESGYQHVWPDMEFGWEIVLGTFVGFCGAAF  59



>ref|XP_006659358.1| PREDICTED: uncharacterized protein LOC102716712 [Oryza brachyantha]
Length=468

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query  403  VDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAFGSV  546
            V YL    NFLWQ  ES Y HVWP M+F W+IVLG+ +GF+GAAFGS+
Sbjct  45   VSYLRKAANFLWQSDESSY-HVWPPMEFGWRIVLGTFVGFIGAAFGSI  91



>ref|XP_008363110.1| PREDICTED: uncharacterized protein LOC103426807 isoform X1 [Malus 
domestica]
Length=477

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +1

Query  340  SAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIG  519
            SAER LK E I      +   +   +   NFLWQ   S Y+ VWPEMKF WKIV+GS++G
Sbjct  32   SAERPLKDEIIKPKIFVEQEAI--FARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVG  89

Query  520  FLGAAF  537
            F GAA 
Sbjct  90   FFGAAL  95



>ref|XP_010649158.1| PREDICTED: uncharacterized protein LOC100253061 [Vitis vinifera]
 emb|CBI17534.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  340  SAERSLKKEAIGGSNVTDYS-DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSII  516
            +AER LK +     ++ + + +  +LS   +FLWQ  +S Y+HVWP+MKF WK+V+ SII
Sbjct  34   NAERLLKADDRPAEHLVNKNKEPGFLSKVVHFLWQSGKSSYQHVWPDMKFGWKLVVASII  93

Query  517  GFLGAAF  537
            GF GAA 
Sbjct  94   GFFGAAL  100



>ref|XP_008363111.1| PREDICTED: uncharacterized protein LOC103426807 isoform X2 [Malus 
domestica]
Length=475

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +1

Query  340  SAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIG  519
            SAER LK E I      +   +   +   NFLWQ   S Y+ VWPEMKF WKIV+GS++G
Sbjct  32   SAERPLKDEIIKPKIFVEQEAI--FARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVG  89

Query  520  FLGAAF  537
            F GAA 
Sbjct  90   FFGAAL  95



>ref|XP_002303288.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
 gb|EEE78267.2| hypothetical protein POPTR_0003s05180g [Populus trichocarpa]
Length=485

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +1

Query  274  KWRLLRPLM----SISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQ  441
            KWR L   M    ++  S  +A++   AE  L+K+      ++   +        NFLWQ
Sbjct  7    KWRGLSLRMIGGATLIVSLGIASMVAIAEARLRKQVSTVHGISPQVEPGLFMRVLNFLWQ  66

Query  442  PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
                GY HVWP+MKF WKIV+G+IIGF GAA 
Sbjct  67   KGLYGYTHVWPDMKFGWKIVVGTIIGFFGAAL  98



>ref|XP_006383214.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
 gb|ERP61011.1| hypothetical protein POPTR_0005s12570g [Populus trichocarpa]
Length=477

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFV----SAERSLKKEAIGGSNVTDYSDVDYLSAF  423
            MA ++   R L     ++    L  V +    SAER LK +    S   + S   Y+   
Sbjct  1    MAKIKLNQRALATTAVLTCLIFLVQVLMTNMASAERLLKDKEPEASAEKEMSP-GYIVKV  59

Query  424  TNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             +FL+Q  +S YE VWP+MKFDW+IV+G+I+GFLGAA 
Sbjct  60   LHFLFQGGKSSYEPVWPDMKFDWRIVVGTIVGFLGAAL  97



>ref|XP_003542098.1| PREDICTED: uncharacterized protein LOC100789733 isoform X1 [Glycine 
max]
Length=487

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  328  AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLG  507
            +V VSA + +  + I  + V + +   +L    NFLW  S SGY+H WP+++F W+I+ G
Sbjct  24   SVSVSALQHVSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  508  SIIGFLGAAF  537
            +IIGFLG+AF
Sbjct  83   TIIGFLGSAF  92



>ref|XP_006595132.1| PREDICTED: uncharacterized protein LOC100789733 isoform X2 [Glycine 
max]
Length=480

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = +1

Query  328  AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLG  507
            +V VSA + +  + I  + V + +   +L    NFLW  S SGY+H WP+++F W+I+ G
Sbjct  24   SVSVSALQHVSHKNINPTTV-ETTQTSFLGKVVNFLWSSSGSGYQHTWPDIEFGWRIITG  82

Query  508  SIIGFLGAAF  537
            +IIGFLG+AF
Sbjct  83   TIIGFLGSAF  92



>ref|XP_011001600.1| PREDICTED: uncharacterized protein LOC105108832 isoform X2 [Populus 
euphratica]
Length=485

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +1

Query  322  LAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIV  501
            +A++   AE  L+K+       +   +   L    NFLWQ    GY HVWP+MKF W+IV
Sbjct  27   MASMVAIAEARLRKQVSSVHGSSPQVEAGLLMRVLNFLWQKGLYGYTHVWPDMKFGWRIV  86

Query  502  LGSIIGFLGAAF  537
            +G+IIGF GAA 
Sbjct  87   VGTIIGFFGAAL  98



>ref|XP_011001598.1| PREDICTED: uncharacterized protein LOC105108832 isoform X1 [Populus 
euphratica]
Length=489

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDW  492
            S  +A++   AE  L+K+       +   +   L    NFLWQ    GY HVWP+MKF W
Sbjct  24   SLGMASMVAIAEARLRKQVSSVHGSSPQVEAGLLMRVLNFLWQKGLYGYTHVWPDMKFGW  83

Query  493  KIVLGSIIGFLGAAF  537
            +IV+G+IIGF GAA 
Sbjct  84   RIVVGTIIGFFGAAL  98



>ref|XP_009356692.1| PREDICTED: uncharacterized protein LOC103947501 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349999.1| PREDICTED: uncharacterized protein LOC103941518 isoform X2 [Pyrus 
x bretschneideri]
Length=475

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK E I      +   +   +   NFLWQ   S Y+ VWPEMKF WKIV+GS++GF
Sbjct  33   AERPLKDEIIKAEIFVEQEPI--FARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVGF  90

Query  523  LGAAF  537
             GAA 
Sbjct  91   FGAAL  95



>ref|XP_009356691.1| PREDICTED: uncharacterized protein LOC103947501 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349998.1| PREDICTED: uncharacterized protein LOC103941518 isoform X1 [Pyrus 
x bretschneideri]
Length=477

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            AER LK E I      +   +   +   NFLWQ   S Y+ VWPEMKF WKIV+GS++GF
Sbjct  33   AERPLKDEIIKAEIFVEQEPI--FARVINFLWQAGGSSYQPVWPEMKFGWKIVVGSVVGF  90

Query  523  LGAAF  537
             GAA 
Sbjct  91   FGAAL  95



>ref|XP_007156932.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
 gb|ESW28926.1| hypothetical protein PHAVU_002G029400g [Phaseolus vulgaris]
Length=470

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +1

Query  343  AERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
            A+R LK++ +G     +   V  L A  NFLW+  +S YE VWP MKF W+I++GSIIGF
Sbjct  32   ADRMLKEKELGNDGKKERQGV--LEAIANFLWEEGKSSYEPVWPNMKFGWRIIVGSIIGF  89

Query  523  LGAAF  537
             GAA 
Sbjct  90   SGAAL  94



>gb|KDO56903.1| hypothetical protein CISIN_1g0454882mg, partial [Citrus sinensis]
Length=308

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 5/94 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVF-VSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            M+GV  +W   R L S     L+ A+  VSA+ SLK EA   S   D +D +++   ++ 
Sbjct  1    MSGVGSEWCRWRLLASTFIGLLVVALLSVSAQSSLKHEATTESK-NDQADPNHVIKISS-  58

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
                S S Y+H+WP++KF WKIV+G+IIGF GAA
Sbjct  59   --PKSRSSYKHIWPDIKFGWKIVVGAIIGFFGAA  90



>emb|CDP02034.1| unnamed protein product [Coffea canephora]
Length=479

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  307  SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKF  486
             W    A+   SAER LK     G  V       ++    +FLWQ  +S Y+HVWPEM+F
Sbjct  24   CWILFTASDIGSAERLLKTVE-PGHIVEKEMRQGFIVRLVHFLWQSGKSSYQHVWPEMEF  82

Query  487  DWKIVLGSIIGFLGAAF  537
             WK+V+G+++GFLGAA 
Sbjct  83   GWKLVVGTVVGFLGAAL  99



>gb|AEI98632.1| hypothetical protein 111018.19 [Coffea canephora]
Length=465

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +1

Query  307  SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKF  486
             W    A+   SAER LK     G  V       ++    +FLWQ  +S Y+HVWPEM+F
Sbjct  24   CWILFTASDIGSAERLLKTVE-PGHIVEKEMRQGFIVRLVHFLWQSGKSSYQHVWPEMEF  82

Query  487  DWKIVLGSIIGFLGAAF  537
             WK+V+G+++GFLGAA 
Sbjct  83   GWKLVVGTVVGFLGAAL  99



>gb|ACJ85296.1| unknown [Medicago truncatula]
Length=474

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 10/81 (12%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++      AER L+ E           ++  +   T+F W   ES YE VWPEMK
Sbjct  21   VSWSLIMIYHVSLAERVLEDEK---------PEIVVMKK-TSFFWYSGESSYERVWPEMK  70

Query  484  FDWKIVLGSIIGFLGAAFGSV  546
            F W+IV+GSI+GF GAA GSV
Sbjct  71   FGWRIVVGSIVGFFGAALGSV  91



>dbj|BAJ87419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  388  TDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAFGSV  546
            T   +  YL    N LWQ   + Y HVWP +K  WKIVLGS IGF GAAFGS+
Sbjct  34   TPPGEASYLRKLANSLWQSDGTSYHHVWPPLKLGWKIVLGSFIGFFGAAFGSI  86



>ref|XP_007046968.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
 gb|EOX91125.1| DNA-directed RNA polymerase isoform 2 [Theobroma cacao]
Length=443

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 14/93 (15%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVD------YLSAFTNFLW  438
            R L  ++W   L  V +S    AER LK +     N   + D +       L    NFLW
Sbjct  9    RSLAIMAWVVFLVLVMMSNVGIAERLLKDK----RNQRVFKDNENENTRGLLVRVANFLW  64

Query  439  QPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Q  +S YE VWPE++F WKIV+GSI+GFLGAA 
Sbjct  65   QGGKSSYEPVWPELEFGWKIVVGSIVGFLGAAL  97



>ref|XP_004235668.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
 ref|XP_010318541.1| PREDICTED: uncharacterized protein LOC101262796 [Solanum lycopersicum]
Length=482

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
            FL  A+ VS ++   +  +  +  T   +  YL    N LW+ SE  Y HVWPE +F W+
Sbjct  23   FLALAIVVSGKQVPYETTLSNNGTTHSYESSYLFDLFNILWRKSEINYHHVWPEPEFGWR  82

Query  496  IVLGSIIGFLGAAF  537
            +++GS+IGF GAAF
Sbjct  83   LIVGSVIGFFGAAF  96



>ref|XP_007046967.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX91124.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=476

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 51/93 (55%), Gaps = 14/93 (15%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVD------YLSAFTNFLW  438
            R L  ++W   L  V +S    AER LK +     N   + D +       L    NFLW
Sbjct  9    RSLAIMAWVVFLVLVMMSNVGIAERLLKDK----RNQRVFKDNENENTRGLLVRVANFLW  64

Query  439  QPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            Q  +S YE VWPE++F WKIV+GSI+GFLGAA 
Sbjct  65   QGGKSSYEPVWPELEFGWKIVVGSIVGFLGAAL  97



>ref|XP_010999980.1| PREDICTED: uncharacterized protein LOC105107666 [Populus euphratica]
Length=477

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            +L A  VSAER LK +    S   + S   Y+    +FL+Q  +S YE VWP MKFDW+I
Sbjct  26   VLMANMVSAERMLKDKEPEASAEKEMSH-GYIVKVLHFLFQGGKSSYEPVWPVMKFDWRI  84

Query  499  VLGSIIGFLGAAF  537
            V+G+ +GFLGAA 
Sbjct  85   VVGTAVGFLGAAL  97



>ref|XP_009592783.1| PREDICTED: uncharacterized protein LOC104089559 isoform X3 [Nicotiana 
tomentosiformis]
Length=399

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            L  A+ VSAE+   +  +  +     +D  Y     + LW+ SE  Y HVWPE++F W++
Sbjct  14   LALAIVVSAEQIPHEATLSNNGTIHSTDSYYFFDLFSLLWKKSEMHYHHVWPELEFGWRV  73

Query  499  VLGSIIGFLGAAF  537
            ++GS+IGF GAAF
Sbjct  74   IVGSVIGFFGAAF  86



>ref|XP_007216479.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
 gb|EMJ17678.1| hypothetical protein PRUPE_ppa024737mg [Prunus persica]
Length=489

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +1

Query  397  SDVDYLSAFTNFLWQ--PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            SD D  +   NFLWQ  P    YEHVWPEMK  WKIV+G++IGF GAAF
Sbjct  53   SDTDLFTRVFNFLWQQDPGLWSYEHVWPEMKLGWKIVVGTVIGFFGAAF  101



>ref|XP_007024175.1| Sulfite exporter TauE/SafE family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY26797.1| Sulfite exporter TauE/SafE family protein, putative isoform 2 
[Theobroma cacao]
Length=407

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = +1

Query  262  GVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQ  441
            G   +WRL+     +     +  V V+AE  L  +A+ G N T   + +Y+     FL  
Sbjct  11   GRSNQWRLISTAFVLIGFLAVDLVLVTAEPRLS-QAVSGYNETQ--EKNYVRKALKFLEL  67

Query  442  PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             S+  YEH WP+M+F WKIV+GSI+GF+GAAF
Sbjct  68   NSKPRYEHEWPDMRFGWKIVVGSILGFVGAAF  99



>ref|XP_006343068.1| PREDICTED: uncharacterized protein LOC102587876 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343069.1| PREDICTED: uncharacterized protein LOC102587876 isoform X2 [Solanum 
tuberosum]
 ref|XP_006343070.1| PREDICTED: uncharacterized protein LOC102587876 isoform X3 [Solanum 
tuberosum]
Length=483

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +1

Query  256  MAGVRGKWRLLRPL-MSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYS-DVDYLSAFTN  429
            MA    K + LR   +++S   +LA   V++   +  E    +N T +S +  YL    N
Sbjct  1    MAKTEFKLKGLRKYGVAVSGLLVLALTTVASAEQIPYETTLSNNGTTHSYESSYLFDLFN  60

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
              W+ SE  Y HVWPE++F W++++GS+IGF GAAF
Sbjct  61   IFWRKSEIHYHHVWPELEFGWRLIVGSVIGFFGAAF  96



>ref|XP_009592781.1| PREDICTED: uncharacterized protein LOC104089559 isoform X1 [Nicotiana 
tomentosiformis]
Length=473

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            L  A+ VSAE+   +  +  +     +D  Y     + LW+ SE  Y HVWPE++F W++
Sbjct  14   LALAIVVSAEQIPHEATLSNNGTIHSTDSYYFFDLFSLLWKKSEMHYHHVWPELEFGWRV  73

Query  499  VLGSIIGFLGAAF  537
            ++GS+IGF GAAF
Sbjct  74   IVGSVIGFFGAAF  86



>ref|XP_004302906.1| PREDICTED: uncharacterized protein LOC101294092 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=479

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWS-FLLAAVFV-SAERSLKKEAIGGSNVTDYSDVDYLSAFTN  429
            MA V   W  LR  M +  + FL+ A+ + S + +++++A   S    +    YL+   +
Sbjct  1    MAEVGLPWCGLRWSMGVVVAGFLVVALVIGSVQDTIQQDASTYSGAEKFQS-GYLNRVLS  59

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            F+W+P + GY  VWPEM+F W+IV+G+IIGF+GAAF
Sbjct  60   FVWRPGQLGYVAVWPEMEFGWRIVVGTIIGFIGAAF  95



>ref|XP_009592782.1| PREDICTED: uncharacterized protein LOC104089559 isoform X2 [Nicotiana 
tomentosiformis]
Length=456

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            L  A+ VSAE+   +  +  +     +D  Y     + LW+ SE  Y HVWPE++F W++
Sbjct  14   LALAIVVSAEQIPHEATLSNNGTIHSTDSYYFFDLFSLLWKKSEMHYHHVWPELEFGWRV  73

Query  499  VLGSIIGFLGAAF  537
            ++GS+IGF GAAF
Sbjct  74   IVGSVIGFFGAAF  86



>ref|XP_008228544.1| PREDICTED: uncharacterized protein LOC103327946 [Prunus mume]
Length=489

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = +1

Query  397  SDVDYLSAFTNFLWQ--PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            SD D  +   NFLWQ  P    YEHVWPEMK  WKIV+GS+IGF GAAF
Sbjct  53   SDNDLFTRVFNFLWQQGPGLWSYEHVWPEMKLGWKIVVGSVIGFFGAAF  101



>ref|XP_007024174.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY26796.1| Sulfite exporter TauE/SafE family protein, putative isoform 1 
[Theobroma cacao]
Length=486

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = +1

Query  262  GVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQ  441
            G   +WRL+     +     +  V V+AE  L  +A+ G N T   + +Y+     FL  
Sbjct  11   GRSNQWRLISTAFVLIGFLAVDLVLVTAEPRLS-QAVSGYNETQ--EKNYVRKALKFLEL  67

Query  442  PSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             S+  YEH WP+M+F WKIV+GSI+GF+GAAF
Sbjct  68   NSKPRYEHEWPDMRFGWKIVVGSILGFVGAAF  99



>ref|XP_006425694.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 gb|ESR38934.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=498

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFV----SAERSLKKEAIGGSNVTDYSDVDYLSAF  423
            MA +R   R L   +++ W   L  + +    +AER LK +          +   +L   
Sbjct  1    MAQIRMNRRSLAAAVTV-WMVFLGLIMMEKLSNAERLLKDKDPQVFADEKETRPGFLCRV  59

Query  424  TNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             +FLWQ  ES YE VWPEM+F WK+V+GSI+GF GAA 
Sbjct  60   AHFLWQSGESSYEPVWPEMQFGWKVVVGSIVGFFGAAL  97



>ref|XP_006425693.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
 ref|XP_006466780.1| PREDICTED: uncharacterized protein LOC102622706 [Citrus sinensis]
 gb|ESR38933.1| hypothetical protein CICLE_v10025446mg [Citrus clementina]
Length=477

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFV----SAERSLKKEAIGGSNVTDYSDVDYLSAF  423
            MA +R   R L   +++ W   L  + +    +AER LK +          +   +L   
Sbjct  1    MAQIRMNRRSLAAAVTV-WMVFLGLIMMEKLSNAERLLKDKDPQVFADEKETRPGFLCRV  59

Query  424  TNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             +FLWQ  ES YE VWPEM+F WK+V+GSI+GF GAA 
Sbjct  60   AHFLWQSGESSYEPVWPEMQFGWKVVVGSIVGFFGAAL  97



>ref|XP_007217721.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
 gb|EMJ18920.1| hypothetical protein PRUPE_ppa005105mg [Prunus persica]
Length=477

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 6/89 (7%)
 Frame = +1

Query  268  RGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPS  447
            R + RLL  +       +LA VFVSA+  L+++    +   +    D + A + FL  P 
Sbjct  8    RSRLRLLGMVY-----LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHPG  61

Query  448  ESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
               Y+HVWPEM+F WKI +G+IIGFLGAA
Sbjct  62   GVVYKHVWPEMRFGWKIAVGTIIGFLGAA  90



>ref|XP_010680798.1| PREDICTED: uncharacterized protein LOC104895862 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=476

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +S +L      AER LK+  I   +         LS   +FLW+  E  Y+ VWP+M+
Sbjct  18   ICFSVVLLNSIARAERPLKENFISLVDKEQVMKEGLLSKMYHFLWKSGEPSYQPVWPDME  77

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GS IGFLGAA 
Sbjct  78   FGWRIVVGSFIGFLGAAL  95



>gb|KDO56897.1| hypothetical protein CISIN_1g0116822mg, partial [Citrus sinensis]
 gb|KDO56898.1| hypothetical protein CISIN_1g0116822mg, partial [Citrus sinensis]
 gb|KDO56899.1| hypothetical protein CISIN_1g0116822mg, partial [Citrus sinensis]
Length=123

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            +WRLL    +     ++A+V VSA+ +LK EA    N  D+ + + +   +      S S
Sbjct  10   RWRLL--AAAFIGLLVVASVSVSAQSNLKPEATS-KNKNDHVEPNIVIKVSA---PKSRS  63

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            GY+HVWP++KF W+IV+G+IIGF G A
Sbjct  64   GYKHVWPDIKFGWRIVVGTIIGFFGTA  90



>ref|XP_011011433.1| PREDICTED: uncharacterized protein LOC105116005 isoform X1 [Populus 
euphratica]
Length=497

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 5/100 (5%)
 Frame = +1

Query  238  EEISG*MAGVRGKWRLLRPLMSI-SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYL  414
             EI   MA ++ K  +L+ L +I S S +   + V AE SL +E         +  +  L
Sbjct  17   REIRNPMARIQAKHLVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMRML  76

Query  415  SAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            S     + +    GY HVWPEM+F WKIV+GSIIGF GAA
Sbjct  77   S----LVREKGRVGYTHVWPEMRFGWKIVMGSIIGFFGAA  112



>ref|XP_010680799.1| PREDICTED: uncharacterized protein LOC104895862 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=475

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +S +L      AER LK+  I   +         LS   +FLW+  E  Y+ VWP+M+
Sbjct  18   ICFSVVLLNSIARAERPLKENFISLVDKEQVMKEGLLSKMYHFLWKSGEPSYQPVWPDME  77

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GS IGFLGAA 
Sbjct  78   FGWRIVVGSFIGFLGAAL  95



>gb|KDO79521.1| hypothetical protein CISIN_1g011797mg [Citrus sinensis]
Length=477

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFV----SAERSLKKEAIGGSNVTDYSDVDYLSAF  423
            MA +R   R L   +++ W   L  + +    +AER LK +          +   +L   
Sbjct  1    MAQIRMNRRSLAAAVAV-WMVFLGLIMMEKLSNAERLLKDKDPQVFADEKETRPGFLCRV  59

Query  424  TNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             +FLWQ  ES YE VWPEM+F WK+V+GSI+GF GAA 
Sbjct  60   AHFLWQSGESSYEPVWPEMQFGWKVVVGSIVGFFGAAL  97



>gb|KDO56896.1| hypothetical protein CISIN_1g022146mg [Citrus sinensis]
Length=302

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             L+A+V VSA+ +LK EA   + +      + +   T+ +     SGY+HVWP++KF WK
Sbjct  22   LLVASVSVSAQSTLKPEATSANKIDHVEPKNVIKVPTHKI----RSGYKHVWPDIKFGWK  77

Query  496  IVLGSIIGFLGAA  534
            IV+ SIIGF GAA
Sbjct  78   IVVSSIIGFFGAA  90



>ref|XP_010098073.1| hypothetical protein L484_026205 [Morus notabilis]
 gb|EXB74510.1| hypothetical protein L484_026205 [Morus notabilis]
Length=470

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 53/96 (55%), Gaps = 17/96 (18%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISW-SFLLA-AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTN  429
            MAG+  KW     L+ I+   FLL  +V VSA+ + +++     N +   D         
Sbjct  1    MAGIGPKWGNTMRLIGIALVGFLLVFSVLVSAQETSQQKTSSEKNSSQSVD---------  51

Query  430  FLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
                   SGY+HVWPEMKF W+I++G IIGFLGAAF
Sbjct  52   ------RSGYKHVWPEMKFGWRIIVGGIIGFLGAAF  81



>ref|XP_002310222.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
 gb|EEE90672.2| hypothetical protein POPTR_0007s12700g [Populus trichocarpa]
Length=477

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 3/67 (4%)
 Frame = +1

Query  340  SAERSLK-KEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSII  516
            SAER LK KEA   + V       Y+    +FL+Q  +S YE VWP+MKFDW++V+G+I+
Sbjct  33   SAERLLKDKEA--ETLVKKEMSPGYIVKMIHFLFQGGKSSYEPVWPDMKFDWRVVVGTIV  90

Query  517  GFLGAAF  537
            GF GAA 
Sbjct  91   GFFGAAL  97



>gb|EEE69518.1| hypothetical protein OsJ_28979 [Oryza sativa Japonica Group]
Length=481

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V  L    NFLWQ   + Y HVWPEM+  W+IVLGS+IGF GAAF
Sbjct  54   EVGILRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAF  99



>ref|NP_001062933.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAD29095.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF24847.1| Os09g0344800 [Oryza sativa Japonica Group]
 dbj|BAG88213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=481

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V  L    NFLWQ   + Y HVWPEM+  W+IVLGS+IGF GAAF
Sbjct  54   EVGILRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAF  99



>ref|XP_006465610.1| PREDICTED: uncharacterized protein LOC102613305 isoform X1 [Citrus 
sinensis]
 ref|XP_006465611.1| PREDICTED: uncharacterized protein LOC102613305 isoform X2 [Citrus 
sinensis]
 ref|XP_006465612.1| PREDICTED: uncharacterized protein LOC102613305 isoform X3 [Citrus 
sinensis]
Length=477

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             L+A+V VSA+ +LK EA   + +      + +   T+ +     SGY+HVWP++KF WK
Sbjct  22   LLVASVSVSAQSTLKPEATSANKIDHVEPKNVIKVPTHKI----RSGYKHVWPDIKFGWK  77

Query  496  IVLGSIIGFLGAA  534
            IV+ SIIGF GAA
Sbjct  78   IVVSSIIGFFGAA  90



>ref|XP_006426964.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426965.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 ref|XP_006426966.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40204.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40205.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
 gb|ESR40206.1| hypothetical protein CICLE_v10025511mg [Citrus clementina]
Length=477

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             L+A+V VSA+ +LK EA   + +      + +   T+ +     SGY+HVWP++KF WK
Sbjct  22   LLVASVSVSAQSTLKPEATSANKIDHVEPKNVIKVPTHKI----RSGYKHVWPDIKFGWK  77

Query  496  IVLGSIIGFLGAA  534
            IV+ SIIGF GAA
Sbjct  78   IVVSSIIGFFGAA  90



>gb|EEC84400.1| hypothetical protein OsI_30977 [Oryza sativa Indica Group]
Length=465

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V  L    NFLWQ   + Y HVWPEM+  W+IVLGS+IGF GAAF
Sbjct  38   EVGILRKVANFLWQTDGNSYHHVWPEMELGWQIVLGSLIGFFGAAF  83



>ref|XP_011011435.1| PREDICTED: uncharacterized protein LOC105116005 isoform X2 [Populus 
euphratica]
Length=475

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSI-SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            MA ++ K  +L+ L +I S S +   + V AE SL +E         +  +  LS     
Sbjct  1    MARIQAKHLVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMRMLS----L  56

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            + +    GY HVWPEM+F WKIV+GSIIGF GAA
Sbjct  57   VREKGRVGYTHVWPEMRFGWKIVMGSIIGFFGAA  90



>gb|ABR16391.1| unknown [Picea sitchensis]
Length=157

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 14/101 (14%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYS---DVDYLSAFT  426
            MAG   KW LL  +M  ++  LLA    SAER+   +    S+ T+ S    VD +   T
Sbjct  1    MAGGGRKW-LLVVVMVATFGLLLAVTLSSAERTFL-DGNSASSETERSMEKIVDPVEGNT  58

Query  427  ---------NFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
                     NFLW+ + S Y+ VWPEMKF W+IV+GSI+GF
Sbjct  59   LKYHVLKARNFLWRSNISDYQRVWPEMKFGWRIVIGSIVGF  99



>ref|XP_009800426.1| PREDICTED: uncharacterized protein LOC104246320 isoform X2 [Nicotiana 
sylvestris]
Length=456

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            L  A+ VSAE+   +  +  +  T  +D  Y     N L + SE  Y HVWPE++  W++
Sbjct  14   LALAIVVSAEKIPHEATLSNNGTTHSTDSYYFFDLFNLLQKMSEMHYHHVWPELECGWRV  73

Query  499  VLGSIIGFLGAAF  537
            ++GS+IGF GAAF
Sbjct  74   IVGSVIGFFGAAF  86



>dbj|BAK01650.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            ++  L+   NF+WQ   + Y+HVWP M+F WK+VLGS+IGF GA+F
Sbjct  44   EISLLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASF  89



>gb|EMT22888.1| hypothetical protein F775_28607 [Aegilops tauschii]
Length=423

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            ++  L+   NF+WQ   + Y+HVWP M+F WK+VLGS+IGF GA+F
Sbjct  43   EISLLNKIANFMWQTDGNSYQHVWPPMEFGWKMVLGSLIGFFGASF  88



>ref|XP_009800425.1| PREDICTED: uncharacterized protein LOC104246320 isoform X1 [Nicotiana 
sylvestris]
Length=473

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  319  LLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKI  498
            L  A+ VSAE+   +  +  +  T  +D  Y     N L + SE  Y HVWPE++  W++
Sbjct  14   LALAIVVSAEKIPHEATLSNNGTTHSTDSYYFFDLFNLLQKMSEMHYHHVWPELECGWRV  73

Query  499  VLGSIIGFLGAAF  537
            ++GS+IGF GAAF
Sbjct  74   IVGSVIGFFGAAF  86



>ref|XP_003523605.1| PREDICTED: uncharacterized protein LOC100816633 [Glycine max]
 gb|KHN04486.1| hypothetical protein glysoja_019573 [Glycine soja]
Length=474

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +1

Query  307  SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKF  486
            SWS ++A     AER LK +      V +   V  +++  +F W   E   + VWPEMKF
Sbjct  21   SWSLIMAYNVCLAERVLKDQKPESFVVKERQGV--MNSIIDFFWNDGEPTNDRVWPEMKF  78

Query  487  DWKIVLGSIIGFLGAAF  537
             W+IV+GSI+GF GAA 
Sbjct  79   GWRIVVGSIVGFFGAAL  95



>dbj|BAD05342.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD05727.1| unknown protein [Oryza sativa Japonica Group]
Length=132

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V Y+    NFLW   E+ Y HVWP M+F WKIVLG +IGF GAAF
Sbjct  39   EVGYMRKVVNFLWS-GEASYHHVWPPMEFGWKIVLGILIGFFGAAF  83



>gb|ABC47842.1| membrane protein-like protein [Glycine max]
Length=469

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +1

Query  307  SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKF  486
            SWS ++A     AER LK +      V +   V  +++  +F W   E   + VWPEMKF
Sbjct  21   SWSLIMAYNVCLAERVLKDQKPESFVVKERQGV--MNSIIDFFWNDGEPTNDRVWPEMKF  78

Query  487  DWKIVLGSIIGFLGAAF  537
             W+IV+GSI+GF GAA 
Sbjct  79   GWRIVVGSIVGFFGAAL  95



>ref|XP_003578003.1| PREDICTED: uncharacterized protein LOC100827421 [Brachypodium 
distachyon]
Length=469

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            ++  L+   NFLWQ   + Y HVWP M+F WK+VLG++IGF GA+F
Sbjct  42   EISLLNKIANFLWQSDGNSYHHVWPPMEFGWKVVLGTLIGFFGASF  87



>gb|KJB56746.1| hypothetical protein B456_009G134400 [Gossypium raimondii]
Length=476

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            MA     WRL+   + +     + +V V+AE S   E  G      Y++ +Y+      L
Sbjct  1    MAAPSKGWRLILAGIILVGFLAVDSVLVTAEPSSNHEQSG------YNEKNYVRKAFKLL  54

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             Q ++  +EH WP+++F WKIV+GSI+GFLGAAF
Sbjct  55   EQNNKPRHEHEWPDIRFGWKIVVGSILGFLGAAF  88



>ref|XP_010263696.1| PREDICTED: uncharacterized protein LOC104601887 [Nelumbo nucifera]
Length=473

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 6/83 (7%)
 Frame = +1

Query  289  RPLMSISWSFLLAAVFVS----AERSLKKEAIGGSNVTDYSDVD-YLSAFTNFLWQPSES  453
            R + + +W  +L  + VS    AER L +   G  +  + +  + ++    NFLWQ  +S
Sbjct  9    RAVEATAWVVVLGIIMVSRVGGAER-LSRHVCGEVSAEEETGEEGFMVRLVNFLWQSGKS  67

Query  454  GYEHVWPEMKFDWKIVLGSIIGF  522
             Y HVWPEM+F W++VLGSIIGF
Sbjct  68   IYHHVWPEMEFGWRLVLGSIIGF  90



>gb|EAZ06861.1| hypothetical protein OsI_29096 [Oryza sativa Indica Group]
Length=469

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +1

Query  406  DYLSAFTNFLWQPS-ESGYEHVWPEMKFDWKIVLGSIIGFLGAAFGSV  546
             +L    NFLW+   E+ Y HVWP M+F W+IVLGS +GF+GAAFGS+
Sbjct  48   SHLRKVANFLWRSGGENSYHHVWPPMEFGWQIVLGSFVGFIGAAFGSI  95



>ref|XP_002299704.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
 gb|EEE84509.2| hypothetical protein POPTR_0001s18300g [Populus trichocarpa]
Length=475

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSI-SWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            MA ++ K  +L+ L +I S S +   + V AE SL +E         +  +  LS     
Sbjct  1    MARIQAKHWVLKLLGAILSGSLVAVLILVLAEPSLTQEGSRTGGTESHRAMRMLS----L  56

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            + +    GY HVWPEM+F WKIVLGSIIGF GAA
Sbjct  57   VREKGRVGYTHVWPEMRFGWKIVLGSIIGFFGAA  90



>ref|XP_004287906.1| PREDICTED: uncharacterized protein LOC101304510 [Fragaria vesca 
subsp. vesca]
Length=478

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDW  492
            S L+ +  VS ER LK +    + V +             LWQ   S Y+ VWPEMKF W
Sbjct  24   SLLMVSEVVSGERPLKDDQKPRNFVEEDIKQGAFLRMMKLLWQTGGSSYQPVWPEMKFGW  83

Query  493  KIVLGSIIGFLGAAF  537
            KI++G+I+GF GAA 
Sbjct  84   KIIVGTIVGFFGAAL  98



>ref|XP_008228546.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
 ref|XP_008228547.1| PREDICTED: uncharacterized protein LOC103327947 isoform X1 [Prunus 
mume]
Length=478

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             +LA VFVSA+  L+++    +   +    D + A + FL  P    Y+HVWP M+F WK
Sbjct  20   LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHPDGVVYKHVWPGMRFGWK  78

Query  496  IVLGSIIGFLGAA  534
            I +G+IIGFLGAA
Sbjct  79   IAIGTIIGFLGAA  91



>ref|XP_008228549.1| PREDICTED: uncharacterized protein LOC103327947 isoform X3 [Prunus 
mume]
Length=448

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             +LA VFVSA+  L+++    +   +    D + A + FL  P    Y+HVWP M+F WK
Sbjct  20   LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHPDGVVYKHVWPGMRFGWK  78

Query  496  IVLGSIIGFLGAA  534
            I +G+IIGFLGAA
Sbjct  79   IAIGTIIGFLGAA  91



>ref|XP_010254876.1| PREDICTED: uncharacterized protein LOC104595716 isoform X1 [Nelumbo 
nucifera]
Length=471

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 40/76 (53%), Gaps = 0/76 (0%)
 Frame = +1

Query  310  WSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFD  489
            W  ++     +AER L+          +  +  Y+    N L Q   S Y HVWPEMK +
Sbjct  18   WGVMMVCQVGAAERLLRGVDQQVLVEKEIREDGYMVRLINLLRQNENSTYHHVWPEMKLE  77

Query  490  WKIVLGSIIGFLGAAF  537
            W++VLGSIIGF GAA 
Sbjct  78   WRLVLGSIIGFFGAAL  93



>ref|XP_007161342.1| hypothetical protein PHAVU_001G061000g [Phaseolus vulgaris]
 gb|ESW33336.1| hypothetical protein PHAVU_001G061000g [Phaseolus vulgaris]
Length=460

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = +1

Query  286  LRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEH  465
            +R ++  S+ FLL  VF  A  S K E    +    +S   Y      F+W  S  GY+H
Sbjct  1    MRNVVIFSFIFLLLCVFFYAITSTKIEVSMKNEAKPFS---YHIKALEFIW--SHLGYQH  55

Query  466  VWPEMKFDWKIVLGSIIGFLGAAF  537
            VWPEM+F W+IV+G+++G LGAAF
Sbjct  56   VWPEMEFGWRIVVGTLLGILGAAF  79



>ref|XP_008228548.1| PREDICTED: uncharacterized protein LOC103327947 isoform X2 [Prunus 
mume]
Length=461

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             +LA VFVSA+  L+++    +   +    D + A + FL  P    Y+HVWP M+F WK
Sbjct  20   LVLALVFVSAQEILEQQPSSQTLGEEVESNDLIRA-SKFLSHPDGVVYKHVWPGMRFGWK  78

Query  496  IVLGSIIGFLGAA  534
            I +G+IIGFLGAA
Sbjct  79   IAIGTIIGFLGAA  91



>gb|AET03944.2| sulfite exporter TauE/SafE family protein [Medicago truncatula]
Length=473

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 10/78 (13%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++      AER L+ E           ++  +   T+F W   ES YE VWPEMK
Sbjct  21   VSWSLIMIYHVSLAERVLEDEK---------PEIVVMKK-TSFFWYSGESSYERVWPEMK  70

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GSI+GF GAA 
Sbjct  71   FGWRIVVGSIVGFFGAAL  88



>ref|XP_003629468.1| hypothetical protein MTR_8g077830 [Medicago truncatula]
Length=480

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 10/78 (13%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++      AER L+ E           ++  +   T+F W   ES YE VWPEMK
Sbjct  21   VSWSLIMIYHVSLAERVLEDEK---------PEIVVMKK-TSFFWYSGESSYERVWPEMK  70

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GSI+GF GAA 
Sbjct  71   FGWRIVVGSIVGFFGAAL  88



>gb|AFK35007.1| unknown [Medicago truncatula]
Length=473

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 10/78 (13%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++      AER L+ E           ++  +   T+F W   ES YE VWPEMK
Sbjct  21   VSWSLIMIYHVSLAERVLEDEK---------PEIVVMKK-TSFFWYSGESSYERVWPEMK  70

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GSI+GF GAA 
Sbjct  71   FGWRIVVGSIVGFFGAAL  88



>ref|XP_007150626.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
 gb|ESW22620.1| hypothetical protein PHAVU_005G168100g [Phaseolus vulgaris]
Length=480

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query  409  YLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +LS   NFLW  S SGY+H WP+++F W+IV GSIIGFLG+AF
Sbjct  51   FLSKVLNFLWS-SGSGYQHTWPDIEFGWRIVTGSIIGFLGSAF  92



>ref|XP_011025767.1| PREDICTED: uncharacterized protein LOC105126564 [Populus euphratica]
Length=477

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +1

Query  340  SAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIG  519
            SAER LK +        D S   Y+    +FL+Q  +S YE VWP+MKFDW+I +G+I+G
Sbjct  33   SAERLLKDKEAETLVKKDMSP-GYIVKMFHFLFQGGKSSYEPVWPDMKFDWRITVGTIVG  91

Query  520  FLGAAF  537
            F GAA 
Sbjct  92   FFGAAL  97



>gb|EPS70855.1| hypothetical protein M569_03905 [Genlisea aurea]
Length=444

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 10/82 (12%)
 Frame = +1

Query  292  PLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVW  471
            P  S+  SFL  ++ VSAERSL       S              T  L    + GY+HVW
Sbjct  14   PFFSLLLSFLCTSLCVSAERSLMMRRSFSSRPDS----------TVSLSPADDYGYQHVW  63

Query  472  PEMKFDWKIVLGSIIGFLGAAF  537
            P+  F+W++V+GSIIGFLGAAF
Sbjct  64   PDFAFNWRLVVGSIIGFLGAAF  85



>ref|XP_010526118.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803769 
[Tarenaya hassleriana]
Length=334

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 0/94 (0%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            M G   KW +LR ++ I+ +F L     SAER+L+  A    +       +Y     +FL
Sbjct  1    MVGFVSKWWVLRSVLVIAVNFALTFALTSAERNLEGTASKVDSEMQEVFHNYFLRAVDFL  60

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  E GY HVWP        ++G++IGF GAAF
Sbjct  61   WRSDERGYHHVWPRDGTXLANLVGTLIGFFGAAF  94



>ref|XP_006426963.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
 gb|ESR40203.1| hypothetical protein CICLE_v10025503mg [Citrus clementina]
Length=479

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            +WRLL    +     ++A+V VSA+ +LK EA    N  D+ + + +   +      S S
Sbjct  10   RWRLLAA--AFIGLLVVASVSVSAQSNLKPEATS-KNKNDHVEPNIVIKVSA---PKSRS  63

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            GY+HVWP++KF W+IV+G+IIGF G A
Sbjct  64   GYKHVWPDIKFGWRIVVGTIIGFFGTA  90



>ref|XP_006465615.1| PREDICTED: uncharacterized protein LOC102614288 isoform X2 [Citrus 
sinensis]
Length=477

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            +WRLL    +     ++A+V VSA+ +LK EA    N  D+ + + +   +      S S
Sbjct  10   RWRLLAA--AFIGLLVVASVSVSAQSNLKPEATS-ENKNDHVEPNIVIKVSA---PKSRS  63

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            GY+HVWP++KF W+IV+G+IIGF G A
Sbjct  64   GYKHVWPDIKFGWRIVVGTIIGFFGTA  90



>ref|XP_006465614.1| PREDICTED: uncharacterized protein LOC102614288 isoform X1 [Citrus 
sinensis]
Length=479

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSES  453
            +WRLL    +     ++A+V VSA+ +LK EA    N  D+ + + +   +      S S
Sbjct  10   RWRLLAA--AFIGLLVVASVSVSAQSNLKPEATS-ENKNDHVEPNIVIKVSA---PKSRS  63

Query  454  GYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            GY+HVWP++KF W+IV+G+IIGF G A
Sbjct  64   GYKHVWPDIKFGWRIVVGTIIGFFGTA  90



>ref|NP_001061719.1| Os08g0389700 [Oryza sativa Japonica Group]
 dbj|BAD05341.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD05726.1| membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF23633.1| Os08g0389700 [Oryza sativa Japonica Group]
Length=465

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V Y+    NFLW   E+ Y HVWP M+F WKIVLG +IGF GAAF
Sbjct  39   EVGYMRKVVNFLWS-GEASYHHVWPPMEFGWKIVLGILIGFFGAAF  83



>gb|EEC83519.1| hypothetical protein OsI_29108 [Oryza sativa Indica Group]
Length=466

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V Y+    NFLW   E+ Y HVWP M+F WKI+LG +IGF GAAF
Sbjct  40   EVGYMRKVVNFLWS-GEASYHHVWPPMEFGWKIILGILIGFFGAAF  84



>ref|XP_002516037.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46457.1| conserved hypothetical protein [Ricinus communis]
Length=481

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 7/90 (8%)
 Frame = +1

Query  274  KWRLLRPLMSISWSFLLAAVFVS-AERSLKKEAIGGSNVTDYSDVDY--LSAFTNFLWQP  444
            +W L+  L +I  SFL+    ++ +E  LK   + GS+     +V++  ++  +NF +Q 
Sbjct  8    RWSLIM-LGAILSSFLVVGSLLALSETRLK---LLGSDYKRPKEVEFHHVTRASNFFYQK  63

Query  445  SESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
               GY+HVWPEM+F WKIVLG +IG  GAA
Sbjct  64   GRLGYKHVWPEMRFGWKIVLGGVIGVFGAA  93



>gb|ABR16333.1| unknown [Picea sitchensis]
Length=505

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 14/101 (14%)
 Frame = +1

Query  256  MAGVRGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYS---DVDYLSAFT  426
            MAG   KW LL  +M  ++  LLA    SAER+   +    S+ T+ S    VD +   T
Sbjct  1    MAGGGRKW-LLVVVMVATFGLLLAVTLSSAERTFL-DGNSASSETERSMEKIVDPVEGNT  58

Query  427  ---------NFLWQPSESGYEHVWPEMKFDWKIVLGSIIGF  522
                     NFLW+ + S Y+ VWPEMKF W+IV+GSI+GF
Sbjct  59   LKYHLLKARNFLWRSNISDYQRVWPEMKFGWRIVIGSIVGF  99



>ref|XP_006340601.1| PREDICTED: uncharacterized protein LOC102601548 [Solanum tuberosum]
Length=476

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--------YLSAFTNFLWQPSESGYEHVW  471
            F+++ V ++AER   K+ +  +   + S V+        +     +FLW   +S YEHVW
Sbjct  17   FIISDVGINAERLTLKDKLEPTATYNISYVENNEMRPHGFAVRLVHFLWS-GKSSYEHVW  75

Query  472  PEMKFDWKIVLGSIIGFLGAAF  537
            PEM+F W++++GSI+GF GAA 
Sbjct  76   PEMEFGWRVIVGSIVGFFGAAL  97



>ref|XP_009788571.1| PREDICTED: uncharacterized protein LOC104236361 [Nicotiana sylvestris]
Length=479

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = +1

Query  268  RGKWRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPS  447
            R K  L+  +  I W     +   +AER LK E      V       +      FLW   
Sbjct  13   RVKALLITAVWIICWGLFTISDVGNAERLLKTEE-PTYVVEKEMRQGFALRLLRFLWN-G  70

Query  448  ESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +S YEHVWPEMKF WKI++GSI+GF GAA 
Sbjct  71   KSTYEHVWPEMKFGWKIIVGSIVGFFGAAL  100



>ref|NP_001145740.1| uncharacterized protein LOC100279247 [Zea mays]
 gb|ACL52495.1| unknown [Zea mays]
 tpg|DAA61109.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=291

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V  L    N +W    + Y+HVWP M+F W+IVLGS+IGF GAAF
Sbjct  41   EVSLLRKVANLMWNGDGNSYQHVWPPMEFGWQIVLGSLIGFFGAAF  86



>ref|XP_006585193.1| PREDICTED: uncharacterized protein LOC100802321 [Glycine max]
Length=473

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  313  SFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDW  492
            +FLL +V+V++ +    +    S   +   VD  +         +E  Y+H WPEMKF W
Sbjct  21   AFLLVSVYVASSQQNTDQKTISSASNETKGVDTKA-------HHAEGFYKHTWPEMKFGW  73

Query  493  KIVLGSIIGFLGAAF  537
            KI++GSIIGFLG+AF
Sbjct  74   KIIVGSIIGFLGSAF  88



>ref|XP_004956625.1| PREDICTED: uncharacterized protein LOC101768056 [Setaria italica]
Length=468

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +1

Query  370  IGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +G +   +  ++  L    N +W  S + Y+HVWP MKF W+IVLG++IGF GAAF
Sbjct  31   VGAAVAPEEEEIGLLRKIANLMWN-SGNTYQHVWPPMKFGWRIVLGTLIGFFGAAF  85



>ref|XP_008651296.1| PREDICTED: uncharacterized protein LOC100279247 isoform X1 [Zea 
mays]
 tpg|DAA61108.1| TPA: hypothetical protein ZEAMMB73_890925 [Zea mays]
Length=470

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  400  DVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            +V  L    N +W    + Y+HVWP M+F W+IVLGS+IGF GAAF
Sbjct  41   EVSLLRKVANLMWNGDGNSYQHVWPPMEFGWQIVLGSLIGFFGAAF  86



>ref|XP_009346009.1| PREDICTED: uncharacterized protein LOC103937781 [Pyrus x bretschneideri]
Length=489

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +1

Query  370  IGGSNVTDYSDVDYLSAFTNFLWQPSES-GYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            I GS    +    + +   NFLWQ      YEHVWPEM   WKIV+G+IIGFLG+AF
Sbjct  47   INGSQ--TFQSHKFQTRMLNFLWQLGRLFSYEHVWPEMTIGWKIVVGTIIGFLGSAF  101



>ref|XP_008342687.1| PREDICTED: uncharacterized protein LOC103405461 [Malus domestica]
Length=428

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +1

Query  427  NFLWQPSES-GYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            NFLWQ      YEHVWPEM   WKIV+G+IIGFLG+AF
Sbjct  3    NFLWQLGRLFSYEHVWPEMTIGWKIVVGTIIGFLGSAF  40



>gb|EMT12794.1| hypothetical protein F775_19997 [Aegilops tauschii]
Length=468

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  385  VTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            V    +  YL    + LWQ   + Y HVWP MK  WKIVLGS IGF GAA
Sbjct  33   VAPPEEASYLRKLASSLWQSDGTAYHHVWPPMKLGWKIVLGSFIGFFGAA  82



>ref|XP_004302905.1| PREDICTED: uncharacterized protein LOC101293605 [Fragaria vesca 
subsp. vesca]
Length=479

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query  277  WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESG  456
            W  LR +  +   + L     S   SL+++     N     + +YL+  +        +G
Sbjct  9    WCRLRLIAKVGICYCLVLALASVSESLEQQTSSSQNHGKEVESNYLTNVSKS-QTSGVAG  67

Query  457  YEHVWPEMKFDWKIVLGSIIGFLGAA  534
            Y+HVWP+++F WKI++G++IGFLG+A
Sbjct  68   YKHVWPDIRFGWKIMVGTVIGFLGSA  93



>ref|XP_004232395.1| PREDICTED: uncharacterized protein LOC101255155 [Solanum lycopersicum]
Length=486

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVD--------YLSAFTNFLWQPSESGYEHVW  471
            F+++   ++AER   K+ +  +   + S V+        +     +FLW   +S YEHVW
Sbjct  27   FIISEAGINAERLTLKDKLEPAATYNISYVENNEMRPQTFAVRLVHFLWS-GKSSYEHVW  85

Query  472  PEMKFDWKIVLGSIIGFLGAAF  537
            PEM+F W++++GSI+GF GAA 
Sbjct  86   PEMEFGWRVIVGSIVGFFGAAL  107



>ref|XP_006580198.1| PREDICTED: uncharacterized protein LOC100819316 [Glycine max]
Length=475

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 7/74 (9%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
            FLL +V+V++     ++    S   D   VD      N         Y+H WPEMKF WK
Sbjct  24   FLLVSVYVASSHQNTEQKPVSSPSNDTKGVDTNGHHANGF-------YKHTWPEMKFGWK  76

Query  496  IVLGSIIGFLGAAF  537
            I++GSIIGFLG+AF
Sbjct  77   IIVGSIIGFLGSAF  90



>ref|XP_007156036.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
 gb|ESW28030.1| hypothetical protein PHAVU_003G253000g [Phaseolus vulgaris]
Length=471

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 3/79 (4%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPS-ESGYEHVWPEM  480
            +SWS ++A    SAER LK +       T+   V  L +  +F W    +   + VWPEM
Sbjct  14   LSWSLIMAYNVSSAERVLKDQNHESLAATEREGV--LFSIIDFFWNDGGDPSKDRVWPEM  71

Query  481  KFDWKIVLGSIIGFLGAAF  537
            KF W+IV+GS++GF GAA 
Sbjct  72   KFGWRIVVGSVVGFFGAAL  90



>ref|XP_009133962.1| PREDICTED: uncharacterized protein LOC103858367 [Brassica rapa]
Length=462

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  ++GY HVWPE +F+W++VLG+++GF GAAF
Sbjct  46   WESDQTGYHHVWPEFEFNWQVVLGTLVGFFGAAF  79



>ref|XP_009611257.1| PREDICTED: uncharacterized protein LOC104104795 isoform X3 [Nicotiana 
tomentosiformis]
Length=435

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +  L + VF SAE+   +  +  +  T   +  Y+    N L Q +E  Y HVWPE++
Sbjct  19   IGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFNILRQKAEMHYHHVWPELQ  78

Query  484  FDWKIVLGSIIGFLGAAF  537
              W++++GSIIGF  AA 
Sbjct  79   VGWRVIVGSIIGFFAAAL  96



>emb|CDX83221.1| BnaA03g22850D [Brassica napus]
Length=462

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +1

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            W+  ++GY HVWPE +F+W++VLG+++GF GAAF
Sbjct  46   WESDQTGYHHVWPEFEFNWQVVLGTLVGFFGAAF  79



>ref|XP_009611258.1| PREDICTED: uncharacterized protein LOC104104795 isoform X4 [Nicotiana 
tomentosiformis]
Length=382

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +  L + VF SAE+   +  +  +  T   +  Y+    N L Q +E  Y HVWPE++
Sbjct  19   IGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFNILRQKAEMHYHHVWPELQ  78

Query  484  FDWKIVLGSIIGFLGAAF  537
              W++++GSIIGF  AA 
Sbjct  79   VGWRVIVGSIIGFFAAAL  96



>ref|XP_009611253.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009611254.1| PREDICTED: uncharacterized protein LOC104104795 isoform X1 [Nicotiana 
tomentosiformis]
Length=482

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +  L + VF SAE+   +  +  +  T   +  Y+    N L Q +E  Y HVWPE++
Sbjct  19   IGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFNILRQKAEMHYHHVWPELQ  78

Query  484  FDWKIVLGSIIGFLGAAF  537
              W++++GSIIGF  AA 
Sbjct  79   VGWRVIVGSIIGFFAAAL  96



>ref|XP_002516570.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45911.1| conserved hypothetical protein [Ricinus communis]
Length=465

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            LWQ   SGY+HVWP M+  W++V+GSIIGF GAAF
Sbjct  57   LWQSDGSGYQHVWPGMELGWQVVVGSIIGFFGAAF  91



>ref|XP_009611256.1| PREDICTED: uncharacterized protein LOC104104795 isoform X2 [Nicotiana 
tomentosiformis]
Length=453

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +  L + VF SAE+   +  +  +  T   +  Y+    N L Q +E  Y HVWPE++
Sbjct  19   IGFLILSSNVFASAEQISDRITLSNNGTTHDFESGYVFNLFNILRQKAEMHYHHVWPELQ  78

Query  484  FDWKIVLGSIIGFLGAAF  537
              W++++GSIIGF  AA 
Sbjct  79   VGWRVIVGSIIGFFAAAL  96



>ref|XP_010935066.1| PREDICTED: uncharacterized protein LOC105055061 [Elaeis guineensis]
Length=495

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 9/76 (12%)
 Frame = +1

Query  337  VSAERSLKKEA--IGGSNV-TDYSDV---DYLSAFTNF---LWQPSESGYEHVWPEMKFD  489
            V A R L   A  +G S++ T+++ +   DY    +N    L+   +S Y HVWP+M+F 
Sbjct  28   VLANRPLASSAHEMGSSSISTNHNKIMEKDYKYILSNIFHSLFDNGDSSYTHVWPDMEFG  87

Query  490  WKIVLGSIIGFLGAAF  537
            W++VLGSIIGFLGAA 
Sbjct  88   WRVVLGSIIGFLGAAL  103



>ref|XP_006660551.1| PREDICTED: uncharacterized protein LOC102715329 [Oryza brachyantha]
Length=470

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  385  VTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            VT   ++  L    NFLWQ   + Y HVWP M+   ++VLG++IGF GAAF
Sbjct  38   VTTPEEMGLLRKVANFLWQTDGNSYHHVWPPMELGCQVVLGTLIGFFGAAF  88



>gb|KHN48052.1| hypothetical protein glysoja_015522 [Glycine soja]
Length=414

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
             LL +V+V++ +    +    S   +   VD  +         +E  Y+H WPEMKF WK
Sbjct  23   LLLVSVYVASSQQNTDQKTISSASNETKGVDTKA-------HHAEGFYKHTWPEMKFGWK  75

Query  496  IVLGSIIGFLGAAF  537
            I++GSIIGFLG+AF
Sbjct  76   IIVGSIIGFLGSAF  89



>ref|XP_006660104.1| PREDICTED: uncharacterized protein LOC102707608 [Oryza brachyantha]
Length=446

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  406  DYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             YL    +FLW   E+ Y+HVWP M+  W+I+LG++IGF GAAF
Sbjct  22   SYLRKVASFLWS-GETAYQHVWPPMELGWQIILGTLIGFFGAAF  64



>ref|XP_009396550.1| PREDICTED: uncharacterized protein LOC103981523 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = +1

Query  265  VRGKW--RLLRPLMSISWSFLLA-AVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFL  435
            + GKW  RL+  ++     F LA A   SA+R LK   +   N+   +  +   A     
Sbjct  1    MEGKWLSRLVAAVVFAVLCFFLATAQVASADRGLK---LMNPNINTIARGEMKRALKRS-  56

Query  436  WQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
             Q   S Y HVWP MKF+W+I +GS+IGFLGAA 
Sbjct  57   QQEDGSSYSHVWPAMKFEWRIAVGSVIGFLGAAL  90



>ref|XP_003527721.1| PREDICTED: uncharacterized protein LOC100789748 [Glycine max]
 gb|ABC47859.1| membrane protein-like protein [Glycine max]
 gb|KHN22333.1| hypothetical protein glysoja_022089 [Glycine soja]
Length=491

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++A     AER LK +        +   V  +++  +F     E   + VWPEMK
Sbjct  21   VSWSLIMAYNVSLAERVLKDQKSESFVAKERQGV--MNSIIDFFRNDGEPTNDRVWPEMK  78

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GSI+GF GAA 
Sbjct  79   FGWRIVVGSIVGFFGAAL  96



>ref|XP_002460084.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
 gb|EER96605.1| hypothetical protein SORBIDRAFT_02g022510 [Sorghum bicolor]
Length=470

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  358  KKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            ++ ++  + V    ++       N +W+   + Y+HVWP M+  W+IVLGS+IGF GAAF
Sbjct  27   RRLSLVRAAVAPEEEMSLFRKVANLMWKSDGNSYQHVWPTMELGWQIVLGSLIGFFGAAF  86



>ref|XP_009631525.1| PREDICTED: uncharacterized protein LOC104121277 [Nicotiana tomentosiformis]
Length=480

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 40/78 (51%), Gaps = 2/78 (3%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I W     +   +AER LK E      V       +       +W   +S YEHVWPEMK
Sbjct  25   ICWGLFTISDVGNAERLLKTEE-PTYVVEKEMRQGFALRLLRLMWN-GKSSYEHVWPEMK  82

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+I++GSI+GF GAA 
Sbjct  83   FGWRIIVGSIVGFFGAAL  100



>gb|KJB18684.1| hypothetical protein B456_003G065000 [Gossypium raimondii]
Length=461

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query  256  MAGVRGK-WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            M   R K W L+   +++   F++ +  V+AE S        S+     + +Y+     F
Sbjct  1    MLAARSKVWWLIFTAITMIGFFVVVSALVAAEPS--------SSPNQAPENNYVRKAFKF  52

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            L   +   YEH WP+M+F W+IV+GS++GFLGAAF
Sbjct  53   LELNNRQRYEHQWPDMRFCWQIVVGSVLGFLGAAF  87



>gb|KJB18685.1| hypothetical protein B456_003G065000 [Gossypium raimondii]
Length=474

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +1

Query  256  MAGVRGK-WRLLRPLMSISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNF  432
            M   R K W L+   +++   F++ +  V+AE S        S+     + +Y+     F
Sbjct  14   MLAARSKVWWLIFTAITMIGFFVVVSALVAAEPS--------SSPNQAPENNYVRKAFKF  65

Query  433  LWQPSESGYEHVWPEMKFDWKIVLGSIIGFLGAAF  537
            L   +   YEH WP+M+F W+IV+GS++GFLGAAF
Sbjct  66   LELNNRQRYEHQWPDMRFCWQIVVGSVLGFLGAAF  100



>gb|ACU23197.1| unknown [Glycine max]
Length=261

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 2/78 (3%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            +SWS ++A     AER LK +        +   V  +++  +F     E   + VWPEM+
Sbjct  21   VSWSLIMAYNVSLAERVLKDQKSESFVAKERQGV--MNSIIDFFRNDGEPTNDRVWPEME  78

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W+IV+GSI+GF GAA 
Sbjct  79   FGWRIVVGSIVGFFGAAL  96



>ref|XP_009784620.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784621.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784622.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009784623.1| PREDICTED: uncharacterized protein LOC104233015 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMK  483
            I +  L  A+F SAE+   + ++  +   D  +  Y     N + Q  +  Y H WPE++
Sbjct  19   IGFLVLAFALFASAEQIGIRGSLDKNGTADDFESGYFVKLFNLMLQKGKMHYHHFWPELE  78

Query  484  FDWKIVLGSIIGFLGAAF  537
            F W++++GS+IGF  AAF
Sbjct  79   FGWRVIVGSVIGFFAAAF  96



>ref|NP_001061712.1| Os08g0387200 [Oryza sativa Japonica Group]
 dbj|BAD05436.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23626.1| Os08g0387200 [Oryza sativa Japonica Group]
 gb|EAZ42600.1| hypothetical protein OsJ_27163 [Oryza sativa Japonica Group]
Length=469

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  406  DYLSAFTNFLWQPS-ESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
             +L    NFLW+   E+ Y HVWP M+F W+IVLGS +GF+GAA
Sbjct  48   SHLRKVANFLWRSGGENSYHHVWPPMEFGWQIVLGSFVGFIGAA  91



>ref|XP_004504240.1| PREDICTED: uncharacterized protein LOC101507837 isoform X2 [Cicer 
arietinum]
Length=441

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 8/72 (11%)
 Frame = +1

Query  322  LAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIV  501
            L  + +SA  +  +E    SNVT+  D +      N     ++  Y HVWP+MKF W+I+
Sbjct  22   LLPIILSAYVTSSQETTPPSNVTNGVDGN-----NN---HHAQELYHHVWPKMKFGWRII  73

Query  502  LGSIIGFLGAAF  537
            +G+IIGFLG+AF
Sbjct  74   VGTIIGFLGSAF  85



>ref|XP_004504239.1| PREDICTED: uncharacterized protein LOC101507837 isoform X1 [Cicer 
arietinum]
Length=467

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 8/72 (11%)
 Frame = +1

Query  322  LAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWKIV  501
            L  + +SA  +  +E    SNVT+  D +      N     ++  Y HVWP+MKF W+I+
Sbjct  22   LLPIILSAYVTSSQETTPPSNVTNGVDGN-----NN---HHAQELYHHVWPKMKFGWRII  73

Query  502  LGSIIGFLGAAF  537
            +G+IIGFLG+AF
Sbjct  74   VGTIIGFLGSAF  85



>gb|KHN06459.1| hypothetical protein glysoja_010803 [Glycine soja]
Length=459

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 7/74 (9%)
 Frame = +1

Query  316  FLLAAVFVSAERSLKKEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEMKFDWK  495
            FLL +V V++      +    S   D   VD      N         Y+H WPEMKF WK
Sbjct  24   FLLVSVHVASSHQNTDQKPVSSPSNDTRGVDTNGHHANGF-------YKHTWPEMKFGWK  76

Query  496  IVLGSIIGFLGAAF  537
            I++GS+IGFLG+AF
Sbjct  77   IIVGSLIGFLGSAF  90



>ref|XP_006369186.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
 gb|ERP65755.1| hypothetical protein POPTR_0001s18380g [Populus trichocarpa]
Length=436

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  445  SESGYEHVWPEMKFDWKIVLGSIIGFLGAA  534
            S+SGY+HVWP+MKF WK V+G+II FLGAA
Sbjct  62   SQSGYKHVWPDMKFGWKTVVGTIITFLGAA  91



>ref|XP_004509250.1| PREDICTED: uncharacterized protein LOC101512581 [Cicer arietinum]
Length=472

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +1

Query  304  ISWSFLLAAVFVSAERSLK-KEAIGGSNVTDYSDVDYLSAFTNFLWQPSESGYEHVWPEM  480
            +SWS ++      AER L+ KE+     + +      ++   +F     +S Y+ VWPEM
Sbjct  17   VSWSLIMIYHVSLAERILEDKESENLVIMKERQGGVIINRVIDFFSYSGKSSYDRVWPEM  76

Query  481  KFDWKIVLGSIIGFLGAAF  537
            KF W+IV+GSI+GF GAA 
Sbjct  77   KFGWRIVVGSIVGFFGAAL  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335