BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF032B13

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGV54749.1|  ubiquitin 11                                            382   7e-131   Phaseolus vulgaris [French bean]
emb|CBI22349.3|  unnamed protein product                                382   2e-130   Vitis vinifera
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             380   4e-130   Brachypodium distachyon [annual false brome]
gb|AEZ49160.1|  polyubiquitin                                           380   7e-130   Wolffia australiana
gb|AFW66442.1|  putative ubiquitin family protein                       377   1e-129   
ref|XP_003626479.1|  Ubiquitin-like protein                             379   1e-129   
ref|XP_003590494.1|  Ubiquitin                                          381   1e-129   
gb|AEW46688.1|  polyubiquitin                                           377   2e-129   Ulva linza
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             377   2e-129   
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    378   2e-129   
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             377   3e-129   Brachypodium distachyon [annual false brome]
emb|CDP08567.1|  unnamed protein product                                382   3e-129   Coffea canephora [robusta coffee]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             378   3e-129   
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             380   3e-129   
gb|AAO43307.1|  putative polyubiquitin                                  377   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             377   3e-129   Elaeis guineensis
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   377   3e-129   Camelina sativa [gold-of-pleasure]
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                377   3e-129   Erythranthe guttata [common monkey flower]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             384   3e-129   Phaseolus vulgaris [French bean]
ref|XP_002317213.1|  polyubiquitin family protein                       377   4e-129   Populus trichocarpa [western balsam poplar]
dbj|BAC57955.1|  polyubiquitin                                          377   4e-129   Tripolium pannonicum [sea starwort]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             377   4e-129   
gb|AET06143.1|  ubiquitin                                               377   4e-129   Papaver somniferum
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      376   4e-129   Setaria italica
gb|KJB36627.1|  hypothetical protein B456_006G167800                    376   4e-129   Gossypium raimondii
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    384   4e-129   
gb|ACJ85618.1|  unknown                                                 376   4e-129   Medicago truncatula
ref|NP_567286.1|  ubiquitin 11                                          376   5e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   376   5e-129   Citrus sinensis [apfelsine]
emb|CAH59739.1|  polyubiquitin                                          376   6e-129   Plantago major [cart-track plant]
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          376   6e-129   Sorghum bicolor [broomcorn]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             376   6e-129   Citrus clementina [clementine]
gb|AAP31578.1|  ubiquitin                                               376   7e-129   Hevea brasiliensis [jebe]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   376   7e-129   Citrus sinensis [apfelsine]
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                380   7e-129   
gb|AGV54228.1|  polyubiquitin-like protein                              382   8e-129   Phaseolus vulgaris [French bean]
gb|AFK41706.1|  unknown                                                 376   8e-129   Medicago truncatula
ref|XP_007512209.1|  polyubiquitin                                      380   1e-128   Bathycoccus prasinos
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      379   1e-128   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    385   1e-128   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             378   1e-128   
gb|AIY27743.1|  polyubiquitin Ubi10                                     379   1e-128   Betula luminifera [liang ye hua]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             378   1e-128   
gb|KJB62484.1|  hypothetical protein B456_009G418900                    375   1e-128   Gossypium raimondii
gb|AES89865.2|  polyubiquitin 3                                         377   1e-128   Medicago truncatula
gb|ABY60454.1|  putative polyubiquitin                                  377   1e-128   Adonis aestivalis var. palaestina
ref|XP_003627152.1|  Ubiquitin                                          377   2e-128   
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                378   2e-128   Erythranthe guttata [common monkey flower]
emb|CAA40323.1|  polyubiquitin protein                                  379   2e-128   Helianthus annuus
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      379   2e-128   Brachypodium distachyon [annual false brome]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      378   2e-128   Brassica rapa
ref|XP_007014924.1|  Polyubiquitin 3                                    378   2e-128   Theobroma cacao [chocolate]
gb|ABK94002.1|  unknown                                                 378   2e-128   Populus trichocarpa [western balsam poplar]
gb|AAO43308.1|  putative polyubiquitin                                  375   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           377   2e-128   Fragaria vesca subsp. vesca
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          377   2e-128   Sorghum bicolor [broomcorn]
dbj|BAJ85978.1|  predicted protein                                      377   2e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACJ85643.1|  unknown                                                 375   2e-128   Medicago truncatula
ref|NP_849292.1|  polyubiquitin 14                                      377   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           377   2e-128   Brassica rapa
gb|AAC35858.1|  polyubiquitin                                           376   2e-128   Capsicum chinense [bonnet pepper]
emb|CAA48140.1|  ubiquitin                                              377   2e-128   Antirrhinum majus [garden snapdragon]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      377   2e-128   Oryza brachyantha
gb|AES89866.2|  polyubiquitin 3                                         377   2e-128   Medicago truncatula
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         378   2e-128   Jatropha curcas
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             377   2e-128   
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      377   2e-128   Citrus sinensis [apfelsine]
prf||1604470A  poly-ubiquitin                                           376   2e-128
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    374   2e-128   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             375   2e-128   Citrus clementina [clementine]
gb|ABD96088.1|  polyubiquitin                                           376   2e-128   Malus domestica [apple tree]
emb|CAH59740.1|  polyubiquitin                                          377   2e-128   Plantago major [cart-track plant]
ref|NP_851029.1|  polyubiquitin 3                                       377   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             377   2e-128   Citrus clementina [clementine]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    377   3e-128   Gossypium raimondii
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             377   3e-128   
gb|EPS72031.1|  polyubiquitin                                           376   3e-128   Genlisea aurea
emb|CDP08569.1|  unnamed protein product                                377   3e-128   Coffea canephora [robusta coffee]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             377   3e-128   Citrus clementina [clementine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      377   3e-128   Glycine max [soybeans]
gb|AFK43392.1|  unknown                                                 375   3e-128   Medicago truncatula
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             377   3e-128   
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           377   3e-128   Nelumbo nucifera [Indian lotus]
gb|ABI84246.1|  polyubiquitin 10                                        373   3e-128   Arachis hypogaea [goober]
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             377   3e-128   Citrus clementina [clementine]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             381   3e-128   
gb|AAQ84316.1|  fiber polyubiquitin                                     374   3e-128   Gossypium barbadense [Egyptian cotton]
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           382   3e-128   Eucalyptus grandis [rose gum]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            376   3e-128   Phaseolus vulgaris [French bean]
gb|AAM64530.1|  ubiquitin homolog                                       374   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             377   3e-128   
emb|CAA54603.1|  pentameric polyubiquitin                               379   4e-128   Nicotiana tabacum [American tobacco]
ref|XP_006685644.1|  ubiquitin                                          374   4e-128   Yamadazyma tenuis ATCC 10573
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         378   4e-128   
emb|CBY46745.1|  polyubiquitin 10 protein                               377   4e-128   Lepidium appelianum [hairy whitetop]
gb|AAB95250.1|  ubiquitin                                               377   4e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         377   5e-128   Jatropha curcas
gb|KJB14874.1|  hypothetical protein B456_002G147600                    378   5e-128   Gossypium raimondii
gb|ADD52202.1|  ubiquitin                                               379   6e-128   Catharanthus roseus [chatas]
gb|KJB62487.1|  hypothetical protein B456_009G418900                    377   6e-128   Gossypium raimondii
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    377   6e-128   Phoenix dactylifera
gb|AFW66439.1|  putative ubiquitin family protein                       376   6e-128   
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      376   7e-128   Camelina sativa [gold-of-pleasure]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    376   7e-128   Linum usitatissimum
gb|KDB11907.1|  ubiquitin                                               376   7e-128   Ustilaginoidea virens
gb|AAO43309.1|  putative polyubiquitin                                  374   7e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   373   7e-128   Piloderma croceum F 1598
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            376   8e-128   Phaseolus vulgaris [French bean]
gb|AHC00631.1|  polyubiquitin                                           377   9e-128   Ganoderma lucidum
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 373   1e-127   Dacryopinax primogenitus
ref|XP_011110054.1|  hypothetical protein H072_4094                     373   1e-127   
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  373   1e-127   Hypholoma sublateritium FD-334 SS-4
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  373   1e-127   Piloderma croceum F 1598
gb|AFY06654.1|  polyubiquitin                                           374   1e-127   Carica papaya [mamon]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  374   1e-127   Pisolithus microcarpus 441
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             376   1e-127   Capsella rubella
emb|CEF99839.1|  Ubiquitin conserved site                               377   1e-127   Ostreococcus tauri
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           376   1e-127   Elaeis guineensis
ref|XP_006381473.1|  polyubiquitin family protein                       375   1e-127   
dbj|GAK65396.1|  ubiquitin                                              377   1e-127   Moesziomyces antarcticus
ref|XP_002872109.1|  predicted protein                                  378   2e-127   
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                375   2e-127   Serpula lacrymans var. lacrymans S7.3
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             372   2e-127   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   375   2e-127   Amanita muscaria Koide BX008
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            371   2e-127   Phaseolus vulgaris [French bean]
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                378   2e-127   
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      375   2e-127   Camelina sativa [gold-of-pleasure]
gb|KJB62485.1|  hypothetical protein B456_009G418900                    375   2e-127   Gossypium raimondii
ref|NP_001105376.1|  polyubiquitin                                      378   2e-127   
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    375   2e-127   Populus euphratica
gb|ABU40645.1|  polyubiquitin                                           378   2e-127   Triticum aestivum [Canadian hard winter wheat]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    379   2e-127   Gossypium raimondii
gb|AIS71924.1|  polyubiquitin                                           372   2e-127   Mangifera indica
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                378   2e-127   Erythranthe guttata [common monkey flower]
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             375   2e-127   Exserohilum turcica Et28A
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             378   2e-127   Eutrema salsugineum [saltwater cress]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         378   2e-127   Elaeis guineensis
gb|EWZ40370.1|  ubiquitin C                                             372   2e-127   Fusarium oxysporum Fo47
gb|ACD31680.1|  ubiquitin                                               375   2e-127   Gossypium hirsutum [American cotton]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      378   2e-127   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        378   2e-127   
emb|CBY46746.1|  polyubiquitin 10 protein                               378   2e-127   Lepidium campestre [bastard cress]
ref|NP_001174480.1|  Os05g0504766                                       378   2e-127   
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      378   2e-127   Tarenaya hassleriana [spider flower]
gb|AAB95252.1|  ubiquitin                                               378   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001420612.1|  predicted protein                                  378   2e-127   Ostreococcus lucimarinus CCE9901
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                379   2e-127   Pyrus x bretschneideri [bai li]
gb|ACS68205.1|  ubiquitin 10.2                                          378   2e-127   Brassica napus [oilseed rape]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     378   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         378   2e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    378   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             378   2e-127   
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     372   2e-127   Rhodotorula toruloides
ref|NP_001148453.1|  LOC100282068                                       378   2e-127   Zea mays [maize]
ref|NP_568397.1|  ubiquitin 4                                           378   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849300.4|  polyubiquitin 10                                      378   2e-127   Arabidopsis thaliana [mouse-ear cress]
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    377   2e-127   Nicotiana sylvestris
gb|AAK68824.1|  Unknown protein                                         372   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      375   2e-127   Camelina sativa [gold-of-pleasure]
gb|AAX40652.1|  polyubiquitin                                           378   2e-127   Oryza sativa Japonica Group [Japonica rice]
emb|CDP05795.1|  unnamed protein product                                378   2e-127   Coffea canephora [robusta coffee]
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    378   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002508175.1|  ubiquitin                                          378   3e-127   Micromonas commoda
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             378   3e-127   
gb|AAY86773.1|  polyubiquitin                                           378   3e-127   Noccaea caerulescens
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                378   3e-127   Erythranthe guttata [common monkey flower]
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         377   3e-127   Nicotiana tomentosiformis
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    377   3e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             372   3e-127   Selaginella moellendorffii
gb|KJB81825.1|  hypothetical protein B456_013G163500                    377   3e-127   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      377   3e-127   Nicotiana sylvestris
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      377   3e-127   Nicotiana tomentosiformis
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    377   3e-127   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             377   3e-127   Capsella rubella
gb|AAB68045.1|  polyubiquitin                                           377   3e-127   Fragaria x ananassa
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  372   3e-127   Paxillus rubicundulus Ve08.2h10
dbj|BAL61087.1|  polyubiquitin                                          372   3e-127   Dianthus caryophyllus [carnation]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           374   3e-127   Nicotiana tomentosiformis
ref|NP_001053957.1|  Os04g0628100                                       378   3e-127   
gb|ADO60140.1|  ubiquitin                                               371   4e-127   Beauveria bassiana
gb|AAB36545.1|  ubiquitin-like protein                                  378   4e-127   Phaseolus vulgaris [French bean]
gb|KJB13592.1|  hypothetical protein B456_002G083000                    377   4e-127   Gossypium raimondii
emb|CCL99875.1|  predicted protein                                      375   4e-127   Fibroporia radiculosa
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      377   4e-127   Nelumbo nucifera [Indian lotus]
ref|XP_001783045.1|  predicted protein                                  372   4e-127   
gb|EMS65864.1|  Polyubiquitin                                           378   4e-127   Triticum urartu
ref|XP_001755431.1|  predicted protein                                  371   4e-127   
gb|KIY53974.1|  polyubiquitin                                           374   4e-127   Fistulina hepatica ATCC 64428
gb|AAQ07453.1|  ubiquitin                                               377   4e-127   Musa acuminata AAA Group [Cavendish banana]
emb|CCT70325.1|  UBI4-Ubiquitin                                         373   4e-127   Fusarium fujikuroi IMI 58289
ref|XP_003030030.1|  polyubiquitin                                      374   4e-127   Schizophyllum commune H4-8
gb|KIY45417.1|  ubiquitin                                               374   5e-127   Fistulina hepatica ATCC 64428
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   374   5e-127   Sphaerobolus stellatus SS14
ref|XP_001555417.1|  polyubiquitin                                      374   5e-127   Botrytis cinerea B05.10
gb|AGZ15412.1|  fiber polyubiquitin                                     371   5e-127   Phaseolus vulgaris [French bean]
gb|KIR29996.1|  polyubiquitin                                           374   5e-127   Cryptococcus gattii VGII LA55
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 374   5e-127   Scleroderma citrinum Foug A
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      377   5e-127   Nicotiana tomentosiformis
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    377   5e-127   Hebeloma cylindrosporum h7
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  375   5e-127   Plicaturopsis crispa FD-325 SS-3
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      379   5e-127   Camelina sativa [gold-of-pleasure]
ref|XP_003082269.1|  polyubiquitin (ISS)                                373   5e-127   
gb|KEH31155.1|  polyubiquitin 3                                         377   6e-127   Medicago truncatula
gb|KIR63773.1|  polyubiquitin                                           374   6e-127   Cryptococcus gattii CA1873
ref|XP_007763327.1|  polyubiquitin                                      374   6e-127   Coniophora puteana RWD-64-598 SS2
ref|XP_001828882.1|  ubiquitin C                                        374   6e-127   Coprinopsis cinerea okayama7#130
ref|XP_007339454.1|  ubiquitin                                          374   6e-127   
ref|XP_001931824.1|  ubiquitin                                          371   6e-127   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001764949.1|  predicted protein                                  374   7e-127   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    377   7e-127   Gossypium raimondii
ref|XP_007366816.1|  polyubiquitin                                      374   7e-127   Dichomitus squalens LYAD-421 SS1
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  374   7e-127   Botryobasidium botryosum FD-172 SS1
ref|XP_003619702.1|  Ubiquitin-like protein                             371   8e-127   
gb|EPX74297.1|  ubiquitin                                               370   8e-127   Schizosaccharomyces octosporus yFS286
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              370   9e-127   Pseudocercospora fijiensis CIRAD86
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  370   9e-127   Naumovozyma dairenensis CBS 421
ref|XP_001598085.1|  polyubiquitin                                      373   9e-127   Sclerotinia sclerotiorum 1980 UF-70
emb|CAB81074.1|  polyubiquitin (ubq10)                                  379   1e-126   Arabidopsis thaliana [mouse-ear cress]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     370   1e-126   Lachancea lanzarotensis
ref|XP_002953480.1|  polyubiquitin                                      373   1e-126   Volvox carteri f. nagariensis
ref|XP_002551324.1|  ubiquitin                                          373   1e-126   Candida tropicalis MYA-3404
gb|ACJ85658.1|  unknown                                                 370   1e-126   Medicago truncatula
ref|XP_719867.1|  hypothetical protein CaO19.6771                       370   1e-126   Candida albicans SC5314
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          379   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    370   1e-126   Parastagonospora nodorum SN15
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    375   2e-126   Setaria italica
ref|XP_003052575.1|  predicted protein                                  373   2e-126   [Nectria] haematococca mpVI 77-13-4
gb|AFK47245.1|  unknown                                                 370   2e-126   Medicago truncatula
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             373   2e-126   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           378   2e-126   Nicotiana sylvestris
gb|AIS40894.1|  polyubiquitin                                           379   2e-126   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_001755307.1|  predicted protein                                  372   2e-126   
ref|XP_006372519.1|  polyubiquitin family protein                       372   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             378   2e-126   Prunus persica
gb|AAD03343.1|  ubiquitin                                               378   2e-126   Pisum sativum [garden pea]
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                378   2e-126   Erythranthe guttata [common monkey flower]
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    378   2e-126   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      378   2e-126   Setaria italica
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  370   2e-126   Paxillus rubicundulus Ve08.2h10
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         378   2e-126   Jatropha curcas
dbj|BAK03691.1|  predicted protein                                      378   2e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001045980.1|  Os02g0161900                                       378   2e-126   
gb|AAB95251.1|  ubiquitin                                               378   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           378   3e-126   
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    378   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           378   3e-126   Camelina sativa [gold-of-pleasure]
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          378   3e-126   Sorghum bicolor [broomcorn]
gb|AAC16012.1|  polyubiquitin                                           378   3e-126   Elaeagnus umbellata [aki-gumi]
emb|CAA40324.1|  hexaubiquitin protein                                  378   3e-126   Helianthus annuus
gb|ACN40936.1|  unknown                                                 378   3e-126   Picea sitchensis
gb|AAO43310.1|  putative polyubiquitin                                  370   3e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAC67552.1|  polyubiquitin                                           375   3e-126   Saccharum hybrid cultivar H32-8560
ref|NP_849299.4|  polyubiquitin 10                                      378   3e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049060.1|  Polyubiquitin 10                                   377   3e-126   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      378   3e-126   Sesamum indicum [beniseed]
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           378   3e-126   Sesamum indicum [beniseed]
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   377   3e-126   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      377   3e-126   
ref|XP_002888365.1|  polyubiquitin                                      377   3e-126   Arabidopsis lyrata subsp. lyrata
gb|KJB13590.1|  hypothetical protein B456_002G083000                    378   3e-126   Gossypium raimondii
dbj|BAK02501.1|  predicted protein                                      377   3e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             377   3e-126   
dbj|BAJ91912.1|  predicted protein                                      377   4e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CCG34086.1|  Polyubiquitin                                          372   4e-126   uncultured eukaryote
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             374   4e-126   Phaseolus vulgaris [French bean]
gb|AGT38457.1|  polyubiquitin                                           378   4e-126   Oryza sativa Japonica Group [Japonica rice]
gb|KJB81827.1|  hypothetical protein B456_013G163500                    377   4e-126   Gossypium raimondii
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           377   4e-126   Nicotiana sylvestris
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   369   4e-126   Brassica rapa
ref|XP_001830230.1|  ubiquitin                                          372   4e-126   Coprinopsis cinerea okayama7#130
gb|AFW70219.1|  polyubiquitin-like protein                              379   4e-126   
ref|XP_002891806.1|  predicted protein                                  375   4e-126   
ref|XP_002842034.1|  hypothetical protein                               372   4e-126   Tuber melanosporum Mel28
ref|XP_002494205.1|  Ubiquitin                                          372   4e-126   Komagataella phaffii GS115
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      374   4e-126   Nelumbo nucifera [Indian lotus]
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                374   5e-126   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           377   5e-126   Nelumbo nucifera [Indian lotus]
ref|XP_001210780.1|  ubiquitin                                          372   5e-126   Aspergillus terreus NIH2624
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                374   5e-126   Serpula lacrymans var. lacrymans S7.3
ref|XP_001227036.1|  polyubiquitin                                      372   5e-126   
gb|EGA57707.1|  Ubi4p                                                   369   5e-126   
gb|ACX46987.1|  ubiquitin                                               376   5e-126   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                377   5e-126   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                377   6e-126   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 374   6e-126   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  374   6e-126   
gb|AFD53810.1|  ubiquitin                                               370   6e-126   
gb|EMS60894.1|  Polyubiquitin                                           377   6e-126   
ref|XP_001880135.1|  ubiquitin                                          374   6e-126   
gb|AFR98116.1|  polyubiquitin                                           374   6e-126   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    374   6e-126   
gb|EUC59758.1|  polyubiquitin                                           374   6e-126   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    377   6e-126   
gb|KEZ40313.1|  Polyubiquitin                                           371   6e-126   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         371   6e-126   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  374   7e-126   
ref|XP_002839703.1|  hypothetical protein                               371   7e-126   
gb|EJU00136.1|  ubiquitin                                               374   7e-126   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    374   7e-126   
gb|AAV65292.1|  polyubiquitin                                           371   7e-126   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  374   7e-126   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             374   7e-126   
gb|KIW56414.1|  polyubiquitin                                           371   7e-126   
ref|XP_007864655.1|  ubiquitin                                          374   7e-126   
ref|XP_003196661.1|  ATP-dependent protein binding protein              374   7e-126   
dbj|BAP70433.1|  Ubiquitin                                              371   7e-126   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  374   7e-126   
ref|XP_002888394.1|  hexaubiquitin protein                              377   7e-126   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      377   8e-126   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    374   8e-126   
ref|XP_010756991.1|  polyubiquitin                                      371   8e-126   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      374   8e-126   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   368   8e-126   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     371   8e-126   
gb|EEH20847.2|  polyubiquitin                                           371   8e-126   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      371   9e-126   
ref|XP_002419618.1|  ubiquitin, putative                                371   9e-126   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  368   1e-125   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    368   1e-125   
gb|KIY97628.1|  ubiquitin C                                             371   1e-125   
gb|EEH07231.1|  ubiquitin                                               370   1e-125   
ref|XP_659604.1|  hypothetical protein AN2000.2                         371   1e-125   
gb|AAA82978.1|  polyubiquitin                                           373   1e-125   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    385   1e-125   
gb|EEQ88150.1|  ubiquitin                                               370   1e-125   
emb|CAA52290.1|  polyubiquitin                                          373   1e-125   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             373   2e-125   
ref|XP_002791169.1|  ubiquitin                                          370   2e-125   
gb|ACA58351.1|  ubiquitin-like protein                                  366   2e-125   
gb|AEH41483.1|  ubiquitin                                               370   2e-125   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    367   2e-125   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             373   2e-125   
ref|XP_005644220.1|  polyubiquitin                                      370   2e-125   
gb|AAY33920.2|  polyubiquitin                                           373   2e-125   
gb|EZF98642.1|  polyubiquitin                                           367   2e-125   
emb|CAA51679.1|  ubiquitin                                              378   2e-125   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  370   2e-125   
ref|XP_004341200.1|  polyubiquitin, putative                            367   2e-125   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    378   2e-125   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           378   2e-125   
dbj|BAL61084.1|  polyubiqutin                                           373   2e-125   
ref|XP_007808982.1|  ubiquitin                                          371   2e-125   
gb|AAP80689.1|  polyubiquitin                                           367   2e-125   
ref|XP_001777816.1|  predicted protein                                  372   2e-125   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              378   2e-125   
emb|CCO30833.1|  Polyubiquitin                                          374   2e-125   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  370   2e-125   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    378   3e-125   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                378   3e-125   
tpd|FAA00317.1|  TPA: polyubiquitin                                     370   3e-125   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      378   3e-125   
gb|AFW66445.1|  ubiquitin2                                              378   3e-125   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           378   3e-125   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    370   3e-125   
dbj|GAA27344.2|  polyubiquitin-A                                        369   3e-125   
dbj|GAA87419.1|  polyubiquitin                                          370   3e-125   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           378   3e-125   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                378   3e-125   
ref|XP_003608276.1|  Ubiquitin                                          378   3e-125   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      378   3e-125   
emb|CCA16073.1|  polyubiquitin putative                                 378   3e-125   
gb|ABD32351.2|  Ubiquitin                                               378   3e-125   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    378   3e-125   
ref|XP_003607670.1|  Ubiquitin                                          377   3e-125   
ref|XP_001538486.1|  polyubiquitin                                      369   3e-125   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                377   3e-125   
ref|XP_003627151.1|  Ubiquitin                                          377   3e-125   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          377   4e-125   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           378   4e-125   
gb|AAO43306.1|  putative polyubiquitin                                  370   4e-125   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   366   4e-125   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              367   4e-125   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                372   4e-125   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    377   4e-125   
ref|XP_001246797.1|  polyubiquitin                                      369   5e-125   
gb|KHJ83418.1|  ubiquitin family protein                                366   5e-125   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     377   5e-125   
ref|NP_013061.1|  ubiquitin                                             372   5e-125   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       372   5e-125   
gb|ELR08709.1|  polyubiquitin                                           372   6e-125   
ref|XP_008034069.1|  ubiquitin 10.1                                     374   6e-125   
gb|EPS29015.1|  hypothetical protein PDE_03961                          369   6e-125   
gb|AAO43305.1|  putative polyubiquitin                                  369   6e-125   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      377   6e-125   
ref|XP_007307433.1|  polyubiquitin                                      374   6e-125   
dbj|BAK61744.1|  ubiquitin                                              366   6e-125   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            367   7e-125   
ref|XP_007861169.1|  polyubiquitin                                      374   7e-125   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  372   7e-125   
tpd|FAA00319.1|  TPA: polyubiquitin                                     374   7e-125   
ref|XP_011275993.1|  ubiquitin C                                        371   7e-125   
ref|XP_011388891.1|  putative ubiquitin                                 374   7e-125   
ref|XP_567862.1|  ATP-dependent protein binding protein                 374   7e-125   
tpd|FAA00316.1|  TPA: polyubiquitin                                     371   8e-125   
ref|XP_453980.1|  hypothetical protein                                  371   8e-125   
gb|KFY10578.1|  hypothetical protein V492_04946                         373   8e-125   
gb|ACB87916.1|  polyubiquitin 1                                         365   9e-125   
ref|NP_983342.1|  ACL062Cp                                              371   9e-125   
gb|KFY77115.1|  hypothetical protein V499_03430                         371   9e-125   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    370   9e-125   
ref|XP_002171731.1|  ubiquitin                                          371   9e-125   
gb|EMS24129.1|  ubiquitin C                                             366   9e-125   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             371   1e-124   
gb|AAL91103.1|  ubiquitin                                               367   1e-124   
dbj|BAO38900.1|  ubiquitin                                              371   1e-124   
ref|NP_595409.1|  ubiquitin                                             371   1e-124   
ref|XP_001766873.1|  predicted protein                                  370   1e-124   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          365   1e-124   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         369   1e-124   
gb|KDR10312.1|  Ubiquitin                                               365   1e-124   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   374   1e-124   
ref|XP_958803.1|  ubiquitin                                             368   1e-124   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        365   1e-124   
dbj|BAH71115.1|  ACYPI006410                                            365   1e-124   
ref|XP_002627625.1|  ubiquitin                                          371   1e-124   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          365   1e-124   
gb|AAF04147.1|  ubiquitin precursor                                     370   1e-124   
gb|ETN78467.1|  ubiquitin family protein                                365   2e-124   
dbj|GAA55031.1|  ubiquitin C                                            365   2e-124   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     365   2e-124   
ref|XP_005831810.1|  ubiquitin                                          365   2e-124   
ref|XP_002553736.1|  KLTH0E05852p                                       371   2e-124   
ref|XP_001774326.1|  predicted protein                                  373   2e-124   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             373   2e-124   
dbj|BAK61751.1|  ubiquitin                                              364   2e-124   
gb|KIZ01427.1|  ubiquitin C                                             370   2e-124   
emb|CDI53149.1|  probable Polyubiquitin protein                         367   2e-124   
ref|XP_003331105.1|  polyubiquitin-A                                    378   3e-124   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      377   3e-124   
gb|KHN45015.1|  Polyubiquitin-A                                         377   3e-124   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      378   3e-124   
emb|CEL52635.1|  Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-...    375   3e-124   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           375   3e-124   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         377   3e-124   
ref|NP_176714.4|  ubiquitin 13                                          367   3e-124   
gb|AAC13691.1|  poly-ubiquitin                                          369   4e-124   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           367   4e-124
gb|ADD24466.1|  Ubiquitin                                               363   4e-124   
gb|AAO43304.1|  putative polyubiquitin                                  367   5e-124   
emb|CAD27944.1|  polyubiquitin-like                                     363   5e-124   
gb|KHN74847.1|  Polyubiquitin-A                                         370   5e-124   
ref|XP_004365491.1|  polyubiquitin 5                                    363   5e-124   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       364   6e-124   
gb|ABV22331.1|  ubiquitin                                               366   6e-124   
ref|XP_460488.1|  DEHA2F02816p                                          372   6e-124   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              364   6e-124   
gb|AAO43303.1|  putative polyubiquitin                                  367   7e-124   
ref|XP_002498336.1|  ZYRO0G07854p                                       372   7e-124   
emb|CDP08561.1|  unnamed protein product                                377   7e-124   
ref|XP_008510526.1|  PREDICTED: polyubiquitin-B                         367   7e-124   
gb|ACH45547.1|  putative ubiquitin C variant 1                          362   8e-124   
gb|EMS54972.1|  Polyubiquitin-A                                         378   8e-124   
ref|XP_001486573.1|  ubiquitin                                          371   8e-124   
gb|ABI53721.1|  polyubiquitin                                           371   9e-124   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   375   9e-124   
emb|CAX72420.1|  polyubiquitin                                          364   9e-124   
gb|EJD76734.1|  polyubiquitin, variant 2                                366   9e-124   
tpg|DAA34473.1|  TPA: ubiquitin                                         363   1e-123   
emb|CAA30815.1|  unnamed protein product                                362   1e-123   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         365   1e-123   
emb|CAJ41447.1|  polyubiquitin                                          365   1e-123   
gb|AAL91109.1|  ubiquitin                                               365   1e-123   
ref|XP_003381625.1|  ubiquitin family protein                           363   1e-123   
gb|AGH70140.1|  ubiquitin family protein                                362   1e-123   
ref|XP_008161896.1|  PREDICTED: polyubiquitin-C                         362   1e-123   
ref|XP_008816966.1|  polyubiquitin                                      365   1e-123   
ref|XP_005650632.1|  hexaubiquitin protein                              371   1e-123   
ref|XP_005525793.1|  PREDICTED: polyubiquitin-C-like isoform X2         363   1e-123   
ref|XP_010293819.1|  PREDICTED: polyubiquitin-B isoform X15             364   1e-123   
ref|XP_007057723.1|  PREDICTED: polyubiquitin-C isoform X1              362   2e-123   
gb|ELU42015.1|  polyubiquitin                                           378   2e-123   
emb|CAX79692.1|  ubiquitin C                                            362   2e-123   
gb|EDM13555.1|  rCG21222, isoform CRA_a                                 364   2e-123   
dbj|BAE40351.1|  unnamed protein product                                364   2e-123   
ref|XP_010602597.1|  PREDICTED: polyubiquitin-C                         362   2e-123   
ref|XP_002964737.1|  hypothetical protein SELMODRAFT_270468             373   2e-123   
gb|ABF13286.1|  polyubiquitin                                           363   2e-123   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         361   2e-123   
gb|EFN76024.1|  Ubiquitin                                               362   2e-123   
ref|XP_001897032.1|  polyubiquitin precursor                            368   2e-123   
ref|XP_002723083.2|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    363   2e-123   
ref|XP_667472.1|  ubiquitin B                                           362   2e-123   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        377   2e-123   
ref|XP_005502111.1|  PREDICTED: polyubiquitin-C isoform X7              364   2e-123   
ref|XP_010177726.1|  PREDICTED: polyubiquitin-B isoform X5              363   2e-123   
ref|NP_061828.1|  polyubiquitin-B precursor                             362   2e-123   
ref|XP_004395987.1|  PREDICTED: polyubiquitin-B-like isoform 1          362   2e-123   
gb|ACL98140.1|  ubiquitin C variant                                     363   2e-123   
ref|XP_002674746.1|  polyubiquitin                                      362   2e-123   
ref|XP_008003373.1|  PREDICTED: polyubiquitin-C                         362   3e-123   
emb|CAJ32646.1|  ubiquitin                                              362   3e-123   
ref|XP_001761027.1|  predicted protein                                  373   3e-123   
gb|ABO84843.1|  ubiquitin B                                             361   3e-123   
sp|P42739.2|UBIQP_ACEPE  RecName: Full=Polyubiquitin; Contains: R...    369   3e-123   
emb|CDP08564.1|  unnamed protein product                                367   3e-123   
gb|ABF66639.1|  ubiquitin                                               365   3e-123   
gb|ELU06246.1|  hypothetical protein CAPTEDRAFT_186294                  362   3e-123   
ref|XP_008300055.1|  PREDICTED: polyubiquitin-B                         362   3e-123   
emb|CAX72421.1|  ubiquitin C                                            362   3e-123   
emb|CAX72428.1|  ubiquitin C                                            362   3e-123   



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   382 bits (982),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 202/234 (86%), Positives = 206/234 (88%), Gaps = 11/234 (5%)
 Frame = +1

Query  19   CSLNL----FYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  186
            C+ NL    +    HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  187  QQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  366
            QQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  139

Query  367  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  140  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  199

Query  547  LTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            LTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  200  LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  249


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 204/229 (89%), Gaps = 8/229 (3%)
 Frame = +1

Query  25   LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  132  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  191

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  192  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  236


 Score =   362 bits (929),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 191/205 (93%), Gaps = 5/205 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  92   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  146

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  147  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  206

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  207  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  266

Query  559  TITLEGESSDTIDNVKGQIQDKEGI  633
            TITLE ESSDTIDNVK +IQDKEG+
Sbjct  267  TITLEVESSDTIDNVKAKIQDKEGM  291



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   380 bits (977),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 203/231 (88%), Gaps = 12/231 (5%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +C L  F   R       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  12   MCDLEDFLECRKM-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  66

Query  196  LIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  67   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  126

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  127  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  186

Query  556  KTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  187  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  233


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   380 bits (977),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 199/220 (90%), Positives = 201/220 (91%), Gaps = 9/220 (4%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  229  RILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            R LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  588
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  134  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193

Query  589  TIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  194  TIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  229


 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 187/202 (93%), Gaps = 5/202 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEGESSDTIDNVKGQIQDK  624
            TITLE  SSDTIDNVK +IQDK
Sbjct  260  TITLEVASSDTIDNVKAKIQDK  281



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   377 bits (969),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 145/157 (92%), Gaps = 5/157 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  489
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   379 bits (974),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 200/215 (93%), Gaps = 7/215 (3%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILAD  243
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  604  KGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            K +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  227  KAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  257


 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/153 (99%), Positives = 151/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  125  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  185  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   381 bits (978),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  430  FAGKQLEDGRTLADYNIQKESTLHLV  507
            FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLV  222



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   377 bits (969),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/167 (92%), Positives = 155/167 (93%), Gaps = 5/167 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  519
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   377 bits (969),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   294 bits (753),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 153/166 (92%), Gaps = 5/166 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  516
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   378 bits (971),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   349 bits (895),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 183/198 (92%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGK  239

Query  559  TITLEGESSDTIDNVKGQ  612
            TITLE ESSDTIDNVK +
Sbjct  240  TITLEXESSDTIDNVKAK  257



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   377 bits (969),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   382 bits (981),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/231 (87%), Positives = 204/231 (88%), Gaps = 7/231 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +    L  +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  36   LTHWQLRSYLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  95

Query  196  LIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  96   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  155

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  156  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  215

Query  556  KTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  216  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  262


 Score =   378 bits (971),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  233  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  292

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  293  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  338


 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 142/154 (92%), Gaps = 5/154 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  194  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  248

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  249  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  308

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  480
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  309  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   378 bits (971),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   346 bits (888),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 181/194 (93%), Gaps = 5/194 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDN  600
            TITLE ESSDTIDN
Sbjct  240  TITLEVESSDTIDN  253



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   380 bits (975),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   359 bits (922),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 189/203 (93%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKE  627
            TITLE ESSDTIDNVK +IQDK+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKK  262



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   377 bits (969),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  184  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  229


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   270 bits (691),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 143/157 (91%), Gaps = 7/157 (4%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            NVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  121  NVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  153



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   377 bits (967),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   377 bits (967),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   377 bits (967),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   384 bits (986),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 206/232 (89%), Gaps = 8/232 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
              +L    H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  30   FIALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  89

Query  193  RLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            RLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  90   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  149

Query  373  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  552
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  150  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  209

Query  553  GKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            GKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  210  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  257


 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  228  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  287

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  288  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  333


 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  189  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  303

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  304  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  363

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  364  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  409


 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  265  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  379

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  380  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   376 bits (966),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   376 bits (966),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 201/226 (89%), Positives = 204/226 (90%), Gaps = 7/226 (3%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            E ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  387  EVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  428


 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   376 bits (966),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   376 bits (966),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   376 bits (966),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   376 bits (966),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 159/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   376 bits (966),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   376 bits (966),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   376 bits (965),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   376 bits (965),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   380 bits (976),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 199/231 (86%), Positives = 205/231 (89%), Gaps = 11/231 (5%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +  + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  21   VGRVELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  76

Query  196  LIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  77   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  136

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  137  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  196

Query  556  KTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  197  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  243


 Score =   378 bits (971),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  274  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  319


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   382 bits (980),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 203/222 (91%), Gaps = 9/222 (4%)
 Frame = +1

Query  49   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  222
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  223  DGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  402
            DGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  263

Query  403  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGES  582
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ES
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323

Query  583  SDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            SDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  324  SDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   374 bits (959),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (956),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   376 bits (965),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   380 bits (977),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  231  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  290

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  291  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  336


 Score =   356 bits (913),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 198/264 (75%), Gaps = 58/264 (22%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  174
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  175  --------------------------IPPDQQRLIFAGKQLEDGRILADYNIQKESTLHL  276
                                      IPPDQQRLIFAGKQLEDGR LADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIP  636
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIP
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240

Query  637  PDQXRAYLXRKTAGRM---GRTLA  699
            PDQ R       AG+    GRTLA
Sbjct  241  PDQQRLIF----AGKQLEDGRTLA  260


 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  192  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  246

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  247  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  306

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   379 bits (972),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 199/214 (93%), Gaps = 7/214 (3%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  607  GQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
             +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  262  AKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  291


 Score =   324 bits (830),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 183/219 (84%), Gaps = 13/219 (6%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR--ILAD  243
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  I + 
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  244  YNIQKESTLHLVL----RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            +     +    +       R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  120

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDT  591
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT
Sbjct  121  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  180

Query  592  IDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            IDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  IDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  215


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   385 bits (989),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 201/226 (89%), Positives = 204/226 (90%), Gaps = 7/226 (3%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            E ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  387  EVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  428


 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGES  582
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEG +
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGNN  466



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   378 bits (970),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (968),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 146/158 (92%), Gaps = 5/158 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  492
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEN  293



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   379 bits (974),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 205/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  63   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  117

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK
Sbjct  118  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  178  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  237

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  238  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  283


 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 190/213 (89%), Gaps = 9/213 (4%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLE ESSDT+DNVK 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  179  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  207


 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 183/197 (93%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  139  STLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  193

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  194  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  253

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  254  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  313

Query  559  TITLEGESSDTIDNVKG  609
            TITLE ESSDTIDNVK 
Sbjct  314  TITLEVESSDTIDNVKA  330



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   378 bits (971),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   375 bits (963),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/187 (92%), Positives = 175/187 (94%), Gaps = 5/187 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLEGES  582
            ITLEG +
Sbjct  241  ITLEGNN  247



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   377 bits (968),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/229 (87%), Positives = 204/229 (89%), Gaps = 12/229 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  116  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  175

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  176  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  220


 Score =   375 bits (962),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 196/211 (93%), Gaps = 5/211 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXR  651
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R
Sbjct  251  TITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   377 bits (967),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   331 bits (848),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 173/185 (94%), Gaps = 5/185 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLE  573
            TITLE
Sbjct  240  TITLE  244


 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 81/135 (60%), Gaps = 46/135 (34%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQK----------------------------------------  258
            IFAGKQLEDGR LADYNIQK                                        
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQ  255

Query  259  -ESTLHLVLRLRGGM  300
             ESTLHLVLRLRGG 
Sbjct  256  KESTLHLVLRLRGGF  270



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   352 bits (903),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 185/199 (93%), Gaps = 5/199 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQI  615
            TITLE ESSDTIDNVK +I
Sbjct  316  TITLEVESSDTIDNVKAKI  334



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   379 bits (973),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 199/214 (93%), Gaps = 7/214 (3%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  607  GQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
             +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  216  AKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  245


 Score =   379 bits (972),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  275

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  276  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  321


 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  291

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  292  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   373 bits (957),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   373 bits (957),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   375 bits (964),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  184  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  229


 Score =   296 bits (757),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 155/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 142/157 (90%), Gaps = 7/157 (4%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            NVK +IQDKE IPPDQ R       AG+    GRTLA
Sbjct  121  NVKAKIQDKEWIPPDQQRLIF----AGKQLEDGRTLA  153



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   375 bits (962),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  140  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  199

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  200  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  245


 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 158/173 (91%), Gaps = 7/173 (4%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  369
            QRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  549
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  550  TGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  121  TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  169



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   377 bits (968),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  171  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  230

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  231  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  276


 Score =   359 bits (921),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 189/204 (93%), Gaps = 7/204 (3%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIP  636
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIP
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180

Query  637  PDQXRAYLXRKTAGRM---GRTLA  699
            PDQ R       AG+    GRTLA
Sbjct  181  PDQQRLIF----AGKQLEDGRTLA  200


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  246

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLDDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (769),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (968),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   308 bits (789),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>prf||1604470A poly-ubiquitin
Length=272

 Score =   376 bits (966),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  32   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  86

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  87   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  146

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  147  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  206

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  207  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  252


 Score =   312 bits (800),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 164/179 (92%), Gaps = 7/179 (4%)
 Frame = +1

Query  172  GIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  351
            GIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  352  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  531
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  532  IFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            IFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  176


 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   374 bits (961),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   375 bits (962),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GR LA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRNLA  209


 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   376 bits (965),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  250


 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 163/178 (92%), Gaps = 7/178 (4%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            FVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  174


 Score =   301 bits (770),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  305



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   377 bits (969),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (962),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (965),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   376 bits (966),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  149  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  208

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  209  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  254


 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 167/182 (92%), Gaps = 7/182 (4%)
 Frame = +1

Query  163  DKEGIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  342
            DKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  523  GMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRT  693
            GMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRT
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRT  176

Query  694  LA  699
            LA
Sbjct  177  LA  178


 Score =   301 bits (771),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  110  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  164

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  165  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  224

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  225  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (960),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   375 bits (962),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (962),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   377 bits (969),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   373 bits (957),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/192 (98%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQ  645
            +IQDKEGIPPDQ
Sbjct  181  KIQDKEGIPPDQ  192


 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 123/137 (90%), Gaps = 7/137 (5%)
 Frame = +1

Query  298  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  477
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  478  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAY  657
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R  
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  658  LXRKTAGRM---GRTLA  699
                 AG+    GRTLA
Sbjct  121  F----AGKQLEDGRTLA  133



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   377 bits (968),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   381 bits (978),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 203/229 (89%), Positives = 206/229 (90%), Gaps = 11/229 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  130  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  189

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  190  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  234


 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  204

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  205  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  264

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  265  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  310


 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  166  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  280

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  281  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  340

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  341  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  386


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  242  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  356

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  357  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   374 bits (961),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/231 (86%), Positives = 207/231 (90%), Gaps = 7/231 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            + +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  27   LGALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  86

Query  196  LIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  87   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  146

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  147  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  206

Query  556  KTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  207  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  253


 Score =   378 bits (970),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  224  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  283

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDT+DNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  284  TITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  329


 Score =   378 bits (970),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  185  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVK
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVK  299

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  300  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  359

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  360  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  405


 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  261  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  375

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  376  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   376 bits (965),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   372 bits (955),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 195/209 (93%), Gaps = 5/209 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQ  645
            TITLE ESSDTIDNVK +IQDKEGIPPDQ
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQ  268


 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 122/134 (91%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  256  AKIQDKEGIPPDQQ  269



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   374 bits (961),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   377 bits (968),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   379 bits (972),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   367 bits (941),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 192/206 (93%), Gaps = 5/206 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIP  636
            TITLE ESSDTIDNVK +IQDKEGIP
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIP  341



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   374 bits (960),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  132  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  191

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  192  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  237


 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  207

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  208  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  267

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  268  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  313


 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  169  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  283

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  284  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/152 (89%), Positives = 138/152 (91%), Gaps = 7/152 (5%)
 Frame = +1

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQ  612
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133

Query  613  IQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  134  IQDKEGIPPDQQRLIF----AGKQLEDGRTLA  161



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   377 bits (968),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  183  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  242

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  243  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  288


 Score =   376 bits (965),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  184  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  212


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  144  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  258

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  259  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 126/140 (90%), Gaps = 7/140 (5%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQX  648
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ 
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  120

Query  649  RAYLXRKTAGRM---GRTLA  699
            R       AG+    GRTLA
Sbjct  121  RLIF----AGKQLEDGRTLA  136



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   377 bits (967),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (965),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   377 bits (967),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   378 bits (970),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  250


 Score =   378 bits (970),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  281  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  326


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 156/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  297  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 163/213 (77%), Gaps = 42/213 (20%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLE                                   DGR LADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  146  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  174



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   379 bits (974),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/230 (87%), Positives = 205/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R  L    AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIL----AGKQLEDGRTLA  361


 Score =   373 bits (957),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   370 bits (949),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 195/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   377 bits (967),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   377 bits (967),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   376 bits (965),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   358 bits (918),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 197/230 (86%), Gaps = 20/230 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSD        IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSD--------IQDKEGIPPDQQRLIF----AGKQLEDGRTLA  277


 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 149/169 (88%), Gaps = 13/169 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD      
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD------  249

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  250  --IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   376 bits (966),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   376 bits (966),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  205  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  250


 Score =   362 bits (930),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 191/205 (93%), Gaps = 5/205 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEGESSDTIDNVKGQIQDKEGI  633
            TITLE ESSDTIDNVK +IQDKEGI
Sbjct  281  TITLEVESSDTIDNVKAKIQDKEGI  305


 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 163/178 (92%), Gaps = 7/178 (4%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            FVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  174



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   376 bits (966),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   374 bits (960),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  184  TITLEVESSDTIDNVKAKIQDKEGIPPDQKRLIF----AGKQLEDGRTLA  229


 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQ+RLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  200  AKIQDKEGIPPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 142/157 (90%), Gaps = 7/157 (4%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            NVK +IQDKE IPPDQ R       AG+    GRTLA
Sbjct  121  NVKAKIQDKEWIPPDQQRLIF----AGKQLEDGRTLA  153



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   373 bits (958),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (767),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   376 bits (966),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   377 bits (967),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 196/220 (89%), Positives = 201/220 (91%), Gaps = 9/220 (4%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  229  RILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            R L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  127

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSD  588
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSD
Sbjct  128  PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  187

Query  589  TIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  188  TIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  223


 Score =   375 bits (962),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  79   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  193

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  194  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  253

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  254  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  299


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  155  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  269

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  270  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   373 bits (957),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   374 bits (961),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  216  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  244


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  155  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 144/161 (89%), Gaps = 7/161 (4%)
 Frame = +1

Query  226  GRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            G  LADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  586  DTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            DTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  132  DTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  168



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   374 bits (959),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  62   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  122  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  181

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  182  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  227


 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  138  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  197

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  198  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 141/155 (91%), Gaps = 7/155 (5%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNV  603
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  604  KGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            K +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  121  KAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  151



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   376 bits (965),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (962),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQ+KEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQEKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   377 bits (968),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  274  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  319


 Score =   376 bits (966),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  215  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  243


 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   376 bits (965),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   375 bits (964),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   375 bits (964),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (954),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   377 bits (967),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/231 (86%), Positives = 205/231 (89%), Gaps = 13/231 (6%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +CS  LF  L+       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  18   LCSSALFPLLQ------AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  71

Query  196  LIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  72   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  131

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  132  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  191

Query  556  KTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  192  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  238


 Score =   374 bits (960),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  94   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  209  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  268

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  269  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  314


 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  224

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  225  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  284

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  285  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  120

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  180

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  181  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  240

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  241  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  286


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  196

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  197  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  256

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  257  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  316

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEG+PPDQ R       AG+    GRTLA
Sbjct  317  TITLEVESSDTIDNVKAKIQDKEGVPPDQQRLIF----AGKQLEDGRTLA  362


 Score =   373 bits (957),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGR LADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  182  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  210


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  218  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  272

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  273  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  332

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEG+PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  AKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   375 bits (964),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   375 bits (963),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 151/164 (92%), Gaps = 5/164 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  510
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIP DQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPLDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (769),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   371 bits (952),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/192 (97%), Positives = 189/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE E+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  QIQDKEGIPPDQ  645
            +IQDKEGIPPDQ
Sbjct  181  KIQDKEGIPPDQ  192


 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 122/134 (91%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  180  AKIQDKEGIPPDQQ  193


 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 123/137 (90%), Gaps = 7/137 (5%)
 Frame = +1

Query  298  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  477
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  478  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAY  657
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R  
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  658  LXRKTAGRM---GRTLA  699
                 AG+    GRTLA
Sbjct  121  F----AGKQLEDGRTLA  133



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 200/215 (93%), Gaps = 7/215 (3%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  604  KGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            K +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  211


 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  182  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  241

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  242  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  287


 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  257

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  258  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  317

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  318  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  363


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  219  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  273

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  333

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAG QLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   378 bits (971),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (968),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/210 (92%), Positives = 196/210 (93%), Gaps = 1/210 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRMGRTLA  699
            +IQDKEGIPPDQ R     K     GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQL-EEGRTLA  209


 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLE+GR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/229 (87%), Positives = 204/229 (89%), Gaps = 12/229 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  241  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/229 (87%), Positives = 204/229 (89%), Gaps = 12/229 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  317  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   280 bits (715),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/159 (91%), Positives = 147/159 (92%), Gaps = 5/159 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ L
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   372 bits (956),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTA--GRMG  687
            +IQDKEGIPPDQ R     K    GR G
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTG  208



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   375 bits (963),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/229 (87%), Positives = 203/229 (89%), Gaps = 12/229 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTL  696
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTL  284


 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (767),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            T+TLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ L
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  381



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/232 (86%), Positives = 206/232 (89%), Gaps = 11/232 (5%)
 Frame = +1

Query  25   LNLFYHLRHSCSYLK----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
            L  +  ++   +YL+    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  2    LAYWVLIKFERNYLESSTSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  61

Query  193  RLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            RLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  62   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  121

Query  373  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  552
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  122  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  181

Query  553  GKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            GKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  182  GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  229


 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  260  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  305


 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  275

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  276  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  335

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  336  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  381


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  237  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  291

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  292  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  351

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  352  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLSLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/212 (91%), Positives = 197/212 (93%), Gaps = 7/212 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTL  696
            +IQDKEGIPPDQ R       AG+    GRTL
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTL  208


 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  61   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  115

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  116  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  175

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  176  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  235

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  236  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  281


 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  137  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  191

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  192  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  251

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  252  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  311

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  312  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  357


 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 194/209 (93%), Gaps = 7/209 (3%)
 Frame = +1

Query  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQKE  261
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  262  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  441
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  442  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQD  621
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQD
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  180

Query  622  KEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            KEGIPPDQ R       AG+    GRTLA
Sbjct  181  KEGIPPDQQRLIF----AGKQLEDGRTLA  205


 Score =   302 bits (773),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  213  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  267

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  268  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  327

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  328  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   372 bits (955),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   375 bits (962),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR 
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRF  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLVF----AGKQLEDGRTLA  285


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   374 bits (961),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (965),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (962),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   378 bits (970),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (962),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   374 bits (961),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   372 bits (954),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (768),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (962),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (960),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   377 bits (969),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (961),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   372 bits (954),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   372 bits (954),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  229



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   374 bits (961),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLED R LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (959),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  251  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  296


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  267  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  326

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  327  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  372


 Score =   378 bits (970),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 201/219 (92%), Gaps = 8/219 (4%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            SC + +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  7    SCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  65

Query  232  ILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
             LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  66   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDT  591
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT
Sbjct  126  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  185

Query  592  IDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            IDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  186  IDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  220


 Score =   303 bits (775),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  228  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  282

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  283  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  342

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  343  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   371 bits (952),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   271 bits (694),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 144/156 (92%), Gaps = 5/156 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  486
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  91   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  145

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  146  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  205

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  206  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  265

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  266  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  311


 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  167  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  222  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  281

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  282  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  341

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  342  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  387


 Score =   303 bits (775),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  243  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  297

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  298  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  357

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 165/198 (83%), Gaps = 10/198 (5%)
 Frame = +1

Query  115  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRG  294
            +V  S  ++ V A++ D +      Q   FA KQLEDGR LADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  295  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  474
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  475  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRA  654
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R 
Sbjct  162  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  655  YLXRKTAGRM---GRTLA  699
                  AG+    GRTLA
Sbjct  222  IF----AGKQLEDGRTLA  235



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 159/172 (92%), Gaps = 5/172 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   375 bits (962),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  72   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  126

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  127  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  186

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  187  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  246

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  247  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  292


 Score =   375 bits (962),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 200/219 (91%), Gaps = 7/219 (3%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  232  ILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
             L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDT  591
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDT
Sbjct  122  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  181

Query  592  IDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            IDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  182  IDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  216


 Score =   301 bits (770),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  148  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  262

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  263  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            T+TLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (968),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   372 bits (954),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 155/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (969),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 162/180 (90%), Gaps = 7/180 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKTLT  552
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+  +
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVRLFS  391



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   371 bits (953),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   295 bits (755),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 154/168 (92%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   377 bits (968),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITL+ ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLKVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   373 bits (958),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/230 (85%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  41   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  95

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  96   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  155

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  156  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  215

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  216  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  261


 Score =   311 bits (798),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 174/213 (82%), Gaps = 31/213 (15%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  157  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  185


 Score =   297 bits (761),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  117  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  171

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  172  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  231

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  232  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   374 bits (961),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (769),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   374 bits (961),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   371 bits (953),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/200 (95%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ES DTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRK  669
            +IQDKEGIPPDQ R     K
Sbjct  181  KIQDKEGIPPDQQRLIFAGK  200


 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 151/169 (89%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   374 bits (961),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   372 bits (956),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   313 bits (803),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 164/176 (93%), Gaps = 5/176 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   374 bits (960),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   370 bits (949),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   372 bits (956),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K
Sbjct  120  IFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (954),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDN+K 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   377 bits (967),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 205/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  361


 Score =   373 bits (957),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (768),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   375 bits (964),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 197/227 (87%), Positives = 203/227 (89%), Gaps = 10/227 (4%)
 Frame = +1

Query  28   NLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  207
            N F    H+ S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  33   NPFKPTLHTPS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  89

Query  208  GKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  387
            GKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  90   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  149

Query  388  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  567
            QDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  150  QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  209

Query  568  LEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            LE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  210  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  252


 Score =   375 bits (962),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  282

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  283  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  328


 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  239  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  298

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  299  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   379 bits (972),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  188  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  242

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  243  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  302

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  303  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  362

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  363  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  408


 Score =   378 bits (971),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 196/215 (91%), Positives = 198/215 (92%), Gaps = 7/215 (3%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILAD  243
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  165

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNV  603
            LIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNV
Sbjct  166  LIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  225

Query  604  KGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            K +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  226  KAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  256


 Score =   376 bits (966),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  112  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  166

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  167  IFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  226

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  227  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  286

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  287  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  332


 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  264  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  318

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  319  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   373 bits (958),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/210 (92%), Positives = 196/210 (93%), Gaps = 5/210 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  96

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  156

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  216

Query  562  ITLEGESSDTIDNVKGQIQDKEGIPPDQXR  651
            ITLE ESSDTIDNVK +IQDKEGIPPDQ R
Sbjct  217  ITLEVESSDTIDNVKAKIQDKEGIPPDQQR  246


 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 165/180 (92%), Gaps = 7/180 (4%)
 Frame = +1

Query  169  EGIPPDQQRLIFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  348
            +GIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  349  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  529  QIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            QIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  130  QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  185


 Score =   254 bits (648),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 134/145 (92%), Gaps = 5/145 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  118  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  202  FAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDG  456
            KIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  233  KIQDKEGIPPDQQRLIFAGKQLEDG  257



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   377 bits (967),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   376 bits (966),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   376 bits (966),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   374 bits (960),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   372 bits (954),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   374 bits (960),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  305



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   374 bits (960),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   374 bits (960),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (767),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   371 bits (952),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   374 bits (961),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 163/183 (89%), Gaps = 5/183 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASK  315

Query  559  TIT  567
             IT
Sbjct  316  IIT  318



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   377 bits (967),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   374 bits (960),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   374 bits (959),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   372 bits (955),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   300 bits (768),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   374 bits (959),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   373 bits (957),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   371 bits (953),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  46   RHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  225
            +H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   QHRSFQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  226  GRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            GR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  163

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESS
Sbjct  164  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  223

Query  586  DTIDNVKGQIQDKEGIP  636
            DTIDNVK +IQDKEGIP
Sbjct  224  DTIDNVKAKIQDKEGIP  240


 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 123/137 (90%), Gaps = 7/137 (5%)
 Frame = +1

Query  298  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  477
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  52   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  111

Query  478  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKGQIQDKEGIPPDQXRAY  657
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK +IQDKEGIPPDQ R  
Sbjct  112  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  658  LXRKTAGRM---GRTLA  699
                 AG+    GRTLA
Sbjct  172  F----AGKQLEDGRTLA  184



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   370 bits (951),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   297 bits (760),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   370 bits (951),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   297 bits (760),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   370 bits (951),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   373 bits (958),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 197/229 (86%), Positives = 203/229 (89%), Gaps = 12/229 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTL  696
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTL  284


 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>emb|CAB81074.1| polyubiquitin (ubq10) [Arabidopsis thaliana]
Length=464

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/203 (92%), Positives = 189/203 (93%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKE  627
            TITLE ESSDTIDNVK +IQDKE
Sbjct  392  TITLEVESSDTIDNVKAKIQDKE  414



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   370 bits (951),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   373 bits (958),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTI+NVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIENVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (955),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTI+NVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   300 bits (767),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_002551324.1| ubiquitin [Candida tropicalis MYA-3404]
 gb|EER30626.1| ubiquitin [Candida tropicalis MYA-3404]
Length=299

 Score =   373 bits (957),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 206/236 (87%), Gaps = 12/236 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLAGLXHSR  717
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+    S+
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF----AGKQLEDGRTLSDYNISK  291


 Score =   372 bits (955),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   271 bits (693),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 146/160 (91%), Gaps = 5/160 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNI K++ L
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNISKKNLL  295



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/194 (95%), Positives = 187/194 (96%), Gaps = 0/194 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXR  651
            +IQDKEGIPPDQ R
Sbjct  181  KIQDKEGIPPDQQR  194


 Score =   256 bits (654),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  120  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  507
            AKIQDKEGIPPDQQRLIFAG  L  G  L+   IQKESTLHLV
Sbjct  180  AKIQDKEGIPPDQQRLIFAGNNLRMG-GLSLIYIQKESTLHLV  221



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   374 bits (961),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 195/209 (93%), Gaps = 5/209 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQ  645
            TITLE ESSDTIDNVK +IQDKEGIPPDQ
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQ  420



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   370 bits (950),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_004956019.1| PREDICTED: polyubiquitin 4-like [Setaria italica]
Length=381

 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID+VK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTID+VKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDHVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (962),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTID+VK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDHVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   373 bits (957),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/230 (85%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  240  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  285


 Score =   372 bits (955),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTL+
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLS  209


 Score =   297 bits (760),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|AFK47245.1| unknown [Medicago truncatula]
Length=233

 Score =   370 bits (950),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 195/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLV  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 154/169 (91%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  120  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD NIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNNIQKESTLHLVLRLRGG  228



>ref|XP_002980153.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
 ref|XP_002991828.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ07090.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ19023.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
Length=306

 Score =   373 bits (957),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (954),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 155/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_009784908.1| PREDICTED: polyubiquitin-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 150/162 (93%), Gaps = 5/162 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  504
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  449



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/214 (92%), Positives = 199/214 (93%), Gaps = 7/214 (3%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADY
Sbjct  13   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  72

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  73   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192

Query  607  GQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
             +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  193  AKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  222


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  78   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  193  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  252

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  253  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  298


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  154  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  208

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  209  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  268

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  269  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  328

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  329  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  374


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  230  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  284

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  285  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  344

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  345  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  404

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  405  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  450


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  306  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  360

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  361  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  420

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  421  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   372 bits (956),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (954),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 155/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   372 bits (956),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 202/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   372 bits (954),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 196/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKT  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007211609.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
 gb|AAL27564.1|AF429430_1 polyubiquitin OUB2 [Olea europaea]
 gb|EMJ12808.1| hypothetical protein PRUPE_ppa005507mg [Prunus persica]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|AAD03343.1| ubiquitin [Pisum sativum]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  457



>gb|EYU33607.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  457



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  145  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  199

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  200  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  259

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  260  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  319

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  320  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  365


 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  221  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  275

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  276  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  335

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  336  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  395

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  396  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  441


 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  81   IQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  200

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  201  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  260

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  261  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  289


 Score =   343 bits (881),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 190/213 (89%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG  LADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  184

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  185  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  213


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  297  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  351

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  352  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  411

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  412  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  460



>ref|XP_004953565.1| PREDICTED: polyubiquitin-like [Setaria italica]
Length=459

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  457



>gb|KIK81924.1| hypothetical protein PAXRUDRAFT_736824 [Paxillus rubicundulus 
Ve08.2h10]
Length=235

 Score =   370 bits (949),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = +1

Query  37   YHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  216
            Y  R   +  +MQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  25   YQTRKPHASTRMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQ  84

Query  217  LEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  396
            LEDGR L+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDK
Sbjct  85   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDK  144

Query  397  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEG  576
            EGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE 
Sbjct  145  EGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  204

Query  577  ESSDTIDNVKGQIQDKEGIPPDQXRAYLXRK  669
            + SDTI NVK +IQDKEGIPPDQ R    RK
Sbjct  205  DPSDTIGNVKAKIQDKEGIPPDQQRLIFARK  235



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   377 bits (967),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPP Q R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPVQQRLIF----AGKQLEDGRTLA  437


 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPP QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPVQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>dbj|BAK03691.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (969),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AK+QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (969),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            ++QDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KVQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|NP_001045980.1| Os02g0161900 [Oryza sativa Japonica Group]
 ref|NP_001058378.1| Os06g0681400 [Oryza sativa Japonica Group]
 ref|XP_006646911.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 gb|AAF01315.1|AF184279_1 polyubiquitin [Oryza sativa Indica Group]
 gb|AAF01316.1|AF184280_1 polyubiquitin [Oryza sativa Indica Group]
 emb|CAA53665.1| polyubiquitin [Oryza sativa Indica Group]
 gb|AAC49806.1| polyubiquitin [Oryza sativa Indica Group]
 dbj|BAD25213.1| polyubiquitin 6 [Oryza sativa Japonica Group]
 dbj|BAF07894.1| Os02g0161900 [Oryza sativa Japonica Group]
 dbj|BAF20292.1| Os06g0681400 [Oryza sativa Japonica Group]
 dbj|BAG95117.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72542.1| hypothetical protein OsI_05955 [Oryza sativa Indica Group]
 gb|EEE56356.1| hypothetical protein OsJ_05481 [Oryza sativa Japonica Group]
 gb|ADB84621.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|ADM86852.1| polyubiquitin [Oryza sativa Japonica Group]
 dbj|BAK06683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEE65380.1| ubiquitin 2 [Panicum virgatum]
 gb|AFW66449.1| ubiquitin2 [Zea mays]
Length=457

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (967),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>gb|AAB95251.1| ubiquitin [Arabidopsis thaliana]
Length=456

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (967),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_008350368.1| PREDICTED: polyubiquitin [Malus domestica]
Length=458

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGXTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_010431529.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Camelina 
sativa]
Length=457

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFV TLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV TLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVXTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV TLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVXTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_010423744.1| PREDICTED: polyubiquitin [Camelina sativa]
Length=458

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (967),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>ref|XP_002452705.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
 gb|EES05681.1| hypothetical protein SORBIDRAFT_04g031060 [Sorghum bicolor]
Length=459

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (967),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>gb|AAC16012.1| polyubiquitin [Elaeagnus umbellata]
Length=458

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   377 bits (967),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   377 bits (967),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ES DTIDNVK QIQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESLDTIDNVKAQIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 203/230 (88%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESLDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            A+IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AQIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKA+IQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESLDTIDNVKAQIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>emb|CAA40324.1| hexaubiquitin protein [Helianthus annuus]
 emb|CAA40325.1| hexaubiquitin protein [Helianthus annuus]
Length=457

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   377 bits (967),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



>gb|ACN40936.1| unknown [Picea sitchensis]
Length=458

 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  240  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  285


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  316  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  361


 Score =   378 bits (970),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 204/230 (89%), Gaps = 12/230 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEGESSDTIDNVKGQIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            TITLE ESSDTIDNVK +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  437


 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 197/213 (92%), Gaps = 7/213 (3%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEGESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE ESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QIQDKEGIPPDQXRAYLXRKTAGRM---GRTLA  699
            +IQDKEGIPPDQ R       AG+    GRTLA
Sbjct  181  KIQDKEGIPPDQQRLIF----AGKQLEDGRTLA  209


 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRILADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  456



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410