BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031P11

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB61503.1|  hypothetical protein B456_009G362500                    308   6e-99   Gossypium raimondii
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    311   8e-99   Nicotiana sylvestris
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    310   2e-98   Nicotiana tomentosiformis
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    310   2e-98   Solanum tuberosum [potatoes]
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    310   3e-98   Elaeis guineensis
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    310   3e-98   Nicotiana sylvestris
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    310   3e-98   Nicotiana tomentosiformis
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    310   4e-98   Solanum lycopersicum
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            309   5e-98   Morus notabilis
gb|KJB61502.1|  hypothetical protein B456_009G362500                    308   9e-98   Gossypium raimondii
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    308   1e-97   Gossypium arboreum [tree cotton]
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    308   1e-97   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    308   1e-97   Gossypium raimondii
gb|ACJ11756.1|  rhamnose synthase                                       308   1e-97   Gossypium hirsutum [American cotton]
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            308   1e-97   Theobroma cacao [chocolate]
gb|KJB45830.1|  hypothetical protein B456_007G332000                    300   2e-97   Gossypium raimondii
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    308   2e-97   Glycine max [soybeans]
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    308   2e-97   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       310   3e-97   Medicago truncatula
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    307   4e-97   Fragaria vesca subsp. vesca
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    307   4e-97   Nelumbo nucifera [Indian lotus]
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             306   7e-97   Prunus persica
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    306   7e-97   Prunus mume [ume]
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    306   8e-97   Pyrus x bretschneideri [bai li]
gb|KCW47402.1|  hypothetical protein EUGRSUZ_K01196                     302   8e-97   Eucalyptus grandis [rose gum]
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    306   9e-97   Glycine max [soybeans]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    306   9e-97   Sesamum indicum [beniseed]
ref|NP_001151455.1|  RHM1                                               306   1e-96   Zea mays [maize]
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    306   1e-96   
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       306   1e-96   Medicago truncatula
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    306   1e-96   Glycine max [soybeans]
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      305   1e-96   
gb|ADB24773.1|  rhamnose synthase                                       306   1e-96   Gossypium hirsutum [American cotton]
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    306   1e-96   Gossypium arboreum [tree cotton]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    306   1e-96   
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    305   1e-96   Cucumis sativus [cucumbers]
dbj|BAJ86835.1|  predicted protein                                      305   2e-96   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 305   2e-96   Triticum urartu
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   2e-96   Populus euphratica
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   2e-96   Vitis vinifera
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    305   2e-96   Solanum lycopersicum
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    305   2e-96   Cucumis melo [Oriental melon]
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   2e-96   Sesamum indicum [beniseed]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    305   2e-96   
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   2e-96   Populus euphratica
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    305   3e-96   Tarenaya hassleriana [spider flower]
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             305   3e-96   Populus trichocarpa [western balsam poplar]
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                305   4e-96   Erythranthe guttata [common monkey flower]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    304   4e-96   Glycine max [soybeans]
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 304   4e-96   Glycine soja [wild soybean]
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    304   4e-96   Glycine max [soybeans]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 304   4e-96   Glycine soja [wild soybean]
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    304   6e-96   Camelina sativa [gold-of-pleasure]
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             303   7e-96   Capsella rubella
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             303   7e-96   
gb|KJB12930.1|  hypothetical protein B456_002G046100                    295   7e-96   Gossypium raimondii
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    304   8e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    303   8e-96   Camelina sativa [gold-of-pleasure]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    303   8e-96   Camelina sativa [gold-of-pleasure]
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        303   9e-96   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    303   9e-96   Cicer arietinum [garbanzo]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    303   1e-95   Setaria italica
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             303   1e-95   Phaseolus vulgaris [French bean]
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             303   1e-95   
emb|CDY25850.1|  BnaA05g14410D                                          296   1e-95   Brassica napus [oilseed rape]
gb|KJB45829.1|  hypothetical protein B456_007G332000                    300   1e-95   Gossypium raimondii
gb|KJB45828.1|  hypothetical protein B456_007G332000                    300   1e-95   Gossypium raimondii
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    303   2e-95   Tarenaya hassleriana [spider flower]
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95   Eucalyptus grandis [rose gum]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    303   2e-95   Solanum tuberosum [potatoes]
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    302   2e-95   Brassica rapa
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    302   3e-95   Eucalyptus grandis [rose gum]
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          302   3e-95   Amborella trichopoda
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             301   4e-95   Eutrema salsugineum [saltwater cress]
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    301   5e-95   Phoenix dactylifera
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             301   5e-95   Capsella rubella
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    302   5e-95   Phoenix dactylifera
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg             301   7e-95   Citrus clementina [clementine]
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340          301   7e-95   Sorghum bicolor [broomcorn]
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    301   7e-95   Elaeis guineensis
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...    301   7e-95   Citrus sinensis [apfelsine]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                   301   8e-95   Citrus sinensis [apfelsine]
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    301   9e-95   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45831.1|  hypothetical protein B456_007G332000                    301   9e-95   Gossypium raimondii
emb|CDY40003.1|  BnaC05g13120D                                          301   9e-95   Brassica napus [oilseed rape]
emb|CDY35137.1|  BnaA06g11470D                                          301   1e-94   Brassica napus [oilseed rape]
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    301   1e-94   Brassica rapa
ref|NP_177978.1|  UDP-L-rhamnose synthase                               300   1e-94   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...    300   1e-94   Camelina sativa [gold-of-pleasure]
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...    300   1e-94   Setaria italica
gb|ABF95280.1|  rhamnose biosynthetic enzyme 1, putative, expressed     297   1e-94   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...    300   1e-94   Camelina sativa [gold-of-pleasure]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    300   2e-94   Tarenaya hassleriana [spider flower]
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg                300   2e-94   Erythranthe guttata [common monkey flower]
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    300   2e-94   Elaeis guineensis
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    300   3e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002887744.1|  RHM1/ROL1                                          299   4e-94   
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...    299   4e-94   Camelina sativa [gold-of-pleasure]
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...    299   4e-94   Phoenix dactylifera
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    299   4e-94   Gossypium arboreum [tree cotton]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             299   5e-94   Capsella rubella
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...    299   5e-94   Oryza brachyantha
emb|CDP06058.1|  unnamed protein product                                298   7e-94   Coffea canephora [robusta coffee]
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    298   9e-94   
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    298   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...    298   1e-93   Brassica rapa
ref|NP_001049724.1|  Os03g0278200                                       298   2e-93   
gb|KDP30504.1|  hypothetical protein JCGZ_17141                         298   2e-93   Jatropha curcas
gb|ADB24772.1|  rhamnose synthase                                       297   2e-93   Gossypium hirsutum [American cotton]
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    297   2e-93   Brachypodium distachyon [annual false brome]
dbj|BAJ97692.1|  predicted protein                                      297   2e-93   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    297   2e-93   Oryza brachyantha
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 297   2e-93   
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 297   2e-93   Triticum urartu
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...    297   2e-93   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88455.1|  BnaC06g38990D                                          298   3e-93   
ref|XP_002894444.1|  mucilage-modified 4                                297   3e-93   
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...    296   4e-93   Eucalyptus grandis [rose gum]
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...    296   4e-93   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY60210.1|  BnaCnng35880D                                          296   6e-93   Brassica napus [oilseed rape]
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg             296   6e-93   Eutrema salsugineum [saltwater cress]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                      295   1e-92   Arabidopsis thaliana [mouse-ear cress]
emb|CDP21573.1|  unnamed protein product                                282   2e-92   Coffea canephora [robusta coffee]
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220          295   2e-92   Sorghum bicolor [broomcorn]
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    295   2e-92   Fragaria vesca subsp. vesca
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...    293   7e-92   
emb|CDY45116.1|  BnaC06g06370D                                          293   1e-91   Brassica napus [oilseed rape]
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    293   1e-91   Brassica rapa
emb|CDY24092.1|  BnaA06g00900D                                          292   1e-91   Brassica napus [oilseed rape]
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...    292   2e-91   Brassica rapa
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             292   2e-91   Phaseolus vulgaris [French bean]
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg             291   3e-91   Prunus persica
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...    291   6e-91   Prunus mume [ume]
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...    291   6e-91   Pyrus x bretschneideri [bai li]
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 290   7e-91   Glycine soja [wild soybean]
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    290   7e-91   Glycine max [soybeans]
ref|XP_001775697.1|  predicted protein                                  290   1e-90   
ref|XP_001775602.1|  predicted protein                                  289   3e-90   
ref|XP_001766894.1|  predicted protein                                  289   3e-90   
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...    289   4e-90   Malus domestica [apple tree]
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                  290   5e-90   
emb|CDP18722.1|  unnamed protein product                                288   6e-90   Coffea canephora [robusta coffee]
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg             288   7e-90   
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...    288   9e-90   Citrus sinensis [apfelsine]
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    288   9e-90   Gossypium arboreum [tree cotton]
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                   288   1e-89   Citrus sinensis [apfelsine]
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...    288   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1            288   1e-89   Morus notabilis
gb|ADB24774.1|  rhamnose synthase                                       287   2e-89   Gossypium hirsutum [American cotton]
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...    286   4e-89   Setaria italica
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220          286   5e-89   
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...    286   6e-89   Malus domestica [apple tree]
gb|AFW77499.1|  hypothetical protein ZEAMMB73_283149                    281   1e-88   
gb|KJB75445.1|  hypothetical protein B456_012G042300                    284   3e-88   Gossypium raimondii
ref|XP_001779703.1|  predicted protein                                  283   4e-88   
gb|ACG33666.1|  RHM1                                                    282   1e-87   Zea mays [maize]
ref|NP_001130297.1|  uncharacterized protein LOC100191391               282   2e-87   Zea mays [maize]
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972             282   2e-87   
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803             281   2e-87   Selaginella moellendorffii
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1                 278   9e-87   Glycine soja [wild soybean]
gb|EMT08126.1|  Putative rhamnose biosynthetic enzyme 1                 271   9e-86   
ref|XP_002515360.1|  dtdp-glucose 4,6-dehydratase, putative             266   7e-85   Ricinus communis
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...    275   9e-85   Malus domestica [apple tree]
gb|EMS55907.1|  putative rhamnose biosynthetic enzyme 3                 270   1e-84   Triticum urartu
ref|XP_004172221.1|  PREDICTED: probable rhamnose biosynthetic en...    263   9e-84   
ref|XP_008351771.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    260   1e-82   
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...    268   3e-82   Nelumbo nucifera [Indian lotus]
gb|EYU29575.1|  hypothetical protein MIMGU_mgv1a008395mg                259   4e-82   Erythranthe guttata [common monkey flower]
gb|AFW66842.1|  hypothetical protein ZEAMMB73_620875                    259   1e-81   
ref|XP_011082935.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    258   4e-81   Sesamum indicum [beniseed]
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...    266   4e-81   Pyrus x bretschneideri [bai li]
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg             264   1e-80   Prunus persica
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...    263   2e-80   Cucumis melo [Oriental melon]
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...    263   2e-80   
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg             262   6e-80   
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...    262   1e-79   
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                   262   1e-79   Citrus sinensis [apfelsine]
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...    260   4e-79   Prunus mume [ume]
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...    259   8e-79   Pyrus x bretschneideri [bai li]
emb|CAN62061.1|  hypothetical protein VITISV_001928                     258   8e-79   Vitis vinifera
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    258   2e-78   Vitis vinifera
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...    258   3e-78   
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    256   6e-78   Populus euphratica
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g             256   1e-77   Populus trichocarpa [western balsam poplar]
emb|CDX97601.1|  BnaA05g24780D                                          255   2e-77   
emb|CDX98494.1|  BnaC05g38810D                                          255   2e-77   
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...    253   1e-76   Nicotiana tomentosiformis
ref|XP_007011619.1|  Rhamnose biosynthesis 1                            252   2e-76   
emb|CDY32340.1|  BnaC01g36590D                                          251   4e-76   Brassica napus [oilseed rape]
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...    251   5e-76   Nicotiana sylvestris
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...    251   8e-76   Solanum tuberosum [potatoes]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...    250   1e-75   
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...    249   4e-75   Glycine max [soybeans]
emb|CDY20084.1|  BnaA01g29180D                                          248   1e-74   Brassica napus [oilseed rape]
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    248   1e-74   Fragaria vesca subsp. vesca
ref|XP_003588651.1|  Rhamnose synthase                                  244   4e-73   Medicago truncatula
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...    243   5e-73   
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1                 243   5e-73   Glycine soja [wild soybean]
ref|XP_003566438.1|  PREDICTED: probable rhamnose biosynthetic en...    235   1e-72   Brachypodium distachyon [annual false brome]
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...    241   3e-72   Cicer arietinum [garbanzo]
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g             241   4e-72   Phaseolus vulgaris [French bean]
ref|XP_003569141.1|  PREDICTED: probable rhamnose biosynthetic en...    233   9e-72   Brachypodium distachyon [annual false brome]
ref|XP_010531915.1|  PREDICTED: LOW QUALITY PROTEIN: trifunctiona...    236   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_001701714.1|  NAD-dependent epimerase/dehydratase                212   5e-64   Chlamydomonas reinhardtii
gb|EPS62084.1|  hypothetical protein M569_12709                         217   2e-63   Genlisea aurea
ref|XP_002953659.1|  hypothetical protein VOLCADRAFT_82358              206   1e-61   Volvox carteri f. nagariensis
ref|XP_011401987.1|  putative rhamnose biosynthetic enzyme 3            202   7e-60   Auxenochlorella protothecoides
gb|AGE49559.1|  GDP-L-fucose synthase 2                                 201   8e-60   Acanthocystis turfacea Chlorella virus Can0610SP
gb|AGE60164.1|  GDP-L-fucose synthase 2                                 201   9e-60   Acanthocystis turfacea Chlorella virus WI0606
ref|XP_003057320.1|  predicted protein                                  208   1e-59   Micromonas pusilla CCMP1545
ref|YP_001427025.1|  hypothetical protein ATCV1_Z544R                   200   4e-59   Acanthocystis turfacea chlorella virus 1
gb|AGE59831.1|  GDP-L-fucose synthase 2                                 199   4e-59   Acanthocystis turfacea Chlorella virus TN603.4.2
ref|XP_005644844.1|  NAD(P)-binding protein                             200   4e-59   Coccomyxa subellipsoidea C-169
gb|AGE57039.1|  GDP-L-fucose synthase 2                                 199   4e-59   Acanthocystis turfacea Chlorella virus NE-JV-3
ref|XP_002181238.1|  predicted protein                                  202   4e-59   Phaeodactylum tricornutum CCAP 1055/1
gb|AGE50238.1|  GDP-L-fucose synthase 2                                 200   5e-59   Acanthocystis turfacea Chlorella virus Canal-1
ref|XP_002500589.1|  predicted protein                                  206   5e-59   Micromonas commoda
ref|XP_005648752.1|  NAD-dependent epimerase/dehydratase                200   5e-59   Coccomyxa subellipsoidea C-169
gb|AGE59487.1|  GDP-L-fucose synthase 2                                 199   7e-59   Acanthocystis turfacea Chlorella virus OR0704.3
ref|XP_007508076.1|  predicted protein                                  205   1e-58   Bathycoccus prasinos
ref|XP_011401232.1|  DEAD-box ATP-dependent RNA helicase 20             205   3e-58   Auxenochlorella protothecoides
gb|AGE56041.1|  GDP-L-fucose synthase 2                                 197   3e-58   Acanthocystis turfacea Chlorella virus MO0605SPH
emb|CBN76510.1|  conserved unknown protein                              198   4e-58   Ectocarpus siliculosus
gb|KJB27003.1|  hypothetical protein B456_004G271200                    202   4e-58   Gossypium raimondii
gb|AGE55724.1|  GDP-L-fucose synthase 2                                 197   5e-58   Acanthocystis turfacea Chlorella virus MN0810.1
gb|AGE53603.1|  GDP-L-fucose synthase 2                                 196   9e-58   Acanthocystis turfacea Chlorella virus GM0701.1
ref|XP_005781167.1|  hypothetical protein EMIHUDRAFT_442934             197   1e-57   Emiliania huxleyi CCMP1516
ref|XP_005757838.1|  hypothetical protein EMIHUDRAFT_433184             197   1e-57   Emiliania huxleyi CCMP1516
gb|AGE56705.1|  GDP-L-fucose synthase 2                                 196   1e-57   Acanthocystis turfacea Chlorella virus NE-JV-2
gb|AGE57735.1|  GDP-L-fucose synthase 2                                 196   2e-57   Acanthocystis turfacea Chlorella virus NTS-1
gb|EWM30544.1|  dTDP-glucose 4,6-dehydratase                            197   2e-57   Nannochloropsis gaditana
ref|XP_005778340.1|  hypothetical protein EMIHUDRAFT_367182             196   2e-57   Emiliania huxleyi CCMP1516
ref|XP_007514013.1|  predicted protein                                  202   2e-57   Bathycoccus prasinos
ref|XP_005854661.1|  dTDP-glucose 4,6-dehydratase                       195   2e-57   Nannochloropsis gaditana CCMP526
ref|XP_002291084.1|  dtdp-glucose 4,6-dehydratase                       195   4e-57   Thalassiosira pseudonana CCMP1335
ref|XP_004336227.1|  dTDPD-glucose 4,6-dehydratase                      195   4e-57   Acanthamoeba castellanii str. Neff
gb|AGE49233.1|  GDP-L-fucose synthase 2                                 194   5e-57   Acanthocystis turfacea Chlorella virus Br0604L
gb|KDD76685.1|  NAD dependent epimerase/dehydratase                     195   5e-57   Helicosporidium sp. ATCC 50920
gb|EWM28017.1|  rhamnose biosynthetic enzyme expressed                  195   7e-57   Nannochloropsis gaditana
gb|KDD73904.1|  NAD dependent epimerase/dehydratase                     193   2e-56   Helicosporidium sp. ATCC 50920
ref|XP_001422283.1|  putative NAD-dependent epimerase/dehydratase       188   1e-54   Ostreococcus lucimarinus CCE9901
ref|XP_005845105.1|  hypothetical protein CHLNCDRAFT_7301               187   2e-54   Chlorella variabilis
ref|XP_001422288.1|  predicted protein                                  187   4e-54   Ostreococcus lucimarinus CCE9901
ref|XP_005536953.1|  dTDP-glucose 4,6-dehydratase                       186   2e-53   Cyanidioschyzon merolae strain 10D
ref|XP_005535008.1|  dTDP-glucose 4,6-dehydratase                       186   2e-53   Cyanidioschyzon merolae strain 10D
ref|XP_005537192.1|  dTDP-glucose 4,6-dehydratase                       186   2e-53   Cyanidioschyzon merolae strain 10D
ref|XP_005850348.1|  hypothetical protein CHLNCDRAFT_142172             184   5e-53   Chlorella variabilis
ref|XP_004256510.1|  DTDP-glucose 4,6-dehydratase, putative             183   7e-53   Entamoeba invadens IP1
gb|EJK47833.1|  hypothetical protein THAOC_33424                        183   1e-52   Thalassiosira oceanica
emb|CBK22816.2|  unnamed protein product                                185   3e-52   Blastocystis hominis
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                    184   6e-51   Ostreococcus tauri
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...    184   8e-51   
ref|XP_006675185.1|  hypothetical protein BATDEDRAFT_18531              179   9e-51   Batrachochytrium dendrobatidis JAM81
ref|XP_001737366.1|  DTDP-glucose 4,6-dehydratase                       177   2e-50   Entamoeba dispar SAW760
ref|XP_004253556.1|  DTDP-glucose 4,6-dehydratase, putative             177   3e-50   Entamoeba invadens IP1
ref|XP_004184621.1|  DTDP-glucose 4,6-dehydratase, putative             176   3e-50   Entamoeba invadens IP1
ref|NP_001054887.1|  Os05g0203400                                       171   1e-49   
gb|EMS11387.1|  dTDP-D-glucose 4,6-dehydratase                          167   4e-49   Entamoeba histolytica HM-3:IMSS
ref|XP_001297395.1|  NAD dependent epimerase/dehydratase family p...    173   5e-49   Trichomonas vaginalis G3
ref|XP_005710308.1|  dTDP-glucose 4,6-dehydratase                       173   2e-48   Chondrus crispus [carageen]
ref|XP_009035289.1|  hypothetical protein AURANDRAFT_23143              171   3e-48   Aureococcus anophagefferens
ref|XP_001741245.1|  DTDP-glucose 4,6-dehydratase                       170   9e-48   Entamoeba dispar SAW760
gb|EPB88805.1|  dTDP-glucose 4,6-dehydratase                            171   9e-48   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_656509.1|  dTDP-D-glucose 4,6-dehydratase                        170   1e-47   Entamoeba histolytica HM-1:IMSS
dbj|GAN06126.1|  DTDPD-glucose 4,6-dehydratase                          171   2e-47   Mucor ambiguus
emb|CDS02810.1|  hypothetical protein LRAMOSA00214                      170   2e-47   Lichtheimia ramosa
ref|XP_005704072.1|  dTDP-glucose 4,6-dehydratase                       169   2e-47   Galdieria sulphuraria
emb|CDH53780.1|  dtdp-glucose-dehydratase                               170   2e-47   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002839554.1|  hypothetical protein                               169   4e-47   Tuber melanosporum Mel28
ref|XP_652489.1|  dTDP-D-glucose 4,6-dehydratase                        168   4e-47   Entamoeba histolytica HM-1:IMSS
ref|XP_005707656.1|  dTDP-glucose 4,6-dehydratase                       168   6e-47   Galdieria sulphuraria
ref|XP_004346522.1|  rhamnose biosynthetic enzyme 3, putative           168   2e-46   Acanthamoeba castellanii str. Neff
gb|ERZ94801.1|  hypothetical protein GLOINDRAFT_72734                   166   4e-46   
ref|XP_009031751.1|  hypothetical protein HELRODRAFT_104422             166   5e-46   Helobdella robusta
gb|AGM32522.1|  NAD dependent epimerase/dehydratase family protein      164   5e-46   Coptotermes formosanus
gb|EXX68145.1|  bifunctional UDP-glucose 4-epimerase/aldose 1-epi...    166   6e-46   Rhizophagus irregularis DAOM 197198w
ref|XP_001267087.1|  dtdp-glucose 4,6-dehydratase                       161   1e-43   Aspergillus fischeri NRRL 181
ref|XP_001628519.1|  predicted protein                                  159   3e-43   Nematostella vectensis
ref|XP_010587692.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   9e-43   Loxodonta africana [African bush elephant]
gb|EPY35950.1|  dTDP-glucose 4,6-dehydratase                            157   2e-42   
gb|EDM02523.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    152   3e-42   
ref|XP_005355717.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          156   3e-42   
ref|XP_010628993.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   3e-42   
ref|XP_003131096.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   4e-42   
ref|XP_006927417.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   4e-42   
ref|XP_008683235.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   4e-42   
gb|EXA35093.1|  dTDP-glucose 4,6-dehydratase                            156   4e-42   
ref|XP_002918693.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   4e-42   
gb|EDM02522.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...    152   4e-42   
gb|EWY82941.1|  dTDP-glucose 4,6-dehydratase                            156   4e-42   
gb|EXL51746.1|  dTDP-glucose 4,6-dehydratase                            156   5e-42   
ref|XP_008825221.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   5e-42   
ref|XP_003409363.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    155   5e-42   
ref|XP_009899796.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          155   7e-42   
ref|XP_004884841.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   9e-42   
ref|XP_004313346.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    154   9e-42   
ref|XP_006156670.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    153   1e-41   
gb|EWZ30418.1|  dTDP-glucose 4,6-dehydratase                            155   1e-41   
ref|XP_007456437.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          154   1e-41   
ref|XP_542640.3|  PREDICTED: dTDP-D-glucose 4,6-dehydratase             154   1e-41   
ref|XP_001746636.1|  hypothetical protein                               154   1e-41   
ref|XP_004408787.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          154   1e-41   
ref|XP_002713048.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   1e-41   
ref|XP_006743512.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          154   1e-41   
dbj|GAM86455.1|  hypothetical protein ANO11243_044690                   155   1e-41   
ref|XP_005882453.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   1e-41   
gb|EXM20830.1|  dTDP-glucose 4,6-dehydratase                            154   1e-41   
ref|XP_006089900.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   1e-41   
ref|XP_007196914.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   2e-41   
ref|XP_010628984.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   2e-41   
dbj|BAB27693.1|  unnamed protein product                                154   2e-41   
ref|XP_003980524.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   2e-41   
ref|NP_083854.3|  dTDP-D-glucose 4,6-dehydratase                        154   2e-41   
gb|EDL00564.1|  TDP-glucose 4,6-dehydratase, isoform CRA_a              154   2e-41   
gb|EDL00567.1|  TDP-glucose 4,6-dehydratase, isoform CRA_d              154   2e-41   
ref|XP_003477586.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   2e-41   
ref|XP_004371454.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   2e-41   
gb|ERE88473.1|  dTDP-D-glucose 4,6-dehydratase-like protein             153   3e-41   
gb|AAH21419.1|  TDP-glucose 4,6-dehydratase                             153   3e-41   
gb|ERE88474.1|  dTDP-D-glucose 4,6-dehydratase-like protein             152   3e-41   
gb|EXK35799.1|  dTDP-glucose 4,6-dehydratase                            154   3e-41   
ref|XP_006191479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   3e-41   
ref|XP_010628976.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    154   3e-41   
ref|XP_007677510.1|  hypothetical protein BAUCODRAFT_48602              153   4e-41   
ref|XP_007196913.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    153   4e-41   
ref|XP_006156669.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    153   4e-41   
ref|XP_007101813.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   4e-41   
ref|XP_004746205.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    153   4e-41   
gb|ENH75981.1|  Putative rhamnose biosynthetic enzyme 1                 153   4e-41   
ref|XP_008569757.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          153   4e-41   
ref|XP_001512139.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   5e-41   
ref|XP_005317101.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   5e-41   
ref|XP_008154704.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   5e-41   
ref|XP_010957995.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   5e-41   
ref|XP_010957996.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   6e-41   
gb|EMD93896.1|  hypothetical protein COCHEDRAFT_1129846                 154   6e-41   
ref|XP_006211070.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   6e-41   
gb|ELT91052.1|  hypothetical protein CAPTEDRAFT_223439                  152   7e-41   
ref|XP_007101808.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   7e-41   
ref|XP_005882452.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   8e-41   
ref|XP_004884840.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   8e-41   
ref|XP_005818916.1|  hypothetical protein GUITHDRAFT_98705              152   8e-41   
ref|XP_006089899.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    152   8e-41   
gb|AAH05284.1|  TGDS protein                                            151   9e-41   
ref|XP_006978807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   9e-41   
ref|XP_004604078.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   9e-41   
dbj|GAM29125.1|  hypothetical protein SAMD00019534_123010               152   1e-40   
ref|XP_011126737.1|  hypothetical protein AOL_s00188g187                153   1e-40   
ref|XP_007689960.1|  hypothetical protein COCMIDRAFT_100591             153   1e-40   
ref|XP_011106233.1|  hypothetical protein H072_241                      152   1e-40   
ref|XP_006769641.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   1e-40   
ref|XP_005079467.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   1e-40   
gb|EGU75304.1|  hypothetical protein FOXB_14183                         152   1e-40   
ref|XP_008057635.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   1e-40   
ref|XP_005487541.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   1e-40   
ref|XP_004273708.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    151   1e-40   
ref|XP_005374169.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40   
ref|XP_005037773.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   2e-40   
ref|XP_005516855.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   2e-40   
gb|EQL02570.1|  dTDP-D-glucose 4,6-dehydratase                          152   2e-40   
ref|XP_004355810.1|  putative dTDP-D-glucose 4,6-dehydratase            149   2e-40   
gb|EKG22293.1|  hypothetical protein MPH_00360                          156   2e-40   
ref|XP_007101807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    151   2e-40   
ref|XP_009002779.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   2e-40   
ref|XP_005586151.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   2e-40   
gb|KDB17974.1|  dtdp-glucose 4,6-dehydratase                            153   2e-40   
ref|NP_055120.1|  dTDP-D-glucose 4,6-dehydratase isoform 1              151   2e-40   
ref|XP_003928247.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          151   2e-40   
ref|XP_006692796.1|  dtdp-glucose 4,6-dehydratase-like protein          153   2e-40   
ref|XP_007701224.1|  hypothetical protein COCSADRAFT_119751             152   2e-40   
ref|XP_007715776.1|  hypothetical protein COCCADRAFT_39769              152   2e-40   
ref|XP_002742523.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   2e-40   
ref|XP_005374168.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40   
ref|XP_005586149.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40   
ref|XP_522697.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    150   3e-40   
ref|XP_004709829.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   3e-40   
ref|XP_003832071.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40   
emb|CEJ93891.1|  Putative dTDP-D-glucose 4,6-dehydratase                151   3e-40   
ref|XP_010809203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40   
ref|XP_003257436.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   3e-40   
ref|XP_002824410.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   3e-40   
ref|NP_001270865.1|  uncharacterized protein LOC101926513               150   3e-40   
ref|XP_004423167.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   3e-40   
ref|XP_007942199.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   4e-40   
ref|XP_004054696.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   4e-40   
ref|XP_001491790.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   4e-40   
ref|XP_006080395.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   4e-40   
ref|XP_005687758.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   4e-40   
ref|XP_005909299.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   4e-40   
emb|CCG81052.1|  Dtdp-glucose 4,6-dehydratase                           150   4e-40   
gb|EHH58661.1|  dTDP-D-glucose 4,6-dehydratase                          150   4e-40   
ref|NP_001094629.1|  dTDP-D-glucose 4,6-dehydratase                     150   4e-40   
emb|CEJ87410.1|  Putative dTDP-D-glucose 4,6-dehydratase                152   4e-40   
ref|XP_006879634.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   5e-40   
ref|XP_006913872.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   5e-40   
ref|XP_001938042.1|  dTDP-D-glucose 4,6-dehydratase                     151   5e-40   
ref|XP_011353793.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          150   5e-40   
gb|EWC48070.1|  hypothetical protein DRE_02649                          150   6e-40   
ref|XP_010357203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40   
ref|XP_009190350.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    150   6e-40   
ref|XP_004577690.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          152   7e-40   
ref|XP_003789623.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   8e-40   
gb|KIM94915.1|  hypothetical protein OIDMADRAFT_206707                  151   8e-40   
ref|XP_009653544.1|  dTDP-D-glucose 4,6-dehydratase                     150   8e-40   
gb|EGZ71579.1|  NAD(P)-binding protein                                  152   8e-40   
ref|XP_005970989.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   9e-40   
ref|XP_003839159.1|  hypothetical protein LEMA_P028320.1                151   9e-40   
ref|XP_002196929.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   1e-39   
dbj|GAD98335.1|  dTDP-D-glucose 4,6-dehydratase-like protein            150   1e-39   
ref|XP_008595173.1|  dTDP-D-glucose 4,6-dehydratase                     150   1e-39   
ref|XP_011393834.1|  dTDP-D-glucose 4,6-dehydratase, variant 1          152   1e-39   
ref|XP_011393833.1|  dTDP-D-glucose 4,6-dehydratase                     152   1e-39   
ref|XP_008023470.1|  hypothetical protein SETTUDRAFT_168049             150   1e-39   
gb|EWG55513.1|  dTDP-glucose 4,6-dehydratase                            149   1e-39   
gb|KGQ08679.1|  putative rhamnose biosynthetic enzyme 2                 150   2e-39   
gb|AEH41993.1|  UDP-glucose-4,6-dehydratase                             150   2e-39   
ref|XP_007586615.1|  putative dtdp-d-glucose -dehydratase protein       149   2e-39   
ref|XP_003717261.1|  dTDP-D-glucose 4,6-dehydratase                     150   2e-39   
emb|CCC10630.1|  unnamed protein product                                151   2e-39   
ref|XP_004650848.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          149   2e-39   
ref|XP_005305067.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    147   2e-39   
gb|KIM94721.1|  hypothetical protein OIDMADRAFT_45648                   149   2e-39   
ref|XP_416988.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...    148   2e-39   
ref|XP_008083851.1|  NAD(P)-binding Rossmann-fold containing protein    150   2e-39   
ref|XP_004457791.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   2e-39   
gb|KFH41770.1|  rhamnose biosynthetic enzyme-like protein               149   2e-39   
ref|XP_004012251.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          148   3e-39   
gb|KEY69402.1|  hypothetical protein S7711_05716                        149   3e-39   
ref|XP_004626312.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          148   3e-39   
ref|XP_005144815.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   4e-39   
ref|XP_006832128.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...    148   4e-39   
ref|XP_003852374.1|  hypothetical protein MYCGRDRAFT_93541              149   4e-39   
ref|XP_005014901.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   5e-39   
ref|XP_009632893.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   5e-39   
ref|XP_010185292.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   5e-39   
gb|KFQ37860.1|  dTDP-D-glucose 4,6-dehydratase                          147   5e-39   
ref|XP_001908195.1|  hypothetical protein                               145   5e-39   
ref|XP_003765842.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   6e-39   
ref|XP_002939327.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    145   6e-39   
gb|EPQ61968.1|  UDP-glucose-4-epimerase                                 149   7e-39   
ref|XP_003003224.1|  dTDP-D-glucose 4,6-dehydratase                     148   8e-39   
ref|XP_007819737.1|  dTDP-D-glucose 4,6-dehydratase                     149   8e-39   
ref|XP_006270243.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   8e-39   
gb|KIE00314.1|  dTDP-D-glucose 4,6-dehydratase                          148   9e-39   
ref|XP_005305066.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    147   9e-39   
ref|XP_007098479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          147   9e-39   
gb|KID89209.1|  dTDP-D-glucose 4,6-dehydratase                          148   9e-39   
gb|KFG80826.1|  dTDP-D-glucose 4,6-dehydratase                          148   1e-38   
ref|XP_007296149.1|  dTDP-glucose 4,6-dehydratase                       147   1e-38   
emb|CCU76670.1|  putative dTDP-D-glucose 4,6-dehydratase                148   1e-38   
gb|KID73157.1|  dTDP-D-glucose 4,6-dehydratase                          148   1e-38   
gb|ESZ93043.1|  dTDP-D-glucose 4,6-dehydratase                          147   1e-38   
gb|KFY70636.1|  hypothetical protein V499_09028                         147   1e-38   
ref|XP_003218711.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          146   1e-38   
ref|XP_816514.1|  GDP-mannose 4,6 dehydratase                           147   1e-38   
ref|XP_007912472.1|  putative dtdp-d-glucose -dehydratase protein       147   1e-38   
ref|XP_007526909.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          146   1e-38   
ref|XP_001377580.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...    146   1e-38   
dbj|GAM88310.1|  hypothetical protein ANO11243_063430                   146   2e-38   
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1                 149   2e-38   
gb|EPE08996.1|  dtdp-d-glucose -dehydratase                             147   2e-38   
gb|KFY20012.1|  hypothetical protein V493_07767                         147   2e-38   
gb|EFQ25012.1|  dTDP-glucose 4,6-dehydratase                            147   2e-38   
ref|XP_009225668.1|  dTDP-D-glucose 4,6-dehydratase                     146   2e-38   
gb|KFY82818.1|  hypothetical protein V500_10312                         147   3e-38   
gb|KFZ04490.1|  hypothetical protein V502_10111                         147   3e-38   
ref|XP_007599732.1|  dTDP-glucose 4,6-dehydratase                       147   3e-38   
gb|ERS98048.1|  dTDP-glucose 4,6-dehydratase                            146   3e-38   
gb|KHO00791.1|  dTDP-D-glucose 4,6-dehydratase                          147   3e-38   
gb|KFA63530.1|  hypothetical protein S40285_00334                       146   3e-38   
ref|XP_003297172.1|  hypothetical protein PTT_07488                     149   3e-38   
gb|ELR02481.1|  dTDP-glucose 4,6-dehydratase                            146   4e-38   
emb|CCE32211.1|  related to dTDP-glucose 4,6-dehydratase                146   4e-38   
gb|KDN69228.1|  putative dTDP-glucose 4,6-dehydratase                   146   5e-38   
emb|CCF46678.1|  dTDP-D-glucose 4,6-dehydratase                         140   5e-38   
gb|KFX91512.1|  hypothetical protein O988_07719                         145   6e-38   
ref|XP_006639064.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase-like     144   6e-38   
gb|KFY39353.1|  hypothetical protein V495_06000                         146   6e-38   
ref|XP_007275549.1|  dtdp-glucose -dehydratase                          145   6e-38   
ref|XP_009311908.1|  GDP-mannose 4,6 dehydratase                        145   7e-38   
gb|EHK18741.1|  hypothetical protein TRIVIDRAFT_44345                   145   7e-38   
gb|KDB11057.1|  dtdp-glucose 4,6-dehydratase                            145   7e-38   
ref|XP_003655256.1|  hypothetical protein THITE_2118740                 146   8e-38   
ref|XP_001598557.1|  conserved hypothetical protein                     145   8e-38   
ref|XP_007834293.1|  hypothetical protein PFICI_07521                   145   8e-38   
ref|XP_006968013.1|  predicted protein                                  145   8e-38   
ref|XP_807120.1|  GDP-mannose 4,6 dehydratase                           144   9e-38   
ref|XP_009254933.1|  hypothetical protein FPSE_03539                    145   1e-37   
gb|EXA38893.1|  dTDP-glucose 4,6-dehydratase                            145   1e-37   
ref|XP_007795374.1|  putative dtdp-glucose -dehydratase protein         145   1e-37   
gb|EWY86757.1|  dTDP-glucose 4,6-dehydratase                            145   1e-37   
gb|EGU76750.1|  hypothetical protein FOXB_12771                         145   1e-37   
gb|ENH73142.1|  Putative rhamnose biosynthetic enzyme 2                 145   1e-37   
gb|EWG46674.1|  dTDP-glucose 4,6-dehydratase                            145   1e-37   
gb|ESS64487.1|  GDP-mannose 4,6 dehydratase                             146   1e-37   
gb|EXK94947.1|  dTDP-glucose 4,6-dehydratase                            145   1e-37   
gb|KEQ60949.1|  dTDP-glucose 4,6-dehydratase                            145   1e-37   
ref|XP_011324006.1|  hypothetical protein FGSG_05467                    145   1e-37   
ref|XP_007440567.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase          144   1e-37   
gb|KHJ33395.1|  putative dtdp-d-glucose -dehydratase                    144   1e-37   



>gb|KJB61503.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=535

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   311 bits (798),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIA HVANRLVRSYP+YKIV++DKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIA HVANRLVRSYP+YKIV++DKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YPNYKIV++DKLDYCSNLKNLLPSRSSPNFK
Sbjct  1    MATFTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/154 (96%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIA HVANRLVRSYP+YKIV++DKLDYCSNLKNL+PSR SPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/154 (95%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+TYTPKNILITGAAGFIA HVANRLVRSYP+YKIV++DKLDYCS+LKNL+PSRSSPNFK
Sbjct  1    MSTYTPKNILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSSLKNLIPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   308 bits (790),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KJB45830.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=403

 Score =   300 bits (768),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNLLPS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MPSYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   LTQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLL  253
            LT++ S  +M +YTPKNILITGAAGFIASHVANRLVRS+P YKIV++DKLDYCSNLKNLL
Sbjct  122  LTEQISKPDMASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLL  181

Query  254  PSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT  433
            PS++SPNFKFVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT
Sbjct  182  PSKASPNFKFVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT  241

Query  434  HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  242  HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  284



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRLVRS+P YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPSRSSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+Y IV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+Y IV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   306 bits (784),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MGSYTPKNILITGAAGFIASHVANRLIRSYPGYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KCW47402.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=530

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNLLPSRSSPNFKF
Sbjct  3    TAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDIASADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            +M +YTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCS+LKNLLPS+SSPNF
Sbjct  23   DMASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNF  82

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  83   KFVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  142

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  143  VTGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  177



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            MTT+TPKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNLLPS +SPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSNASPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP YKIV++DK+DYCSNLKNL PSRSSPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPQYKIVVLDKIDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            +M +YTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCS+LKNLLPS+SSPNF
Sbjct  22   DMASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNF  81

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  82   KFVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  141

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  142  VTGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  176



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            +M T+TPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL+PSRSSPNF
Sbjct  12   DMATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNF  71

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  72   KFVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  131

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  132  VTGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  166



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCS+LKNLLPS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY+PKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYSPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNLLPS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/154 (95%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNLLPS+SS NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL+PSRSSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSNLKNLLPS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DK+DYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+ YTPKNILITGAAGFIASHVANRLVRSYP+Y IV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPDYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSNLKNLLPS+ SPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 153/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            MTT+TPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MTTFTPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIDSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGD+ SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+SSPNFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGD+ SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDVGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+T+TPKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSNLKNLLPS SSPNFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLVRTYPGYKIVVLDKLDYCSNLKNLLPSNSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FV+GDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVQGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>gb|KJB12930.1| hypothetical protein B456_002G046100 [Gossypium raimondii]
Length=371

 Score =   295 bits (754),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY P+NILITGAAGFIASHV NRL+R+YP+YKIV +DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPRNILITGAAGFIASHVTNRLIRNYPSYKIVALDKLDYCSNLKNLHPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FV+GDI SADLVNYLL TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIGSADLVNYLLFTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MAAYNPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRLVRS+P YKIV++DKLDYCSNLKNLLPS+SS NFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSSNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAIVGNHEASQLL  154



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PSR SPNFK
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSNLKNLNPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL+PS+SSPNFK
Sbjct  1    MATHTPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAIVGNHEASQLL  154



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/154 (94%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVRSYP YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRSYPEYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>emb|CDY25850.1| BnaA05g14410D [Brassica napus]
Length=428

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNFKF
Sbjct  3    TTYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLV+YLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>gb|KJB45829.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=546

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNLLPS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KJB45828.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=564

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNLLPS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVAN+LVRSYP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANKLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  154



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNLLPSRSSPNFKF
Sbjct  3    TAYTPKNILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDIASADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIASADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+ YTPKNILITGAAGFIASHVANRLVRSYP Y IV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MSNYTPKNILITGAAGFIASHVANRLVRSYPEYNIVVLDKLDYCSNLKNLSPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLMTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            +GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  SGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  154



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  YTPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MANYTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLSPSQSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  154



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 149/151 (99%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNILITGAAGFIASHVANRL+R+YPNYKIV++DKLDYCSNLKNLLPSRSSPNFKFVK
Sbjct  14   YTPKNILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFKFVK  73

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  74   GDIASADLVNFLLITEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  133

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            + RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  134  VTRFIHVSTDEVYGETDEDAVVGNHEASQLL  164



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MASYEPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI S DLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSVDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   302 bits (773),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  +TPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNL N LPSRSSPNFK
Sbjct  1    MAAHTPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLNNFLPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKL  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL+PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLL+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010916151.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Elaeis guineensis]
Length=673

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FV GDIASAD+VNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVNGDIASADVVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL+PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL+PS++S NFK
Sbjct  1    MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCS LKNLLPS+SS NFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSELKNLLPSQSSANFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   301 bits (770),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNLLPS+ SPNFK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   301 bits (770),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            ++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            ++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            ++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS+ SPNFKF
Sbjct  3    SSYTPKNILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNYLLITERIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + TTYTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF
Sbjct  3    DTTTYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIAS DLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  63   KFVKGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  VTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  157



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCS+LKNL PSRSSPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSSLKNLNPSRSSPNLK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>gb|ABF95280.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
Length=545

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLL TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + TTYTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF
Sbjct  3    DTTTYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIAS DLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  63   KFVKGDIASDDLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  VTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  157



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNIL+TGAAGFIASHVANRLVRSYP+YKIV++DKLDYCS+LKNL PS+SSPNFK
Sbjct  1    MATYKPKNILVTGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FV+GDIASADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVEGDIASADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  154



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M+T+TPKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNLLPS++S NFK
Sbjct  1    MSTFTPKNILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLLPSKASANFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETEEDAVVGNHEASQLL  154



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGA GFIASHVAN L+R+YP YKIV++DKLDYCSNLKNL PSRSSPNFK
Sbjct  1    MATYKPKNILITGAGGFIASHVANCLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSNLKNL PSRS PNF+
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPKYKIVVLDKLDYCSNLKNLNPSRSCPNFR  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQ+RRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+RSYP+Y IV++DKLDYCSNLKNL PS+ SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRSYPHYNIVVLDKLDYCSNLKNLNPSKQSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + TTYTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF
Sbjct  3    DTTTYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  63   KFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  VTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  157



>ref|XP_008812156.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHV NRL+R+YP YKIV++D+LDYCSNLKNL PS SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVTNRLIRNYPEYKIVVLDRLDYCSNLKNLNPSSSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  154



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNLLPS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPSFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + TTYTPKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF
Sbjct  3    DTTTYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  63   KFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  VTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  157



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score =   299 bits (765),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCS+LKNL PSR SPN K
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRPSPNLK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y P+NILITGAAGFIASHVANRLVRSYP+YKIV++DKLDYCSN+KNLLPS+SSP +K
Sbjct  1    MAPYKPQNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNMKNLLPSQSSPKYK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            +G +RRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  SGGVRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M++YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PSR SPNFK
Sbjct  1    MSSYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI RFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQITRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS++SP+FK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  121  TGQVRRFIHVSTDEVYGETDEDALVGNHEASQLL  154



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCS+L NL PSR SPNFK
Sbjct  1    MAAYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVNYLL TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNYLLTTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCSNLKNLLPS+ S NFK
Sbjct  1    MATYKPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKLSANFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +Y PKNILITGAAGFIASHVANRLVR+YP YKIV++DKLDYCSN KNL PS+ SP+FK
Sbjct  1    MASYKPKNILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLFPSKLSPSFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIESADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPK+ILITGAAGFIASHV NR+VR+YP+YKIV++DKLDYCSNLKNLLP+ SSPNFKF
Sbjct  3    TPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPK+ILITGAAGFIASHV NR+VR+YP+YKIV++DKLDYCSNLKNLLP+ SSPNFKF
Sbjct  3    TPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/151 (93%), Positives = 148/151 (98%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV NR+VRSYP+YKIV++DKLDYCSNLKNLLP+ SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVTNRIVRSYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFVK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            IRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  125  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPK+ILITGAAGFIASHV NR+VR+YP+YKIV++DKLDYCSNLKNLLP+ SSPNFKF
Sbjct  3    TPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 150/153 (98%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPK+ILITGAAGFIASHV NR+VR+YP+YKIV++DKLDYCSNLKNLLP+ SSPNFKF
Sbjct  3    TPYTPKSILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRLVR+YP+YK+V++DKLDYCSNLKNL PS  SPNFK
Sbjct  1    MASYTPKNILITGAAGFIASHVANRLVRNYPDYKVVVLDKLDYCSNLKNLHPSLCSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLV++LL+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVHFLLLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 151/154 (98%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M +YTPKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS++SP+FK
Sbjct  38   MASYTPKNILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFK  97

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  98   FVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  157

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQ+RRFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  158  TGQVRRFIHVSTDEVYGETDEDALVGNHEASQLL  191



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + TTY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF
Sbjct  3    DTTTYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK
Sbjct  63   KFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  VTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  157



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            MT+YTPKNILITGAAGFIA HVANRL R++  YKIV++DKLDYCSNLKNLLPS+S+PNFK
Sbjct  1    MTSYTPKNILITGAAGFIACHVANRLTRNFTEYKIVVLDKLDYCSNLKNLLPSKSAPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FV+GDIASADLVN+LLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+V
Sbjct  61   FVQGDIASADLVNHLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score =   296 bits (759),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/154 (93%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLV +YP YKIV++DKLDYCSNLKNL  SRSSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVWNYPEYKIVVLDKLDYCSNLKNLNLSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIGSADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNFKF
Sbjct  3    TTYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLV+YLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF+F
Sbjct  3    TTYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/153 (92%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCS+LKNL PS SSPNFKF
Sbjct  4    TTYKPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKF  63

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  64   VKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  124  GQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  156



>emb|CDP21573.1| unnamed protein product, partial [Coffea canephora]
Length=247

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY P+NILITGAAGF+ASHVANRL+R+YP+YKIV++DKLDYCSN KNL PSRSSPNFK
Sbjct  1    MATYKPENILITGAAGFVASHVANRLIRNYPSYKIVVLDKLDYCSNEKNLNPSRSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN++L+TESIDT+MHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTLMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             G I+RFIHVSTD+VYG TD DAVVGNHEASQLL
Sbjct  121  AGNIKRFIHVSTDDVYGGTDGDAVVGNHEASQLL  154



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCS+LKNL PSR+S N K
Sbjct  1    MATYEPKNILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASQNLK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LL+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/153 (90%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHV NRL+R+YP Y IV++DKLDYCSNLKNL PSRSSPNFKF
Sbjct  3    TTYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLHPSRSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHV N LVR+YP+YKIV++DKLDYCS+LKNL PSR+SPN K
Sbjct  1    MATYEPKNILITGAAGFIASHVTNCLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN+LL+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHLLVTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF+F
Sbjct  3    TEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/153 (92%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            TTY PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNFKF
Sbjct  3    TTYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLV+YLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVSYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             QIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  RQIRRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF+F
Sbjct  3    TEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/153 (91%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHVANRL+RSYP+YKIV++DKLDYCS+LKNL PS SSPNF+F
Sbjct  3    TEYKPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIAS DLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   VKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAAVGNHEASQLL  155



>ref|XP_007146360.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
 gb|ESW18354.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
Length=666

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 149/153 (97%), Gaps = 1/153 (1%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            TY PKNILITGAAGFIASHV NR+VR+YP+YKIV++DKLDYCSNLKNL+PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIVVLDKLDYCSNLKNLMPSRSSPNFKFI  63

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  463
            KGDI SADLVNY+L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSG  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLL  156



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL PSRSS NFKF
Sbjct  3    TAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL PSRSS NFKF
Sbjct  3    TAYKPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTRNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNIL+TGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL PS+SSPNFKF
Sbjct  3    TAYKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLHPSKSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|KHN18103.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=660

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 149/153 (97%), Gaps = 1/153 (1%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            TY PKNILITGAAGFIASHV NR+VR+YP+YKI+++DKLDYCSNLKNL+PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  463
            KGDI SADLVNY+L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLL  156



>ref|XP_003551914.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006602243.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=660

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 149/153 (97%), Gaps = 1/153 (1%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            TY PKNILITGAAGFIASHV NR+VR+YP+YKI+++DKLDYCSNLKNL+PSRSSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  463
            KGDI SADLVNY+L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLL  156



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL PSR+S NFKF
Sbjct  4    TMYEPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSRASKNFKF  63

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  64   VKGDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGET+ +A+VGNHEASQLL
Sbjct  124  GQIKRFIHVSTDEVYGETEAEAIVGNHEASQLL  156



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +2

Query  89   SPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSS  268
            +P  +  Y PKNILITGAAGFIASHVANRL+R+YP YKIV++DKLDYCSNLKNL PS++S
Sbjct  3    NPGKVDAYVPKNILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSKAS  62

Query  269  PNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  448
             NFKFVKGDI SADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE
Sbjct  63   KNFKFVKGDIGSADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  122

Query  449  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ACKVTGQI+RFIHVSTDEVYGET+ +A+VGNHEASQLL
Sbjct  123  ACKVTGQIKRFIHVSTDEVYGETEAEAIVGNHEASQLL  160



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  89   SPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSS  268
            +P     Y PKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS++S
Sbjct  3    NPGGSQGYVPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKAS  62

Query  269  PNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  448
             NFKFVKGDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE
Sbjct  63   KNFKFVKGDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  122

Query  449  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ACKVTGQI+RFIHVSTDEVYGET+ +A+VGNHEASQLL
Sbjct  123  ACKVTGQIKRFIHVSTDEVYGETEAEAIVGNHEASQLL  160



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNIL+TGAAGFIASHV NRL+R+YP YKIV++DKLDYCSNLKNL PS+SSP FKF
Sbjct  3    TAYKPKNILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLNPSKSSPKFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 148/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCS+LKNL P+R SPNFKF
Sbjct  3    TRYTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLNPARLSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDIASADLV ++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIASADLVQFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY P+NILITGAAGFIA HVANRL+R+YP YKIV++DKLDYCSN KNL PS SSPNFK
Sbjct  1    MATYKPENILITGAAGFIACHVANRLIRNYPRYKIVVLDKLDYCSNKKNLDPSCSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADLVNHILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TG I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  121  TGNIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  154



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+ +YP YKIV++DKLDYCSNLKNL PSR SPNFKF
Sbjct  3    TVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGD+ASADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+T
Sbjct  63   IKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKIT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score =   288 bits (737),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+ +YP YKIV++DKLDYCSNLKNL PSR SPNFKF
Sbjct  3    TVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGD+ASADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+T
Sbjct  63   IKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKIT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score =   288 bits (737),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T YTPKNILITGAAGFIASHV NRL+ +YP YKIV++DKLDYCSNLKNL PSR SPNFKF
Sbjct  3    TVYTPKNILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGD+ASADLV+++L+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+T
Sbjct  63   IKGDVASADLVHFILLTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKIT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNIL+TGAAGFIASHV NRL+++YP YKIV++DKLDYCSNLKNL PS+SSPNFKF
Sbjct  3    TVYKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score =   288 bits (736),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHV NRL+R+YP Y IV++DKLDYCSNLKNLLPSRSS N KF
Sbjct  3    TAYKPKNILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLLPSRSSLNIKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGET+EDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETEEDAVVGNHEASQLL  155



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCS+LKNL PSRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFIK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDA+VGNHEASQLL
Sbjct  125  IKRFIHVSTDEVYGETDEDAMVGNHEASQLL  155



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFIASHVA R+ + YP+YKIV++DKLDYCSNLKNLLP  SSPNFKF
Sbjct  3    TAYKPKNILITGAAGFIASHVAIRITKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIASADLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK+T
Sbjct  63   VKGDIASADLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKIT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGN EASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNKEASQLL  155



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHVA R+ + YP+YKIV++DKLDYCSNLKNLLP  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRVTKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVN+LL+TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC++TGQ
Sbjct  65   GDIASADLVNFLLVTEKIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRITGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   286 bits (732),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNIL+TGAAGFIASHV NRL+++YP YKIV++DKLDYCSNLKNL PS+SSPN KF
Sbjct  3    TAYKPKNILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNLKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SADLVN++L+TE+IDTIMHFAAQTHVDNSFGNSFEFT+NNIYGTHVLLEACKVT
Sbjct  63   IKGDIGSADLVNFILLTENIDTIMHFAAQTHVDNSFGNSFEFTQNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  123  GQIKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>gb|AFW77499.1| hypothetical protein ZEAMMB73_283149 [Zea mays]
Length=529

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHVA R+ + YP+YKI+++DKLDYCSNLKNLLP  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIAS DLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  165



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNILITGAAGFIASHV NRL+R+YP+YKIV++DKLDYCS+LKNL  SRSSPNFKF+K
Sbjct  5    YTPKNILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDRSRSSPNFKFIK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLV+++L TE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  65   GDIASADLVHFILQTEFIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            + PKNILITGAAGFIASHVANRL+R+YP+YKIV++DKLDYCSNLKNL PS+ S NFKFVK
Sbjct  2    HEPKNILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKGSKNFKFVK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ
Sbjct  62   GDIASADLVNFLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGET+ +A+VGNHEASQLL
Sbjct  122  IKRFIHVSTDEVYGETEVEAIVGNHEASQLL  152



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHVA R+ + YP+YKI+++DKLDYCSNLKNLLP  SSPNFKFVK
Sbjct  5    YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  64

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIAS DLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  65   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  124

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  125  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  155



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHVA R+ + YP+YKI+++DKLDYCSNLKNLLP  SSPNFKFVK
Sbjct  15   YKPKNILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFVK  74

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIAS DLVN+LL+TE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC+++GQ
Sbjct  75   GDIASVDLVNFLLVTENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACRISGQ  134

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  135  IKRFIHVSTDEVYGETDEDAVVGNHEASQLL  165



>ref|XP_002989472.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
 gb|EFJ09348.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
Length=675

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTP+NILITGAAGFIASHVANRLVRSYP YKIV++DKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLL
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLL  164



>ref|XP_002964674.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
 gb|EFJ35007.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
Length=676

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTP+NILITGAAGFIASHVANRLVRSYP YKIV++DKLDYCSNLKNL  S+ S NFKFVK
Sbjct  14   YTPRNILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFVK  73

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASADLVNYLLITE IDTIMHFAAQTHVDNSFGNS EFTKNNIYGTHVLLEACKV G 
Sbjct  74   GDIASADLVNYLLITEGIDTIMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLEACKVAGT  133

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            IRRFIHVSTDEVYGET+ DA+VGNHEASQLL
Sbjct  134  IRRFIHVSTDEVYGETEADAIVGNHEASQLL  164



>gb|KHM99622.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=582

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 146/153 (95%), Gaps = 1/153 (1%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            TY PKNILITGAAGFIASHV NR+V++YP+YKI+++DKLDYCSNLKNL+   SSPNFKF+
Sbjct  4    TYKPKNILITGAAGFIASHVCNRIVQNYPDYKIIVLDKLDYCSNLKNLIHLCSSPNFKFI  63

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT-  463
            KGDI SADLVNY+L+TESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV+ 
Sbjct  64   KGDIGSADLVNYILLTESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVSK  123

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQ++RFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  124  GQVKRFIHVSTDEVYGETDEDAVVGNHEASQLL  156



>gb|EMT08126.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=433

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 144/157 (92%), Gaps = 1/157 (1%)
 Frame = +2

Query  92   PVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSP  271
            P+ M TY PKNILITGAAGFIASHVANRLVR+YP Y IVI+D++DYCS+L+NL PSR SP
Sbjct  63   PLQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSP  122

Query  272  NFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  451
            NFKFV+GDIASADLVN+LL+TESIDT+MHFAAQTHVDNSF +SFEFTKNN+YGTHVLLEA
Sbjct  123  NFKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSSSFEFTKNNVYGTHVLLEA  182

Query  452  CKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            CK   +IRRFIHVSTDEVYGETD +AVVGNHE S+LL
Sbjct  183  CKQV-KIRRFIHVSTDEVYGETDLNAVVGNHEESRLL  218



>ref|XP_002515360.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
 gb|EEF46809.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
Length=369

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            N   Y PK ILITGAAGFIASHV NRL+R+YP+YKIV +DKLDYCS+L+NL P RSSPNF
Sbjct  4    NHAPYEPKKILITGAAGFIASHVTNRLIRNYPDYKIVALDKLDYCSSLRNLTPCRSSPNF  63

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIASADLVN+LLI E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK
Sbjct  64   KFVKGDIASADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACK  123

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            VT +I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  124  VTKKIKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNIL+TGAAGFIASHV NRL+R+YP+Y IV++DKLDYCSNLKNL PS SSPNFKF
Sbjct  3    TEYKPKNILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGD  SAD VN++L+TE+IDTIMHFAAQTHVDNSFGNSF FTKNNIYGTHVLLEACKVT
Sbjct  63   IKGDKGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNIYGTHVLLEACKVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RF+HVSTDEVYGET+E AVVGNHEASQLL
Sbjct  123  GQIKRFVHVSTDEVYGETNEGAVVGNHEASQLL  155



>gb|EMS55907.1| putative rhamnose biosynthetic enzyme 3 [Triticum urartu]
Length=492

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 143/157 (91%), Gaps = 1/157 (1%)
 Frame = +2

Query  92   PVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSP  271
            P+ M TY PKNILITGAAGFIASHVANRLVR+YP Y IVI+D++DYCS+L+NL PSR SP
Sbjct  89   PLQMATYEPKNILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSP  148

Query  272  NFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  451
            NFKFV+GDIASADLVN+LL+TESIDT+MHFAAQTHVDNSF  SFEFTKNN+YGTH+LLEA
Sbjct  149  NFKFVRGDIASADLVNHLLVTESIDTVMHFAAQTHVDNSFSCSFEFTKNNVYGTHILLEA  208

Query  452  CKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            CK   +IRRFIHVSTDEVYGETD +AVVGNHE S+LL
Sbjct  209  CKQV-KIRRFIHVSTDEVYGETDVNAVVGNHEESRLL  244



>ref|XP_004172221.1| PREDICTED: probable rhamnose biosynthetic enzyme 2-like, partial 
[Cucumis sativus]
Length=354

 Score =   263 bits (673),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV NRL+++YP+YKIV +DKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  159



>ref|XP_008351771.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnose biosynthetic 
enzyme 1, partial [Malus domestica]
Length=340

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  125  ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVKGDIAS  304
            ILITGAAGFI  HV N+L+R+YP YKI+++DKLDYCSNLKNL PS SSPN KF+KGDI S
Sbjct  1    ILITGAAGFIGXHVVNQLMRNYPEYKILVLDKLDYCSNLKNLHPSHSSPNLKFIKGDICS  60

Query  305  ADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFI  484
            AD VN +L+ ESIDTIMHFAAQTHVDNSFGNSFEFTKNN+YGT VLLEACKVTGQI+RFI
Sbjct  61   ADFVNSILLNESIDTIMHFAAQTHVDNSFGNSFEFTKNNVYGTQVLLEACKVTGQIKRFI  120

Query  485  HVSTDEVYGETDEDAVVGNHEASQLL  562
            HVSTDEVYGETDE+AVVGNHEASQLL
Sbjct  121  HVSTDEVYGETDENAVVGNHEASQLL  146



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  92   PVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSP  271
            P    TYTPKNIL+TGAAGFIASHV NRL+++YPNY IV +DKLDYCS++KNLLPS+SSP
Sbjct  3    PQTDDTYTPKNILLTGAAGFIASHVTNRLIKNYPNYNIVALDKLDYCSSIKNLLPSQSSP  62

Query  272  NFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEA  451
            NFKFVKGDI S+DLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEA
Sbjct  63   NFKFVKGDIMSSDLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEA  122

Query  452  CKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            CKVT QI+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  123  CKVTRQIKRFIHVSTDEVYGETDAETDIGNCEASQLL  159



>gb|EYU29575.1| hypothetical protein MIMGU_mgv1a008395mg [Erythranthe guttata]
Length=375

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y PKNILITG AGFIASHV+N L R+Y  Y IV++DKLDYCSNLKNL  SRS PNFK
Sbjct  1    MEKYKPKNILITGGAGFIASHVSNWLTRNYSQYIIVVLDKLDYCSNLKNLDSSRSFPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI SADLVNY+L+TESIDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDICSADLVNYILVTESIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKA  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            + +I+RF+HVSTDEVYGETDE+A VGNHEASQLL
Sbjct  121  SNRIKRFVHVSTDEVYGETDENAAVGNHEASQLL  154



>gb|AFW66842.1| hypothetical protein ZEAMMB73_620875 [Zea mays]
Length=407

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSP--NF  277
            T Y PK ILITGAAGFIASHVA R+V  YP YK+V++DKLDYCSNLKNLLP   S   NF
Sbjct  5    TPYKPKRILITGAAGFIASHVAIRIVNRYPEYKVVVLDKLDYCSNLKNLLPVMGSGGNNF  64

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDIASADLV+++L TE IDT+MHFAAQTHVDNSFGNS EFTKNNIYGTHVLLE+C+
Sbjct  65   KFVKGDIASADLVSFILATEGIDTVMHFAAQTHVDNSFGNSLEFTKNNIYGTHVLLESCR  124

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
               QIRRFIHVSTDEVYGETD DAVVGNHEASQLL
Sbjct  125  TAAQIRRFIHVSTDEVYGETDGDAVVGNHEASQLL  159



>ref|XP_011082935.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Sesamum indicum]
Length=384

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  Y P+NILITGAAGFIASHVAN L R+Y  Y+I+++DKLDYCSNLKNL PS+S  NFK
Sbjct  1    MDKYKPRNILITGAAGFIASHVANWLTRNYSEYRIIVLDKLDYCSNLKNLDPSQSHHNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGD+ SADLVNY+L TE IDT+MHFAAQTHVDNSFGNSFEF KNN+YGT VLLEACK 
Sbjct  61   FVKGDVCSADLVNYILATEDIDTVMHFAAQTHVDNSFGNSFEFIKNNVYGTCVLLEACKS  120

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             G I+RFIHVSTDEVYGETDE+A VGNHEASQLL
Sbjct  121  FGHIKRFIHVSTDEVYGETDENATVGNHEASQLL  154



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score =   266 bits (679),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PK+IL+TGAAGFIASHV NRL+R+YP+Y IV++DKLDYCSNLKNL PS SS NFKF
Sbjct  3    TEYKPKSILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSANFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDI SAD VN++L+TE+IDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLEAC VT
Sbjct  63   IKGDIGSADFVNFILLTENIDTIMHFAAQTHVDNSFGNSFGFTKNNICGTHVLLEACNVT  122

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            GQI+RF+HVSTDEVYGET+EDAVVGN EASQLL
Sbjct  123  GQIKRFVHVSTDEVYGETNEDAVVGNPEASQLL  155



>ref|XP_007225132.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
 gb|EMJ26331.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
Length=660

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFI SHV NRL+++YP+YKIV +DKLDYCS+ KNL PSR+SPNFKF
Sbjct  6    TPYAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKLDYCSSFKNLRPSRASPNFKF  65

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIA ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT
Sbjct  66   VKGDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVT  125

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             QI+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  126  QQIKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV NRL+++YP+YKIV +DKLDYCSN+KNL PS++SPNF+F+K
Sbjct  8    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  158



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV NRL+++YP+YKIV +DKLDYCSN+KNL PS++SPNF+F+K
Sbjct  9    YAPKNILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFIK  68

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI SADL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  69   GDIVSADLINYLLVAEEIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTQR  128

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  129  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  159



>ref|XP_006450198.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
 gb|ESR63438.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
Length=661

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            +Y PK ILITGAAGFI SHV NRL+++YP+Y+IV +DKLDYCS+LKNL PSR+SPNFKF+
Sbjct  9    SYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  68

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  466
            KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+TG
Sbjct  69   KGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLTG  128

Query  467  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            Q++RFIHVSTDEVYGETD ++ +GN EASQLL
Sbjct  129  QVKRFIHVSTDEVYGETDMESDIGNPEASQLL  160



>ref|XP_006483733.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=681

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            +Y PK ILITGAAGFI SHV NRL+++YP+Y+IV +DKLDYCS+LKNL PSR+SPNFKF+
Sbjct  29   SYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  88

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  466
            KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+TG
Sbjct  89   KGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLTG  148

Query  467  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            Q++RFIHVSTDEVYGETD ++ +GN EASQLL
Sbjct  149  QVKRFIHVSTDEVYGETDMESDIGNPEASQLL  180



>gb|KDO67325.1| hypothetical protein CISIN_1g035631mg [Citrus sinensis]
Length=684

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            +Y PK ILITGAAGFI SHV NRL+++YP+Y+IV +DKLDYCS+LKNL PSR+SPNFKF+
Sbjct  9    SYKPKKILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  68

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  466
            KGDI  ADL+NYLL++E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+TG
Sbjct  69   KGDITCADLMNYLLVSEGIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKLTG  128

Query  467  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            Q++RFIHVSTDEVYGETD ++ +GN EASQLL
Sbjct  129  QVKRFIHVSTDEVYGETDMESDIGNPEASQLL  160



>ref|XP_008220004.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=660

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFI SHV N+L+++YP+Y IV +DKLDYCS+ KNL PSR+SPNFKF
Sbjct  6    TPYAPKNILITGAAGFIGSHVTNQLIKNYPSYNIVALDKLDYCSSFKNLRPSRASPNFKF  65

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIA ADLVN+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT
Sbjct  66   VKGDIACADLVNHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVT  125

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             QI+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  126  QQIKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>ref|XP_009363628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009367987.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=660

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFI SHV NRL+++YP+YKIV +DK+DYCS+ KNL P RSSPNFKF
Sbjct  6    TPYAPKNILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKF  65

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIA ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT
Sbjct  66   VKGDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVT  125

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             +++RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  126  QRVKRFIHVSTDEVYGETDMETNIGNPEASQLL  158



>emb|CAN62061.1| hypothetical protein VITISV_001928 [Vitis vinifera]
Length=619

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P+NILITGAAGFIASHV NRLV+++P+Y+IV +DKLDYCSN+KNL PSRSS NFKFVK
Sbjct  8    YVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI  ADLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTKR  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD D  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDLDTDIGNPEASQLL  158



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P+NILITGAAGFIASHV NRLV+++P+Y+IV +DKLDYCSN+KNL PSRSS NFKFVK
Sbjct  8    YVPRNILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI  ADLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIVCADLVNHLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVTKR  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD D  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDLDTDIGNPEASQLL  158



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PK+ILITGAAGFI SHV NRL+++YP+YKIV +DK+DYCS+ KNL P RSSPNFKF
Sbjct  6    TPYAPKSILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKF  65

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VKGDIA ADL+N+LLI + IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT
Sbjct  66   VKGDIACADLINHLLIADEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVT  125

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             +++RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  126  QRVKRFIHVSTDEVYGETDMETNIGNPEASQLL  158



>ref|XP_011031381.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=660

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P+ ILITGAAGFIASHV  RL++ YP+YKIV +DKLDYCSNLKNL   R SPNFKFVK
Sbjct  8    YAPRKILITGAAGFIASHVTRRLIKDYPDYKIVALDKLDYCSNLKNLAKCRGSPNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA ADLVN+LLI E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACKVTKK  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>ref|XP_006382137.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
 gb|ERP59934.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
Length=660

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P+ ILITGAAGFIASHV  RL++ YP+YKIV +DKLDYCSNLKNL   R SPNFKFVK
Sbjct  8    YAPRKILITGAAGFIASHVIRRLIKDYPDYKIVALDKLDYCSNLKNLATCRGSPNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA ADLVN+LLI E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKVT +
Sbjct  68   GDIACADLVNHLLIAEDIDTIMHFAAQTHVDNSFGNSFEFTTNNIYGTHVLLEACKVTKK  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 131/154 (85%), Gaps = 19/154 (12%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  135



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 131/154 (85%), Gaps = 19/154 (12%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIASADL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASADL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  135



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFI SHV NRL + YP+Y+IV +DKLDYCS+LKNL PS SSPNFKF
Sbjct  5    TPYVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKF  64

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            VK DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T
Sbjct  65   VKADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLT  124

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
              I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  125  KSIKRFIHVSTDEVYGETDLETDIGNPEASQLL  157



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PK ILITGAAGFIASHV +RL+ +YP YKIV +DKLDYCS+LKNL P  SSPNFKFVK
Sbjct  8    YAPKKILITGAAGFIASHVTSRLINNYPEYKIVALDKLDYCSSLKNLQPCFSSPNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI   DL+NYLL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACKV+ Q
Sbjct  68   GDIICTDLLNYLLVAEDIDTIMHFAAQTHVDNSFGNSFEFTNNNIYGTHVLLEACKVSKQ  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDMETDIGNPEASQLL  158



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 130/154 (84%), Gaps = 19/154 (12%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPHYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIAS DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  102  TGQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  135



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFI SHV NRL + YP+Y+IV +DKLDYCS+LKNL PS SSPNFKFVK
Sbjct  7    YVPKNILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKFVK  66

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
             DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T  
Sbjct  67   ADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLTKS  126

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  127  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  157



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score =   251 bits (641),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKN+LITGAAGFI SHV NRL + YPNY+IV +DKLDYCS+LKNL PS S PNFKFVK
Sbjct  8    YVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSCPNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
             DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T  
Sbjct  68   ADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLTKS  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  158



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKN+LITGAAGFI SHV NRL + YPNY+IV +DKLDYCS+LKNL PS S PNFKFVK
Sbjct  8    YVPKNVLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSCPNFKFVK  67

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
             DI SADL+N+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NNIYGTHVLLEACK+T  
Sbjct  68   ADITSADLINHLLVEEKIDTIMHFAAQTHVDNSFGNSFEFTINNIYGTHVLLEACKLTKC  127

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RFIHVSTDEVYGETD +  +GN EASQLL
Sbjct  128  IKRFIHVSTDEVYGETDLETDIGNPEASQLL  158



>ref|XP_003545554.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
 gb|KHN14574.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  RL+ SYP+YKIV +DK+DYCS  KNL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDSYPSYKIVALDKVDYCSTFKNLQSCASSPNFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA+AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD +A +GNHEASQLL
Sbjct  122  VKRFIHVSTDEVYGETDLEADIGNHEASQLL  152



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 130/155 (84%), Gaps = 20/155 (13%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TY PKNILITGAAGFIASHVANRLVR+YP+YKIV++DKLDYCSNLKNL PS+SSPNFK
Sbjct  1    MATYKPKNILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFK  60

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDIAS DL                   THVDNSFGNSFEFTKNNIYGTHVLLEACKV
Sbjct  61   FVKGDIASDDL-------------------THVDNSFGNSFEFTKNNIYGTHVLLEACKV  101

Query  461  TG-QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TG QIRRFIHVSTDEVYGETDEDA VGNHEASQLL
Sbjct  102  TGQQIRRFIHVSTDEVYGETDEDASVGNHEASQLL  136



>ref|XP_004292875.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
 ref|XP_011459027.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
Length=660

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y PKNILITGAAGFI SHV +RL+++YPNY IV +DKLDYCS+ KNL   ++S NFKF
Sbjct  6    TPYAPKNILITGAAGFIGSHVTSRLIKNYPNYNIVALDKLDYCSSFKNLHACKASHNFKF  65

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            +KGDIA ADLVN+LL+ E IDTIMHFAAQTHVDNSFGNSFEFT NN+YGTHVLLEACKVT
Sbjct  66   IKGDIACADLVNHLLMVEEIDTIMHFAAQTHVDNSFGNSFEFTNNNVYGTHVLLEACKVT  125

Query  464  GQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
             +I+RFIHVSTDEVYGETD  + +GN EASQLL
Sbjct  126  KRIKRFIHVSTDEVYGETDMGSDIGNPEASQLL  158



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  R++  YP+YKIV +DKLDYCS  KNL    SSP FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRIINKYPSYKIVALDKLDYCSTFKNLQSCTSSPKFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIAS D+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASVDIVNHVLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD DA +GNHE SQLL
Sbjct  122  VKRFIHVSTDEVYGETDLDANIGNHETSQLL  152



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  RL+  YP+YKIV +DKLDYCS  KNLL   SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA+AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD DA +GNHEASQLL
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLL  152



>gb|KHN30780.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  RL+  YP+YKIV +DKLDYCS  KNLL   SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA+AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHILIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTNC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD DA +GNHEASQLL
Sbjct  122  VKRFIHVSTDEVYGETDLDADIGNHEASQLL  152



>ref|XP_003566438.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=370

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 6/153 (4%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHVANRLVR YP Y+I+ +DKLDYC++L NL P+ +SPNF+FV+
Sbjct  18   YVPKNILITGAAGFIASHVANRLVRDYPWYRILALDKLDYCASLNNLAPALASPNFRFVR  77

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
             D+ASADLV +LL  E IDT+MHFAAQTHVD    NSFEFTKNN+ GTHVLLEAC+  G 
Sbjct  78   ADVASADLVLHLLNGERIDTVMHFAAQTHVD----NSFEFTKNNVLGTHVLLEACRRAGP  133

Query  470  --IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
              +RRF+HVSTDEVYGETD+DA VGNHEASQLL
Sbjct  134  GAVRRFVHVSTDEVYGETDKDAAVGNHEASQLL  166



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  RL+  YP+YKIV +DKLDYCS  KNL P  SS  FKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTKRLINKYPSYKIVALDKLDYCSTFKNLEPCTSSQKFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIASAD+VN+LLI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+ T  
Sbjct  62   GDIASADIVNHLLIEEEIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRATNC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD D  +GN E SQLL
Sbjct  122  VKRFIHVSTDEVYGETDLDTDIGNIETSQLL  152



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITGAAGFIASHV  +L+  YP+YKIV +DKLDYCS  +NL    SSPNFKF+K
Sbjct  2    YEPKNILITGAAGFIASHVTTKLINKYPSYKIVALDKLDYCSTFRNLKSCISSPNFKFIK  61

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDIA+AD+VN++LI E IDTIMHFAAQTHVDNSFGNS EFT NNIYGTHVLLEAC+VT  
Sbjct  62   GDIATADIVNHVLIEEKIDTIMHFAAQTHVDNSFGNSMEFTYNNIYGTHVLLEACRVTDC  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            ++RFIHVSTDEVYGETD +  +GNHEAS+LL
Sbjct  122  VKRFIHVSTDEVYGETDLEDDIGNHEASRLL  152



>ref|XP_003569141.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=361

 Score =   233 bits (593),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 2/154 (1%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T+Y PKNILITGAAGFI SHVANRLVRSYP+Y ++++DK+DYCS+LKNL PSR SPNFKF
Sbjct  3    TSYEPKNILITGAAGFIGSHVANRLVRSYPHYNVLVLDKMDYCSSLKNLDPSRGSPNFKF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGN-SFEFTKNNIYGTHVLLEACKV  460
            V+GDIAS  LV  LL+  SIDT+MHFAAQTHVD+SFG+ S EFTKNN++ THVLLEACK 
Sbjct  63   VEGDIASPGLVRRLLVDNSIDTVMHFAAQTHVDSSFGDGSLEFTKNNVHCTHVLLEACKQ  122

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
              +I+RFIHVSTDEVYGE++ DAV G  E S+LL
Sbjct  123  V-KIKRFIHVSTDEVYGESEADAVAGKREDSRLL  155



>ref|XP_010531915.1| PREDICTED: LOW QUALITY PROTEIN: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=487

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 132/156 (85%), Gaps = 8/156 (5%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M  YTPK ILI GAAGFIASHVANRL+R     K V+++KLD C NL    PS+SS NFK
Sbjct  1    MVFYTPKTILIIGAAGFIASHVANRLIRIT---KTVVLEKLDSCLNLN---PSKSSSNFK  54

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHV--DNSFGNSFEFTKNNIYGTHVLLEAC  454
            FVKGDIASADLVNYLLITE IDTIMHFAAQTH   DNSFGNSF+ TK+NIYGTHVLLEAC
Sbjct  55   FVKGDIASADLVNYLLITEGIDTIMHFAAQTHATGDNSFGNSFQLTKDNIYGTHVLLEAC  114

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            K+T +IRR IHVSTDEVYG+TDEDA+VGNHEASQLL
Sbjct  115  KMTDRIRRSIHVSTDEVYGQTDEDAIVGNHEASQLL  150



>ref|XP_001701714.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
 gb|EDP06689.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
Length=328

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITG AGFIASHV  R+ ++YP YK+V++DKLDYC++LKNL    + PNF+F+K
Sbjct  15   YEPKNILITGGAGFIASHVVIRITKNYPQYKVVVLDKLDYCASLKNLGSVANLPNFRFIK  74

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G+
Sbjct  75   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEAARMHGR  134

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            IRRFI+VSTDEVYGET      G  E+S L
Sbjct  135  IRRFINVSTDEVYGETSLGKTTGLVESSHL  164



>gb|EPS62084.1| hypothetical protein M569_12709, partial [Genlisea aurea]
Length=617

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/108 (95%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +2

Query  239  LKNLLPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKN  418
            LKNL+PS++SPNFKFVKGDI SADLVNYLLITE+IDTIMHFAAQTHVDNSFGNSFEFTKN
Sbjct  1    LKNLIPSKASPNFKFVKGDIGSADLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKN  60

Query  419  NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL
Sbjct  61   NIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  108



>ref|XP_002953659.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
 gb|EFJ45283.1| hypothetical protein VOLCADRAFT_82358 [Volvox carteri f. nagariensis]
Length=366

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNILITG AGFIASHV  R+   YP YK+V++DKLDYC+++ NL      PNF+ +K
Sbjct  14   YTPKNILITGGAGFIASHVVIRIATRYPEYKVVVLDKLDYCASVNNLSCLADKPNFRLIK  73

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL++Y+L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLEA ++ G 
Sbjct  74   GDIQSMDLISYILKTEEIDTVMHFAAQTHVDNSFGNSLAFTLNNTYGTHVLLEASRMAGT  133

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            IRRFI+VSTDEVYGET      G  E+S L
Sbjct  134  IRRFINVSTDEVYGETSLGKTTGLVESSHL  163



>ref|XP_011401987.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
 gb|KFM28938.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
Length=372

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTP+NIL+TG AGFI SHV  RLV+ YP Y++V+ D LDYC+ L NL   + +PNFKF+K
Sbjct  7    YTPRNILVTGGAGFIGSHVVVRLVQRYPQYRVVVFDCLDYCATLHNLQAVKDAPNFKFIK  66

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL+ Y++ TE IDT+MHFAAQTHVD+SFGNS  FT NN+YGTHVLLEA +  GQ
Sbjct  67   GDIKSGDLLYYVMETEKIDTVMHFAAQTHVDHSFGNSVSFTINNMYGTHVLLEAARRYGQ  126

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            + RFI+VSTDEVYGET      G  E S+L
Sbjct  127  VHRFINVSTDEVYGETSFGLAAGLVEKSRL  156



>gb|AGE49559.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Can0610SP]
Length=350

 Score =   201 bits (512),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G +RRFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVRRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>gb|AGE60164.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
WI0606]
Length=350

 Score =   201 bits (512),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G +RRFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVRRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>ref|XP_003057320.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58965.1| predicted protein [Micromonas pusilla CCMP1545]
Length=691

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P+N+LITG AGFIASHVA R  + YP Y +V+VDKLDYC+NL NL    + PNFKFVK
Sbjct  23   YVPQNVLITGGAGFIASHVALRFAKRYPRYNVVVVDKLDYCANLNNLREIAALPNFKFVK  82

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG-  466
             D+ SADL+ Y++  E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  83   ADVGSADLMTYVMREEQIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKSLGD  142

Query  467  QIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            QI+RF+HVSTDEVYGE+  +    N EA+ LL
Sbjct  143  QIKRFLHVSTDEVYGESSYELDKANVEAASLL  174



>ref|YP_001427025.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
 gb|ABT16678.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
Length=350

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G ++RFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVQRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>gb|AGE59831.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
TN603.4.2]
Length=347

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPK++L+TG AGFI SHV  +LV  YP  K+V++DK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVHRYPECKVVVIDKMDYCATLNNLATVRDAPNFKFVK  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            +RRFI+VSTDEVYGE+      G  E S L
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSL  152



>ref|XP_005644844.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20300.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=361

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 113/154 (73%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            N   + PK IL+TG AGFI SHVA  L R YP YK+++ DKLDYC   KNL     +PNF
Sbjct  4    NTEYFVPKVILVTGGAGFIGSHVAVCLTRKYPQYKVIVFDKLDYCGTQKNLASLMDAPNF  63

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KF+KGD+ S DL+NY+L  E++DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC+
Sbjct  64   KFIKGDLQSGDLLNYILRRENVDTVLHFAAQTHVDNSFGNSLAFTVNNTYGTHVLLEACR  123

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            + G IRRF++VSTDEVYGE+      G  E S L
Sbjct  124  MFGGIRRFVNVSTDEVYGESSYGKDKGVGEDSTL  157



>gb|AGE57039.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-3]
Length=350

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G ++RFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVQRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>ref|XP_002181238.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47161.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=437

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = +2

Query  77   TQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLP  256
            T+  +PV    YTP+NIL+TG AGFIASHVA  L + YP YKIV+ D LDYC+ L NL  
Sbjct  69   TKPTAPVE--DYTPENILVTGGAGFIASHVAILLCKKYPQYKIVVYDCLDYCACLANLQE  126

Query  257  SRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTH  436
                PNFKFVKGDIAS DLV+Y+L  E IDTI+HFAAQTHVDNSFGNSF FT+ NIYGTH
Sbjct  127  LFDLPNFKFVKGDIASPDLVSYVLREEKIDTILHFAAQTHVDNSFGNSFAFTQTNIYGTH  186

Query  437  VLLEACKVTGQIRRFIHVSTDEVYGETDE  523
            VLLE+ K    +RRF+HVSTDEVYGE ++
Sbjct  187  VLLESAKCCDTLRRFVHVSTDEVYGEGED  215



>gb|AGE50238.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Canal-1]
Length=359

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = +2

Query  98   NMTT---YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSS  268
            NMT+   Y PK++LITG AGFIAS V  +LVR YP  K+V++DKLDYC+ L NL   R +
Sbjct  8    NMTSQNEYQPKSVLITGGAGFIASWVTIKLVRRYPECKVVVLDKLDYCATLNNLATIRDA  67

Query  269  PNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLE  448
            PNFKF+KGDI S+DL+ ++L  E +DTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE
Sbjct  68   PNFKFIKGDIQSSDLITHILQQEEVDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLE  127

Query  449  ACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
              ++ G ++RFI+VSTDEVYGE+      G  E S L
Sbjct  128  CARLHGGVQRFINVSTDEVYGESSLGKTEGLDEHSSL  164



>ref|XP_002500589.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61847.1| predicted protein [Micromonas sp. RCC299]
Length=682

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y  KN+LITG AGFIASHVA    + YP YK+V+VDKLDYC+NL NL       NFKFVK
Sbjct  12   YEAKNVLITGGAGFIASHVAILFAKKYPQYKVVVVDKLDYCANLNNLRSIAGLLNFKFVK  71

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GD+ SADL+ Y++ +E IDT+MHFAAQTHVDNSFGNSFEFT+NNI GTHVLLE  K  G 
Sbjct  72   GDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNSFGNSFEFTENNIRGTHVLLETVKTLGT  131

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RF+HVSTDEVYGE+  +    N EA+ LL
Sbjct  132  IKRFLHVSTDEVYGESSYEKDEANVEAASLL  162



>ref|XP_005648752.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24208.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
Length=363

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 122/168 (73%), Gaps = 4/168 (2%)
 Frame = +2

Query  56   RSS*SGLTQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCS  235
            R+  +GL + Q       Y PK+IL+TG AGFIASHV  RL   YPN K+V++DKLDYC+
Sbjct  11   RALSNGLEEEQG----GDYVPKSILLTGGAGFIASHVVIRLCSRYPNTKVVVLDKLDYCA  66

Query  236  NLKNLLPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTK  415
            ++ NL   +  PNFKFVKGDI SADL++++L  ++IDT+MHFAAQTHVDNSFGNS  FT 
Sbjct  67   SMHNLDAVKDLPNFKFVKGDIQSADLISFVLKEDNIDTVMHFAAQTHVDNSFGNSLAFTM  126

Query  416  NNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            NN +GTHVLLEA +V G IRRFI VSTDEVYGET      G  E S L
Sbjct  127  NNTHGTHVLLEAARVYGGIRRFIAVSTDEVYGETSVGRDSGCTETSTL  174



>gb|AGE59487.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
OR0704.3]
Length=350

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTP ++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G +RRFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVRRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>ref|XP_007508076.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20795.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITG AGFIASH A  L + YP+ KIV++DKLDYC+N+K+L       NFKF+ 
Sbjct  3    YEPKNILITGGAGFIASHAAILLAKKYPHCKIVVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI SADLV+Y+L  E+IDTIMHFAAQTHVDNSFGNSF FTKNNI GTHVLLE+CK+ G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTKNNILGTHVLLESCKMLGT  122

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RF+HVSTDEVYGE+  +    N E + LL
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLL  153



>ref|XP_011401232.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
 gb|KFM28219.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
Length=746

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y P++ILITG AGFIASHV  +LV+ YP+ K+V++DKLDYC+ L+NL   R  PNFKFVK
Sbjct  397  YVPRSILITGGAGFIASHVTIKLVKRYPHVKVVVLDKLDYCATLENLKSIRDCPNFKFVK  456

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S DL+ ++L TE IDT+MHFAAQTHVDNSFGNS  FT NN YGTHVLLE+ ++ G+
Sbjct  457  GEIQSTDLIVHILETEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYGTHVLLESARLYGK  516

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            IRRF++VSTDEVYGET      G  EAS L
Sbjct  517  IRRFLNVSTDEVYGETSLGKAEGLSEASAL  546



>gb|AGE56041.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MO0605SPH]
Length=350

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTP ++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G ++RFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVQRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>emb|CBN76510.1| conserved unknown protein [Ectocarpus siliculosus]
Length=381

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTP+NILITG AGFIASH+   LV  YP Y IV+ D+LDYC+ L+NL      PN+KFVK
Sbjct  21   YTPQNILITGGAGFIASHLVILLVEKYPQYNIVVFDRLDYCACLENLDCIAQKPNYKFVK  80

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S+D+V Y+L  E IDTI+HFAAQTHVDNSFGNSF+FT+NNIYGTHVLLE+ K  G 
Sbjct  81   GNICSSDMVTYVLREEKIDTILHFAAQTHVDNSFGNSFQFTQNNIYGTHVLLESAKKVG-  139

Query  470  IRRFIHVSTDEVYGETDED  526
            I+RF+HVSTDEVYGE + D
Sbjct  140  IKRFVHVSTDEVYGEGEHD  158



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 114/154 (74%), Gaps = 31/154 (20%)
 Frame = +2

Query  101  MTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFK  280
            M TYTPKNILIT  A FIASHVANRL+R+Y +YKIV                     NFK
Sbjct  1    MATYTPKNILITRVARFIASHVANRLIRNYLSYKIV---------------------NFK  39

Query  281  FVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV  460
            FVKGDI+SA LVNYLL+ ESIDTIMHFAAQTH          FTKNNIYGTHVLLEACKV
Sbjct  40   FVKGDISSAGLVNYLLVAESIDTIMHFAAQTH----------FTKNNIYGTHVLLEACKV  89

Query  461  TGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            TGQIRRFIHVS DEVYG+TDEDA+VGNHEA QLL
Sbjct  90   TGQIRRFIHVSIDEVYGDTDEDAIVGNHEAFQLL  123



>gb|AGE55724.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MN0810.1]
Length=353

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +2

Query  98   NMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNF  277
            + T YTP ++LITG AGFIAS V  +LV+ YP  K+V++DKLDYC+ L NL   R +PNF
Sbjct  3    SQTEYTPTSVLITGGAGFIASWVTIKLVKRYPECKVVVLDKLDYCATLNNLAAVRDAPNF  62

Query  278  KFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACK  457
            KFVKGDI SADL+ ++L  E+IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  +
Sbjct  63   KFVKGDIQSADLITHVLEQENIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECAR  122

Query  458  VTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            +   ++RFI+VSTDEVYGE+      G  E S L
Sbjct  123  LYVGVQRFINVSTDEVYGESSLGKAEGLDEHSSL  156



>gb|AGE53603.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
GM0701.1]
Length=347

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YT K++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTLKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL+ ++L  E IDTIMHFAAQTHVDNSFGNS  FT NN+YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAAQTHVDNSFGNSLAFTMNNVYGTHVLLECARLYGG  122

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            IRRFI+VSTDEVYGE+      G  E S L
Sbjct  123  IRRFINVSTDEVYGESSLGKKEGLDEHSSL  152



>ref|XP_005781167.1| hypothetical protein EMIHUDRAFT_442934 [Emiliania huxleyi CCMP1516]
 gb|EOD28738.1| hypothetical protein EMIHUDRAFT_442934 [Emiliania huxleyi CCMP1516]
Length=378

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = +2

Query  71   GLTQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNL  250
            G  +  S V++  YTP NIL+TG AGFIASHV   LV  YP YK+V +DK+DYCS+L NL
Sbjct  12   GHVRPASKVDVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNL  71

Query  251  LPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYG  430
               +  PNF+ VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ G
Sbjct  72   DQVKDKPNFRMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVLG  131

Query  431  THVLLEACKVTGQIRRFIHVSTDEVYGET  517
            THVL+EA K  G IRRFIHVSTDEVYG +
Sbjct  132  THVLVEAAKKAG-IRRFIHVSTDEVYGSS  159



>ref|XP_005757838.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
 gb|EOD05409.1| hypothetical protein EMIHUDRAFT_433184 [Emiliania huxleyi CCMP1516]
Length=378

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = +2

Query  68   SGLTQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKN  247
             G  +  S V++  YTP NIL+TG AGFIASHV   LV  YP YK+V +DK+DYCS+L N
Sbjct  11   GGHVRPASKVDVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHN  70

Query  248  LLPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIY  427
            L   +  PNF+ VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ 
Sbjct  71   LDQVKDKPNFRMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVL  130

Query  428  GTHVLLEACKVTGQIRRFIHVSTDEVYGET  517
            GTHVL+EA K  G IRRFIHVSTDEVYG +
Sbjct  131  GTHVLVEAAKKAG-IRRFIHVSTDEVYGSS  159



>gb|AGE56705.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-2]
Length=347

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PNFKFVK
Sbjct  3    YTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFVK  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  ++ G 
Sbjct  63   GDIQSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECARLYGG  122

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            +RRFI+VSTDEVYGE+      G  E S L
Sbjct  123  VRRFINVSTDEVYGESSLGKKEGLDEHSSL  152



>gb|AGE57735.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NTS-1]
Length=350

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTPK++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPKSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  
Sbjct  61   FKFVKGDIQSTDLLAHVLKQEKIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G ++RFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVQRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>gb|EWM30544.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana]
Length=423

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNIL+TG AGFI SHVA  L   YP YKIV++DKLDYC++L+NL       NFKFVK
Sbjct  18   YTPKNILVTGGAGFIGSHVAILLAHRYPKYKIVVLDKLDYCASLENLADVTRRRNFKFVK  77

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S+DLVN++L  E IDTI+H AAQTHVDNSFGNSF FT+NNI GTHVLLE+ KV G 
Sbjct  78   GNICSSDLVNFVLEEEEIDTIVHLAAQTHVDNSFGNSFSFTQNNILGTHVLLESAKVHG-  136

Query  470  IRRFIHVSTDEVYGE  514
            IRRF+HVSTDEVYGE
Sbjct  137  IRRFVHVSTDEVYGE  151



>ref|XP_005778340.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 ref|XP_005784020.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
 gb|EOD25911.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 gb|EOD31591.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
Length=378

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 1/150 (1%)
 Frame = +2

Query  68   SGLTQRQSPVNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKN  247
             G  +  S  ++  YTP NIL+TG AGFIASHV   LV  YP YK+V +DK+DYCS+L N
Sbjct  11   GGHVRPASKADVGNYTPTNILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHN  70

Query  248  LLPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIY  427
            L   +  PNFK VKG++ SADL+NY+L TE IDTI+H AAQTHVDNSFGNSF FT+NN+ 
Sbjct  71   LDQVKDKPNFKMVKGNLLSADLMNYVLETEQIDTIIHAAAQTHVDNSFGNSFAFTENNVL  130

Query  428  GTHVLLEACKVTGQIRRFIHVSTDEVYGET  517
            GTHVL+EA K  G IRRFIHVSTDEVYG +
Sbjct  131  GTHVLVEAAKKAG-IRRFIHVSTDEVYGSS  159



>ref|XP_007514013.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15450.1| predicted protein [Bathycoccus prasinos]
Length=667

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKN+LITG AGFIASHVA    + YP+ K++++DKLDYC+N+K+L       NFKF+ 
Sbjct  3    YEPKNVLITGGAGFIASHVAILFAKKYPHCKVIVLDKLDYCANVKHLSELSHLLNFKFIM  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI SADLV+Y+L  E+IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+CK  G 
Sbjct  63   GDIQSADLVSYILRNENIDTIMHFAAQTHVDNSFGNSFAFTENNILGTHVLLESCKTLGT  122

Query  470  IRRFIHVSTDEVYGETDEDAVVGNHEASQLL  562
            I+RF+HVSTDEVYGE+  +    N E + LL
Sbjct  123  IKRFLHVSTDEVYGESSYELNASNTEHASLL  153



>ref|XP_005854661.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
 gb|EKU21695.1| dTDP-glucose 4,6-dehydratase [Nannochloropsis gaditana CCMP526]
Length=358

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNIL+TG AGFIASHV   LV+ +P YKIV +D+LDYCS L+NL   +   N+KFVK
Sbjct  16   YTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYKNYKFVK  75

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+ KV   
Sbjct  76   GNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLESAKVH-N  134

Query  470  IRRFIHVSTDEVYGETDED  526
            I+RFIHVSTDEVYGE   D
Sbjct  135  IKRFIHVSTDEVYGEGAAD  153



>ref|XP_002291084.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
 gb|EED91191.1| dtdp-glucose 4,6-dehydratase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNIL+TG AGFI SHVA  L + YP+Y IV+ DKLDYCS L NL       NFKFVK
Sbjct  11   YIPKNILLTGGAGFIGSHVAILLAKKYPHYNIVVYDKLDYCSCLANLDEVSRLKNFKFVK  70

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DLV+Y+++ E IDT+MHFAAQTHVDNSFGNSF FT++NIYGTHV+LEA K    
Sbjct  71   GDITSPDLVSYVMVEEDIDTVMHFAAQTHVDNSFGNSFNFTQSNIYGTHVMLEAAKCHRG  130

Query  470  IRRFIHVSTDEVYGETD  520
            ++RFIHVSTDEVYGE +
Sbjct  131  MKRFIHVSTDEVYGEGE  147



>ref|XP_004336227.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14214.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
Length=386

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +2

Query  104  TTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKF  283
            T Y+PKNILITG AGFI SHV + LV  YP+YKIV  DKLDYCS+LKN+   +S PN++F
Sbjct  3    TEYSPKNILITGGAGFIGSHVVSLLVNKYPDYKIVNYDKLDYCSSLKNIASLQSKPNYRF  62

Query  284  VKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVT  463
            V+G+I SA+LV+++L  E IDTI+HFAAQTHVDNSFGNSF+FT+ N+ GTHVLLEA K+ 
Sbjct  63   VEGNILSAELVSFILEEEQIDTIVHFAAQTHVDNSFGNSFQFTETNVLGTHVLLEAAKLA  122

Query  464  GQIRRFIHVSTDEVYGETD  520
            G I+RFIHVSTDEV GE +
Sbjct  123  G-IKRFIHVSTDEVKGENE  140



>gb|AGE49233.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Br0604L]
Length=350

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +2

Query  95   VNMTTYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPN  274
            +N   YTP ++L+TG AGFI SHV  +LV+ YP  K+V++DK+DYC+ L NL   R +PN
Sbjct  1    MNSQEYTPTSVLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPN  60

Query  275  FKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC  454
            FKFVKGDI S DL+ ++L  E IDTIMHFAA THVDNSFGNS  FT NN YGTHVLLE  
Sbjct  61   FKFVKGDIRSPDLLAHVLKQEEIDTIMHFAATTHVDNSFGNSLAFTMNNTYGTHVLLECA  120

Query  455  KVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            ++ G +RRFI+VSTDEVYGE+      G  E S L
Sbjct  121  RLYGGVRRFINVSTDEVYGESSLGKKEGLDEHSSL  155



>gb|KDD76685.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=376

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +2

Query  107  TYTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFV  286
            +Y P+NIL+TG AGFI SHV   L+R +P Y+++++DKLDYC++L NL     +P+FKF+
Sbjct  20   SYIPRNILVTGGAGFIGSHVVRYLLRHHPTYRVIVLDKLDYCASLFNLEELEGNPSFKFI  79

Query  287  KGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTG  466
            KGDI S DL+ Y+L TE+IDTI+HFAAQTHVDNSFGNS  FT NNI GTHVLLEA +  G
Sbjct  80   KGDILSGDLLIYILATENIDTILHFAAQTHVDNSFGNSLAFTMNNICGTHVLLEAARTYG  139

Query  467  QIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
             +RR I+VSTDEVYGET      G  E+S +
Sbjct  140  LVRRLINVSTDEVYGETSVGLAQGLPESSPM  170



>gb|EWM28017.1| rhamnose biosynthetic enzyme expressed [Nannochloropsis gaditana]
Length=403

 Score =   195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            YTPKNIL+TG AGFIASHV   LV+ +P YKIV +D+LDYCS L+NL   +   N+KFVK
Sbjct  61   YTPKNILVTGGAGFIASHVVLLLVKKFPKYKIVNLDRLDYCSCLENLDEIKYYKNYKFVK  120

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S+DLVNY+L  E IDTIMHFAAQTHVDNSFGNSF FT+NNI GTHVLLE+ KV   
Sbjct  121  GNICSSDLVNYVLEEEEIDTIMHFAAQTHVDNSFGNSFSFTQNNILGTHVLLESAKVH-N  179

Query  470  IRRFIHVSTDEVYGETDED  526
            I+RFIHVSTDEVYGE   D
Sbjct  180  IKRFIHVSTDEVYGEGAAD  198



>gb|KDD73904.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=365

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 115/160 (72%), Gaps = 10/160 (6%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PK+IL+TG AGFIASHV  +LV+ YP  KIV++DKLDYC+ L NL   +   NFKFVK
Sbjct  6    YNPKSILVTGGAGFIASHVTIKLVQQYPGCKIVVLDKLDYCATLNNLTSVKDCSNFKFVK  65

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNI----------YGTHV  439
            GDI SADL+ ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN           YGTHV
Sbjct  66   GDIQSADLLVHILEQEEIDTVMHFAAQTHVDNSFGNSLAFTMNNTYVVGHVERVEYGTHV  125

Query  440  LLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            LLE+C++ G+IRRF++VSTDEVYGE+      G  E S L
Sbjct  126  LLESCRLYGRIRRFVNVSTDEVYGESSLGKEEGLQETSPL  165



>ref|XP_001422283.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 ref|XP_001422349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00600.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 5/148 (3%)
 Frame = +2

Query  125  ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVKGDIAS  304
            IL+TG AGFI SHVA RL   +P Y IVI+DKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVILDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  305  ADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  478
             DL++Y+L +E IDT+MHFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC      +IRR
Sbjct  63   FDLLSYVLQSERIDTVMHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQKTEIRR  122

Query  479  FIHVSTDEVYGETDEDAVVGNHEASQLL  562
            F+HVSTDEVYGE   D+   N E + LL
Sbjct  123  FLHVSTDEVYGENLMDS---NTEHASLL  147



>ref|XP_005845105.1| hypothetical protein CHLNCDRAFT_7301, partial [Chlorella variabilis]
 gb|EFN53003.1| hypothetical protein CHLNCDRAFT_7301 [Chlorella variabilis]
Length=327

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  131  ITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVKGDIASA-  307
            +TG AGFI SHVA RL++ Y +YK+V++DKLDYC+++ NL  ++  P FKFV+GDI    
Sbjct  1    VTGGAGFIGSHVAIRLLKRY-SYKVVVLDKLDYCASMHNLREAQDHPRFKFVRGDITGGL  59

Query  308  DLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIH  487
            DLV Y+L  E +DT++HFAAQTHVDNSFGNS  FT NN YGTHVLLEAC+V G++RRFI+
Sbjct  60   DLVQYVLREEGVDTVLHFAAQTHVDNSFGNSLAFTANNTYGTHVLLEACRVYGRVRRFIN  119

Query  488  VSTDEVYGETDEDAVVGNHEASQL  559
            VSTDEVYG+T    + G  E+S L
Sbjct  120  VSTDEVYGDTSHSLLAGLPESSSL  143



>ref|XP_001422288.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00605.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 114/148 (77%), Gaps = 5/148 (3%)
 Frame = +2

Query  125  ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVKGDIAS  304
            IL+TG AGFI SHVA RL   +P Y IV++DKLDYCS+LKNL  ++   N +FVKGD+ S
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVVLDKLDYCSSLKNLERAKECANVRFVKGDVRS  62

Query  305  ADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEAC--KVTGQIRR  478
             DL++Y+L +E IDT++HFAAQ+HVDNSFGNS+EFTKNNI GTH LLEAC    T +IRR
Sbjct  63   FDLLSYVLQSERIDTVVHFAAQSHVDNSFGNSYEFTKNNIEGTHALLEACVRAQTTEIRR  122

Query  479  FIHVSTDEVYGETDEDAVVGNHEASQLL  562
            F+HVSTDEVYGE   D+   N E + LL
Sbjct  123  FLHVSTDEVYGENLMDS---NTEHAALL  147



>ref|XP_005536953.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80917.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            + P+NIL+TG AGFIASHV  RLV  YP+Y++ ++DKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  470  IRRFIHVSTDEVYG  511
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_005535008.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005536685.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005537980.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80401.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80649.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81944.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            + P+NIL+TG AGFIASHV  RLV  YP+Y++ ++DKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  470  IRRFIHVSTDEVYG  511
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_005537192.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81156.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            + P+NIL+TG AGFIASHV  RLV  YP+Y++ ++DKLDYCS+L NL    + PNFKF++
Sbjct  36   FVPRNILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFIR  95

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            GDI S DLV Y+L  E IDT++HFAA THVDNSF +S  FT+NN+ GTHVLLE  +  G+
Sbjct  96   GDIRSHDLVLYVLQEECIDTVLHFAACTHVDNSFTSSILFTENNVLGTHVLLECARQYGK  155

Query  470  IRRFIHVSTDEVYG  511
            +RRFIHVSTDEVYG
Sbjct  156  VRRFIHVSTDEVYG  169



>ref|XP_005850348.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
 gb|EFN58246.1| hypothetical protein CHLNCDRAFT_142172 [Chlorella variabilis]
Length=377

 Score =   184 bits (468),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 112/162 (69%), Gaps = 12/162 (7%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKI------------VIVDKLDYCSNLKNLL  253
            Y PKNILITG AGFIAS V  +LV+  P  K+            +++DKLDYC+ L NL 
Sbjct  12   YQPKNILITGGAGFIASWVVIKLVKQRPECKVGSRVTLGVVGAVIVLDKLDYCATLNNLA  71

Query  254  PSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGT  433
              R  PNFKF+KGDI S+DLV ++L  E IDT+MHFAAQTHVDNSFGNS  FT NN YGT
Sbjct  72   AVRDLPNFKFIKGDIQSSDLVVHILEQEQIDTVMHFAAQTHVDNSFGNSMAFTMNNTYGT  131

Query  434  HVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQL  559
            HVLLE  ++ G+++RFI+VSTDEVYGE+      G  E S L
Sbjct  132  HVLLECSRLYGKVQRFINVSTDEVYGESSLGKTEGLKEHSPL  173



>ref|XP_004256510.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP89739.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=342

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 105/144 (73%), Gaps = 6/144 (4%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PK ILITG AGFIASHV    V  YP YKIV+VDKLDYC++LKNL   + +PNFKF  
Sbjct  3    YEPKVILITGGAGFIASHVVIHFVTQYPQYKIVVVDKLDYCASLKNLDAVKGAPNFKFFI  62

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
             DI  A  +  +   E +DT+MHFAAQTHVDNSFGNSF+FT NNI+GTHVLLE  K    
Sbjct  63   ADITDAHTMQKIFEMEKVDTVMHFAAQTHVDNSFGNSFQFTHNNIFGTHVLLEVAK-NAN  121

Query  470  IRRFIHVSTDEVYGETDEDAVVGN  541
            +RRFIHVSTDEVYG+     V+GN
Sbjct  122  VRRFIHVSTDEVYGQ-----VIGN  140



>gb|EJK47833.1| hypothetical protein THAOC_33424 [Thalassiosira oceanica]
Length=369

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 106/153 (69%), Gaps = 9/153 (6%)
 Frame = +2

Query  89   SPVNMTTYTPKNILITGAAG---------FIASHVANRLVRSYPNYKIVIVDKLDYCSNL  241
             P     Y P+NIL+TG AG         FI SH A  L + YP Y +++ DKLDYCS L
Sbjct  6    EPDEENDYIPRNILLTGGAGPLIIAETLGFIGSHAAILLAKKYPQYNVIVYDKLDYCSCL  65

Query  242  KNLLPSRSSPNFKFVKGDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNN  421
             NL       NFKFVKGDI S DLV+Y++  E +DT+MHFAAQTHVDNSFGNSF FT++N
Sbjct  66   ANLDEISRLKNFKFVKGDICSPDLVSYVMREEDVDTVMHFAAQTHVDNSFGNSFNFTQSN  125

Query  422  IYGTHVLLEACKVTGQIRRFIHVSTDEVYGETD  520
            IYGTHVLLE+ K    IRRFIHVSTDEVYGE +
Sbjct  126  IYGTHVLLESAKNHKTIRRFIHVSTDEVYGEGE  158



>emb|CBK22816.2| unnamed protein product [Blastocystis hominis]
Length=464

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  110  YTPKNILITGAAGFIASHVANRLVRSYPNYKIVIVDKLDYCSNLKNLLPSRSSPNFKFVK  289
            Y PKNILITG AGFIASHV   LV  YP YKIV +D LDYC  L NL    + PN+KFV+
Sbjct  7    YVPKNILITGGAGFIASHVVTLLVNKYPQYKIVNLDCLDYCGTLNNLKEVENKPNYKFVE  66

Query  290  GDIASADLVNYLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQ  469
            G+I S+  V Y+L +E IDT++HFAAQ+HVDNS+GNS  FT NN+ GTHV+LEAC++ G 
Sbjct  67   GNIMSSCFVRYVLKSEEIDTVIHFAAQSHVDNSYGNSLTFTYNNVVGTHVMLEACRLHG-  125

Query  470  IRRFIHVSTDEVYGETDE  523
            I+RFIHVSTDEVYGE  +
Sbjct  126  IKRFIHVSTDEVYGEQQD  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880