BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031N06

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    216   3e-62   Nicotiana tomentosiformis
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    212   5e-61   Nicotiana sylvestris
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    204   4e-58   Sesamum indicum [beniseed]
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    203   9e-58   Solanum tuberosum [potatoes]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    202   2e-57   Solanum tuberosum [potatoes]
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    201   6e-57   
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    199   2e-56   Solanum lycopersicum
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    199   4e-56   Solanum lycopersicum
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                198   7e-56   Erythranthe guttata [common monkey flower]
emb|CDP13760.1|  unnamed protein product                                194   2e-54   Coffea canephora [robusta coffee]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    192   7e-54   Populus euphratica
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                190   6e-53   Erythranthe guttata [common monkey flower]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    189   6e-53   Populus euphratica
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             186   8e-52   Populus trichocarpa [western balsam poplar]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         186   9e-52   Jatropha curcas
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...    180   9e-52   
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             185   2e-51   Citrus clementina [clementine]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    185   2e-51   Citrus sinensis [apfelsine]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   183   7e-51   Citrus sinensis [apfelsine]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    183   9e-51   Populus euphratica
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   183   1e-50   Citrus sinensis [apfelsine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   183   1e-50   Citrus sinensis [apfelsine]
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     181   1e-50   Eucalyptus grandis [rose gum]
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    182   1e-50   Medicago truncatula
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    182   2e-50   Sesamum indicum [beniseed]
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     182   2e-50   Eucalyptus grandis [rose gum]
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              182   2e-50   Medicago truncatula
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    182   3e-50   
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    182   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    182   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    181   6e-50   Cucumis melo [Oriental melon]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    180   2e-49   Glycine max [soybeans]
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    180   2e-49   Glycine soja [wild soybean]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    180   2e-49   Ricinus communis
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    179   3e-49   Prunus mume [ume]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             178   6e-49   Prunus persica
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    178   6e-49   Glycine soja [wild soybean]
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    178   6e-49   Glycine max [soybeans]
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    176   1e-48   
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    177   2e-48   
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    176   3e-48   
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    176   3e-48   
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    176   4e-48   Cucumis sativus [cucumbers]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    174   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    174   3e-47   Cicer arietinum [garbanzo]
gb|KJB62956.1|  hypothetical protein B456_009G445400                    172   3e-47   Gossypium raimondii
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    173   4e-47   Gossypium arboreum [tree cotton]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             173   4e-47   Phaseolus vulgaris [French bean]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             173   6e-47   Phaseolus vulgaris [French bean]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    172   8e-47   Cicer arietinum [garbanzo]
gb|KJB62955.1|  hypothetical protein B456_009G445400                    172   8e-47   Gossypium raimondii
gb|KJB13801.1|  hypothetical protein B456_002G094900                    172   8e-47   Gossypium raimondii
gb|KJB13800.1|  hypothetical protein B456_002G094900                    172   1e-46   Gossypium raimondii
gb|KJB13799.1|  hypothetical protein B456_002G094900                    172   1e-46   Gossypium raimondii
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    171   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    171   2e-46   
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    170   7e-46   Gossypium arboreum [tree cotton]
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    168   2e-45   
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    167   5e-45   Fragaria vesca subsp. vesca
gb|AAP40466.1|  unknown protein                                         167   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    167   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    166   1e-44   
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    166   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    166   2e-44   Phoenix dactylifera
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    166   2e-44   
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    165   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    165   3e-44   Fragaria vesca subsp. vesca
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    165   3e-44   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   164   4e-44   Citrus sinensis [apfelsine]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             164   6e-44   Capsella rubella
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    163   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    164   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    164   8e-44   Elaeis guineensis
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    163   1e-43   Cicer arietinum [garbanzo]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    164   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    163   1e-43   
emb|CDY17323.1|  BnaA10g09570D                                          163   2e-43   Brassica napus [oilseed rape]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    162   2e-43   
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    162   2e-43   Glycine soja [wild soybean]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    162   2e-43   Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    162   2e-43   Glycine max [soybeans]
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             162   3e-43   
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             162   3e-43   
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             162   3e-43   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    162   3e-43   
dbj|BAC42822.1|  GPI-anchored protein                                   158   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    162   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    162   5e-43   
ref|XP_002867546.1|  MRH5/SHV3                                          162   6e-43   
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    162   6e-43   Brassica rapa
emb|CDY45656.1|  BnaC09g31980D                                          160   7e-43   Brassica napus [oilseed rape]
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    160   8e-43   
emb|CDY46687.1|  BnaA03g48210D                                          161   8e-43   Brassica napus [oilseed rape]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    161   8e-43   Tarenaya hassleriana [spider flower]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             161   9e-43   Eutrema salsugineum [saltwater cress]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    161   1e-42   Brassica rapa
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    161   1e-42   Brassica rapa
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    160   1e-42   Medicago truncatula
emb|CDX94294.1|  BnaC01g18900D                                          160   1e-42   
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    160   2e-42   Brassica rapa
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              160   2e-42   
emb|CAN61355.1|  hypothetical protein VITISV_027762                     159   2e-42   Vitis vinifera
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             160   2e-42   
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    160   2e-42   Glycine soja [wild soybean]
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    160   2e-42   Glycine max [soybeans]
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    160   2e-42   Vitis vinifera
emb|CDX92806.1|  BnaC07g40640D                                          160   2e-42   
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...    157   2e-42   Glycine max [soybeans]
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    160   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    160   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    160   3e-42   Camelina sativa [gold-of-pleasure]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    160   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        159   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    159   5e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAL07129.1|  unknown protein                                         159   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    161   6e-42   
dbj|BAD94535.1|  Glycerophosphodiesterase-like                          155   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    159   6e-42   Camelina sativa [gold-of-pleasure]
emb|CBI18678.3|  unnamed protein product                                159   6e-42   Vitis vinifera
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    159   6e-42   Vitis vinifera
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    159   6e-42   Camelina sativa [gold-of-pleasure]
emb|CAB36515.1|  putative protein                                       159   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    159   7e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    159   9e-42   Glycine max [soybeans]
emb|CDX89312.1|  BnaA01g15810D                                          158   1e-41   
emb|CDY61647.1|  BnaCnng38120D                                          158   1e-41   Brassica napus [oilseed rape]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    157   1e-41   
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             158   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             158   2e-41   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    157   2e-41   Populus euphratica
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    159   2e-41   
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    157   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    157   2e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_007011972.1|  SHV3-like 5                                        157   2e-41   
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    157   3e-41   Phoenix dactylifera
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          157   3e-41   Amborella trichopoda
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        157   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    157   4e-41   Arabis alpina [alpine rockcress]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    157   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    156   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             156   6e-41   Capsella rubella
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     156   6e-41   Eucalyptus grandis [rose gum]
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    156   8e-41   
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    156   8e-41   Brassica rapa
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             155   8e-41   
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    157   1e-40   Brassica rapa
emb|CDY46667.1|  BnaA03g48410D                                          157   1e-40   Brassica napus [oilseed rape]
emb|CDY32720.1|  BnaA02g07820D                                          155   1e-40   Brassica napus [oilseed rape]
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    155   2e-40   
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    155   2e-40   
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             155   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             155   2e-40   Capsella rubella
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    154   3e-40   Brassica rapa
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    154   4e-40   Populus euphratica
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    154   4e-40   Elaeis guineensis
emb|CDY13237.1|  BnaC09g24190D                                          154   4e-40   Brassica napus [oilseed rape]
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    154   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    154   4e-40   Brassica rapa
emb|CDY36746.1|  BnaA03g11400D                                          154   5e-40   Brassica napus [oilseed rape]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             154   6e-40   Phaseolus vulgaris [French bean]
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    153   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    153   7e-40   Brassica rapa
emb|CDY11996.1|  BnaC03g14220D                                          153   1e-39   Brassica napus [oilseed rape]
emb|CDY14478.1|  BnaC03g21170D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    152   2e-39   Morus notabilis
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   151   3e-39   Genlisea aurea
emb|CDX92782.1|  BnaC07g40400D                                          153   3e-39   
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    152   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             152   3e-39   Eutrema salsugineum [saltwater cress]
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    151   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43885.1|  BnaC09g33580D                                          151   4e-39   Brassica napus [oilseed rape]
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    151   5e-39   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...    150   5e-39   Nicotiana sylvestris
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    151   5e-39   Brassica rapa
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             150   7e-39   Phaseolus vulgaris [French bean]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    150   7e-39   
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    150   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             150   9e-39   Phaseolus vulgaris [French bean]
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...    150   1e-38   Nicotiana sylvestris
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...    149   1e-38   Gossypium arboreum [tree cotton]
gb|AAD10252.1|  S222                                                    147   1e-38   Triticum aestivum [Canadian hard winter wheat]
gb|EAY86479.1|  hypothetical protein OsI_07859                          149   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    150   2e-38   Phoenix dactylifera
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    148   2e-38   
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    147   2e-38   Camelina sativa [gold-of-pleasure]
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    150   2e-38   Medicago truncatula
ref|NP_001047275.1|  Os02g0588500                                       149   3e-38   
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    148   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    148   4e-38   Ricinus communis
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    149   4e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    148   4e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    148   5e-38   
ref|NP_001169682.1|  hypothetical protein precursor                     148   8e-38   Zea mays [maize]
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    147   9e-38   Triticum urartu
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             147   1e-37   
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          147   1e-37   Amborella trichopoda
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...    147   2e-37   Nicotiana tomentosiformis
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             144   4e-37   
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    145   5e-37   Medicago truncatula
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    146   5e-37   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    145   5e-37   Prunus mume [ume]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    145   6e-37   Tarenaya hassleriana [spider flower]
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             145   6e-37   Prunus persica
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    145   7e-37   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    145   8e-37   Cucumis melo [Oriental melon]
emb|CDY12605.1|  BnaA02g12730D                                          144   8e-37   Brassica napus [oilseed rape]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    144   1e-36   Brassica rapa
emb|CDX86766.1|  BnaA09g21560D                                          143   1e-36   
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    144   1e-36   Zea mays [maize]
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             143   2e-36   
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    144   2e-36   Oryza brachyantha
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             144   2e-36   Capsella rubella
emb|CDY12599.1|  BnaA02g12670D                                          140   2e-36   Brassica napus [oilseed rape]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    144   3e-36   Elaeis guineensis
gb|AAF98210.1|AC007152_6  Unknown protein                               144   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    143   4e-36   Glycine soja [wild soybean]
ref|XP_002888566.1|  kinase family protein                              144   4e-36   
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   144   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    143   4e-36   Arabis alpina [alpine rockcress]
gb|KJB54927.1|  hypothetical protein B456_009G054700                    143   5e-36   Gossypium raimondii
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    142   5e-36   Phoenix dactylifera
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    142   6e-36   Pyrus x bretschneideri [bai li]
emb|CDY32730.1|  BnaA02g07920D                                          142   7e-36   Brassica napus [oilseed rape]
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...    142   8e-36   Cucumis sativus [cucumbers]
emb|CDY58867.1|  BnaC09g52640D                                          142   9e-36   Brassica napus [oilseed rape]
gb|KDP38642.1|  hypothetical protein JCGZ_03995                         142   1e-35   Jatropha curcas
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...    142   1e-35   
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    142   1e-35   Phoenix dactylifera
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    141   2e-35   Nelumbo nucifera [Indian lotus]
emb|CDP10204.1|  unnamed protein product                                141   2e-35   Coffea canephora [robusta coffee]
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    142   2e-35   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...    141   2e-35   
emb|CAH67272.1|  B0806H07.1                                             141   2e-35   Oryza sativa [red rice]
ref|NP_001053060.1|  Os04g0472300                                       141   2e-35   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    141   2e-35   Nelumbo nucifera [Indian lotus]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    140   3e-35   Triticum urartu
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          140   3e-35   Sorghum bicolor [broomcorn]
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    140   3e-35   Oryza brachyantha
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    140   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    140   4e-35   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    140   5e-35   Fragaria vesca subsp. vesca
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    140   5e-35   Elaeis guineensis
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    140   5e-35   
emb|CDY02788.1|  BnaC02g11010D                                          140   6e-35   
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    139   6e-35   Brachypodium distachyon [annual false brome]
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    139   8e-35   Phoenix dactylifera
dbj|BAJ85772.1|  predicted protein                                      139   8e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87963.1|  predicted protein                                      139   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    140   1e-34   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...    139   1e-34   Solanum tuberosum [potatoes]
emb|CDY02800.1|  BnaC02g10890D                                          139   1e-34   
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             139   1e-34   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    139   1e-34   
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    139   1e-34   Setaria italica
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...    134   2e-34   Nicotiana sylvestris
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             138   3e-34   Capsella rubella
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    136   5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    136   7e-34   Brassica rapa
emb|CDY19634.1|  BnaA05g20420D                                          136   8e-34   Brassica napus [oilseed rape]
emb|CDY29432.1|  BnaC05g32380D                                          135   8e-34   Brassica napus [oilseed rape]
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...    137   9e-34   Solanum tuberosum [potatoes]
emb|CDX82242.1|  BnaA03g35790D                                          134   9e-34   
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    136   9e-34   Arabis alpina [alpine rockcress]
emb|CDX88656.1|  BnaA03g09930D                                          136   1e-33   
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     136   1e-33   Zea mays [maize]
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                    135   1e-33   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    136   1e-33   Glycine soja [wild soybean]
emb|CDY60415.1|  BnaC02g45340D                                          137   1e-33   Brassica napus [oilseed rape]
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    136   2e-33   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    135   3e-33   Zea mays [maize]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    133   5e-33   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...    134   6e-33   Glycine soja [wild soybean]
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...    134   7e-33   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    134   9e-33   
emb|CDY36036.1|  BnaC03g41620D                                          134   1e-32   Brassica napus [oilseed rape]
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...    133   1e-32   
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    133   2e-32   
gb|ABG22015.1|  Glycerophosphoryl diester phosphodiesterase famil...    129   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    132   2e-32   
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    134   2e-32   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    134   2e-32   
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    132   2e-32   
ref|NP_001066731.1|  Os12g0456700                                       130   2e-32   
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          132   3e-32   
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...    131   3e-32   
ref|XP_003610370.1|  GPI-anchored protein                               132   3e-32   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...    132   4e-32   
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    132   4e-32   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    131   7e-32   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    131   7e-32   
dbj|BAK08209.1|  predicted protein                                      130   9e-32   
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-31   
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-31   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                129   2e-31   
gb|EEC69228.1|  hypothetical protein OsI_38235                          130   3e-31   
gb|EEE53168.1|  hypothetical protein OsJ_36008                          130   5e-31   
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    128   6e-31   
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    128   8e-31   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    128   1e-30   
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    126   1e-30   
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    127   2e-30   
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          126   4e-30   
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    126   5e-30   
gb|EPS68532.1|  hypothetical protein M569_06231                         125   6e-30   
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    126   7e-30   
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    123   7e-30   
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    125   9e-30   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g             125   9e-30   
ref|NP_001062173.1|  Os08g0503200                                       125   1e-29   
dbj|BAJ93663.1|  predicted protein                                      123   4e-29   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    123   1e-28   
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    121   2e-28   
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    121   2e-28   
gb|AAO42211.1|  unknown protein                                         121   2e-28   
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    121   3e-28   
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    120   6e-28   
ref|NP_001046128.1|  Os02g0187400                                       118   3e-27   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    118   3e-27   
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    116   3e-27   
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    117   3e-27   
gb|EEC72640.1|  hypothetical protein OsI_06154                          118   6e-27   
gb|EEE56466.1|  hypothetical protein OsJ_05675                          117   7e-27   
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          117   1e-26   
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          114   2e-26   
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    115   3e-26   
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    114   5e-26   
ref|NP_001062919.2|  Os09g0339800                                       113   1e-25   
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    112   2e-25   
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...    109   2e-25   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    112   3e-25   
gb|KHN41389.1|  Putative glycerophosphoryl diester phosphodiester...    100   2e-22   
emb|CDY11831.1|  BnaC03g12570D                                          103   3e-22   
emb|CDY72472.1|  BnaAnng41260D                                          100   5e-22   
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g          98.2    1e-20   
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...  98.2    2e-20   
ref|XP_001766682.1|  predicted protein                                97.1    6e-20   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...  92.4    3e-18   
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g           90.5    1e-17   
ref|XP_001756342.1|  predicted protein                                83.2    4e-15   
ref|XP_002453429.1|  hypothetical protein SORBIDRAFT_04g005910        80.1    5e-15   
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  72.4    1e-11   
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...  72.0    1e-11   
emb|CDY42328.1|  BnaC02g17050D                                        68.2    6e-11   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           67.4    7e-10   
ref|XP_002300352.2|  hypothetical protein POPTR_0001s371702g          63.5    3e-09   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           65.1    4e-09   
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...  62.4    1e-08   
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                 60.8    8e-08   
ref|XP_007146555.1|  hypothetical protein PHAVU_006G0504000g          55.5    6e-07   
ref|XP_001756508.1|  predicted protein                                58.2    7e-07   
gb|EEE69509.1|  hypothetical protein OsJ_28963                        56.6    2e-06   
gb|AFW58562.1|  hypothetical protein ZEAMMB73_533189                  55.1    3e-06   
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...  50.8    1e-04   



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKD +PFC+GS+N+ID TTAAQ  FSN+A ++PELK  N I + +L W +IQSL+  I
Sbjct  392  QMTKDRVPFCLGSINLIDKTTAAQSPFSNIATTVPELKITNGILTINLTWTEIQSLKPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SN +++FRLFRNP A+N+G FM+L DFLTFA NATSVSGV+I+VENAAY+A K+GLGVT 
Sbjct  452  SNRWSEFRLFRNPKARNDGNFMSLADFLTFAKNATSVSGVMISVENAAYMA-KQGLGVTG  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA       KKV+I S DSSVL +F  S YE VYG+ ++I DI++STILE
Sbjct  511  AVLDALSKAGYNNQTAKKVLIQSTDSSVLEEFKKSSYELVYGVGDDIRDIESSTILE  567



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 137/177 (77%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIPFC+GS+N+ID TTAAQ  FS++  ++PELK  N I + +L W +IQSL+  I
Sbjct  392  QMTKDGIPFCLGSINLIDKTTAAQSPFSSITTTVPELKITNGILTINLTWTEIQSLRPTI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SN ++ FRLFRNP A+N+G FM+L DFLTFA N TSVSGV+I++ENAAYLA K+GLGVT 
Sbjct  452  SNRWSVFRLFRNPKARNDGNFMSLADFLTFAKNTTSVSGVMISIENAAYLA-KQGLGVTG  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+K+       KKV+I S DSSVL +F  S YE VYG+ ++I DI++STILE
Sbjct  511  AVLDALSKSGYNNQTAKKVLIQSTDSSVLEEFKKSSYELVYGVGDDIRDIESSTILE  567



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 134/178 (75%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT DG+P C+GS+N+ D T  AQ  FSNLA   P+L  QN I +++L W  IQ+L+  I
Sbjct  395  QMTNDGVPICLGSINLRDRTDVAQSDFSNLATDNPDLNIQNGIFTYNLTWSQIQTLKPAI  454

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ + LFRNP ++N+G  M+L DFL FA NA+SVSGVLIT+ENAAYLA+K+GLGVTD
Sbjct  455  SNPYSNYSLFRNPRSRNDGNLMSLADFLAFANNASSVSGVLITIENAAYLAQKQGLGVTD  514

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AV+ AL+KA      TKKVMI S+DS+VL+KF ++S YE VY +  ++ DI NSTILE
Sbjct  515  AVVDALSKAGYNNQTTKKVMIRSSDSAVLLKFKSSSNYELVYLVDNDVRDILNSTILE  572



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 134/177 (76%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIPFC+GS+N+ID TT  Q  F+N+A ++PEL   N I +F+L W +I SL+ +I
Sbjct  391  QMTKDGIPFCLGSINLIDKTTVFQSLFTNIASTVPELNITNGIVTFNLTWDEINSLKPEI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NP+ +FRL+RNP A+NEG F++L DFLT+A NAT+VSGV+I++ENAAYLA  +G GVTD
Sbjct  451  TNPWLEFRLYRNPKARNEGNFVSLVDFLTYAKNATTVSGVMISIENAAYLA-NQGFGVTD  509

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AV  AL  A       KKVMI S DSSVL +F  ++YE VY + ++ISDI++STI E
Sbjct  510  AVREALRNAGYNNQTVKKVMIQSKDSSVLKEFKKTRYELVYRVADDISDIESSTISE  566



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIPFC+GS+N+ID TTAAQ  FS++A ++PEL+  + I + +LNW DIQ+L+  I
Sbjct  392  QMTKDGIPFCLGSINLIDTTTAAQSPFSDIATTVPELQITDGILTINLNWSDIQTLKPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S  ++ + L RNP A+N+G FM+L DFLTF+ NA +VSGVLI++ENAAYLA K+GLGVTD
Sbjct  452  STRYSDYSLSRNPKARNDGNFMSLADFLTFSKNA-NVSGVLISIENAAYLA-KQGLGVTD  509

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AV  AL+ A       KKVMI SNDSSVL +F  S YE VY + E+ISDI+NST+LE
Sbjct  510  AVSDALSTAGYNNQTAKKVMIQSNDSSVLEEFKKSSYELVYLVDEDISDIKNSTLLE  566



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 133/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM KDGIPFC+GS+N+ID TT AQ  F N+  ++PEL   N I +F+L W +I+SL+  I
Sbjct  380  QMAKDGIPFCLGSINLIDKTTVAQSPFDNIGSAVPELNITNGIFTFNLTWDEIKSLKPAI  439

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+++FRL+RNP A+N+G F++L DFLT+A NAT+VSGV+I +ENAAYLA K G GVT 
Sbjct  440  SNPWSEFRLYRNPKARNDGNFVSLVDFLTYAKNATTVSGVMIGIENAAYLA-KHGFGVTA  498

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+ A   +   KKVMI S DSSVL +F  S+YE VY + ++ISDI+ STI E
Sbjct  499  AVLKALSSAAYNNQSAKKVMIQSTDSSVLKEFKKSQYELVYRVADDISDIKISTISE  555



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 134/177 (76%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM KDGIPFC+GS+N+ID TT  +  F N+A ++PEL   N I +F+L W +I+SL+ +I
Sbjct  389  QMAKDGIPFCLGSINLIDKTTVFRSPFINIASTVPELNITNGIFTFNLTWDEIKSLKPEI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NP+ +FRL+RNP A+NEG F++L +FLT+A NAT+VSGV+I++ENAAYLA  +G GVTD
Sbjct  449  TNPWLEFRLYRNPKARNEGNFVSLMEFLTYAKNATTVSGVMISIENAAYLA-NQGFGVTD  507

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL  A       KKVMI S DSSVL +F  ++YE VY + ++ISDI++STI E
Sbjct  508  AVLEALRNAGYNNQTAKKVMIQSKDSSVLKEFKKNRYELVYRVADDISDIESSTISE  564



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 134/177 (76%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIPFC+ S+N+ID TTAAQ  FS++A + PEL+  + I + +LNW DIQ+L+  I
Sbjct  392  QMTKDGIPFCLSSINLIDTTTAAQSPFSDIATTAPELQITDGILTINLNWSDIQTLKPVI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S  ++ FRL RNP A+N GKFM+L DFLTF+  A +VSG++I++ENAAYLA K+GLGVTD
Sbjct  452  STRYSDFRLSRNPKARNVGKFMSLADFLTFSKTA-NVSGIMISIENAAYLA-KQGLGVTD  509

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+ A       +KVMI SNDSSVL +F  S YE VY + + ISDI+NSTILE
Sbjct  510  AVLDALSTAGYNNQTARKVMIQSNDSSVLEEFKKSSYELVYLVDDNISDIKNSTILE  566



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q+T DGIPFC+GS+N++D + A +  FSN+A + P+L  ++ I +++L W  IQ+L+  I
Sbjct  396  QITNDGIPFCLGSINLMDKSNAVESIFSNMATTNPDLNIRDGIFAYNLTWSQIQTLKPAI  455

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ + LFRNP A+N+GKFM L +FL F  N++SV GVLI++ENAAYLAEK+GLGVTD
Sbjct  456  SNPYSNYSLFRNPRARNDGKFMQLTNFLAFGNNSSSVKGVLISIENAAYLAEKQGLGVTD  515

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTILE  521
            AVL AL K+   +  +KK+MI S+DS+VL KF +S  YE VY + E+ISDI NSTI+E
Sbjct  516  AVLNALRKSGHNNQTSKKIMIKSSDSAVLEKFKSSGNYELVYLVGEDISDILNSTIVE  573



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DG+PFCMGS+N+I+ TTAAQ  F +   +IP+L  Q+ I +F+L W  IQ+L+  +
Sbjct  390  QMSQDGVPFCMGSINLIERTTAAQSAFRSFTKTIPDLNIQDGIFAFNLTWSQIQTLKPSM  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP   + LFRNP A+N+G F+ L DFL  A+NATSVSGVLI +E+AAYLA+ +GL V D
Sbjct  450  YNPNTIYALFRNPKAQNDGNFVQLSDFLAIASNATSVSGVLIGIEHAAYLAQNQGLDVVD  509

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL  LNK+    KKV+I SNDSSVL+     SKYE VY I E ISDI NSTILE
Sbjct  510  AVLTTLNKSSYN-KKVLIESNDSSVLVNIGKKSKYELVYSINETISDITNSTILE  563



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+GS+N+ D TT AQ  +SN A  IP++K  N I +F L W +IQSL   I
Sbjct  391  QISKDGIPFCLGSINLYDSTTVAQSSYSNRAQDIPQIKAGNGIFTFSLTWSEIQSLTPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF+K+ L RNP  +N GKF+TL DFL  A N +S+SGVLI++ENAAYL +K+GL VTD
Sbjct  451  SNPFSKYELSRNPKFRNSGKFLTLSDFLALAKNTSSLSGVLISIENAAYLIQKEGLLVTD  510

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTI  515
             VL  L+KA   D  +KKVMI S +SSVLMKF + K YE VY I+E+I D Q++ +
Sbjct  511  KVLDILSKAGYDDPTSKKVMIESTNSSVLMKFRDKKSYELVYRIEEDIQDTQDAAL  566



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 130/178 (73%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++ DG+PFC+GS+N+ + T AAQ  FSNLA++ P+L  ++ I +++L W  IQ+L   I
Sbjct  395  QISNDGVPFCLGSINLRERTNAAQSDFSNLAITNPDLNIEDGIFAYNLTWTQIQTLIPAI  454

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ F LFRNP  +N G  M L DFL FA  A SVSGVLI++ENAAYLA+K+GLGVTD
Sbjct  455  SNPYSNFSLFRNPKNRNSGTLMQLSDFLAFANTAPSVSGVLISIENAAYLAQKQGLGVTD  514

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+ A      TKK+MI S++S+VL KF + + Y+ VY I E+I DI NSTIL+
Sbjct  515  AVLEALSTAGYNNQTTKKIMIKSSESAVLTKFKSTTNYDLVYLIDEDIRDILNSTILQ  572



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+GS+N+ D TT AQ  +SN A  IP++K  N I +F L W +IQSL   I
Sbjct  391  QISKDGIPFCLGSINLYDSTTVAQSSYSNRAQDIPQIKAGNGIFTFSLTWSEIQSLTPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF+KF L RNP  +N GKF+TL +FL  A + +S+SGVLI++ENAAYL +K+GL VTD
Sbjct  451  SNPFSKFELSRNPKFRNSGKFLTLSEFLALAKSTSSLSGVLISIENAAYLIQKEGLLVTD  510

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTI  515
             VL  L+KA   D  +KKVMI S +SSVLMKF + K YE VY I+E+I D Q++ +
Sbjct  511  KVLDILSKAGYDDPTSKKVMIESTNSSVLMKFRDKKSYELVYRIEEDIQDTQDAAL  566



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+GS+N+ D TT AQ  +SN   +IP++K  + I +F L W +IQ+L   I
Sbjct  391  QISKDGIPFCLGSINLYDSTTVAQSIYSNREQNIPQIKAGSGIFTFSLTWSEIQNLTPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++K+ L RNP  KN GKF+TL DFL  A N +S+SGVLI++ENAAYL EK+GL +TD
Sbjct  451  SNPYSKYELLRNPKFKNLGKFLTLSDFLALAKNTSSLSGVLISIENAAYLIEKEGLPITD  510

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L+ A   D  +KKVMI S +SSVLMKF + S YE VY I+E+I D Q++ +
Sbjct  511  KVLEVLSLAGYDDPTSKKVMIESTNSSVLMKFRDESNYELVYRIEEDIQDAQDAAL  566



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 125/178 (70%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+GS+N+ID TT AQ  +SNLA  IPE+K  + I++F L W  IQ L   I
Sbjct  394  QMSKDGIPFCLGSINLIDSTTVAQSNYSNLAQIIPEIKKGSGIYTFSLTWNQIQKLTPII  453

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+AK+ L RNP  KN G F+TL DFL  A NA+S+SGVLI++ENA YL EK+ L VTD
Sbjct  454  SNPYAKYELLRNPKFKNVGNFLTLSDFLDMAKNASSLSGVLISIENAPYLIEKQQLPVTD  513

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA    +   +VM+ S +SSVLMKF   S+Y  VY + E+I D  +S I +
Sbjct  514  AVLDALSKAGYDKQVALEVMVQSTNSSVLMKFKGKSRYNLVYKVDEDIRDALDSAITD  571



>ref|XP_008345038.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Malus domestica]
Length=339

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  S+N+ID TT AQ  FS+L   +PE+K  + I++F L WKDI+ L   I
Sbjct  61   QISKDGIPFCASSINLIDSTTVAQSPFSDLTXVVPEIKAGSGIYTFSLTWKDIEGLTPTI  120

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++K+ L RNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  121  SNPWSKYTLXRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIGIEYAAYLAEKQKLSITD  180

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA    +    V I S +SSVLMKF   + YE VY I+EEI D  +STI
Sbjct  181  AVMNTLSKAGFDNQTALDVKIQSTNSSVLMKFKEKTSYELVYKIEEEIGDAPSSTI  236



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IP++   + I SF LNW +IQ+L  QI
Sbjct  397  QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPDIMAGSGIFSFSLNWDEIQTLIPQI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  457  SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  516

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI
Sbjct  517  SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTI  572



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IP++   + I SF LNW +IQ+L  QI
Sbjct  397  QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPDIMAGSGIFSFSLNWDEIQTLIPQI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  457  SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  516

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI
Sbjct  517  SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTI  572



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IPE+   + I SF L W +IQ+L  QI
Sbjct  444  QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPEIMAGSGIFSFSLIWDEIQTLIPQI  503

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  504  SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  563

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI
Sbjct  564  SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTI  619



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+GS+N+ D TT AQ  +SN + +IP +K  N I +F L W +IQ+L   I
Sbjct  391  QISKDGIPFCLGSINLYDSTTVAQSSYSNHSQNIPHIKAGNGIFTFSLTWSEIQNLNPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF+KF L RNP  +N GKF+TL +FL  A + +S+SGVLI++ENA YL +K+GL VTD
Sbjct  451  SNPFSKFELSRNPKFRNSGKFLTLSEFLALAKSTSSLSGVLISIENADYLIQKEGLPVTD  510

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L+KA   D  +KKVMI S +SSVLMKF + + YE VY I+E+I D Q++ +
Sbjct  511  KVLDVLSKAGYDDPTSKKVMIESTNSSVLMKFRDKNNYELVYRIEEDIQDAQDAAL  566



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IPE+   + I SF L W +IQ+L  QI
Sbjct  444  QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPEIMAGSGIFSFSLIWDEIQTLIPQI  503

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  504  SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  563

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI
Sbjct  564  SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTI  619



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC+  +N+I+ T AAQ +F+++  +IPE+   + I SF L W +IQ+L  QI
Sbjct  444  QMSKDGVPFCLSFINLINSTNAAQSKFNSITTTIPEIMAGSGIFSFSLIWDEIQTLIPQI  503

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+ KF+LFRNP  KN GKFM L DFL  A NA S+SGVLI++ENA YLAEK+G+ VT+
Sbjct  504  SNPYFKFKLFRNPKNKNAGKFMKLSDFLEMAKNANSLSGVLISIENAVYLAEKQGMSVTN  563

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +V+ AL  A    +   KVMI S DSSVLMK    + YE VY +KE I D  N TI
Sbjct  564  SVMEALGNAGYNKQTALKVMIQSTDSSVLMKLREKTSYELVYKVKENIRDALNQTI  619



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  278  QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  337

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            ++P+++F++FRNP  KN GKF++L +FL    N +SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  338  ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKN-SSVSGVLIGIENAAYLAEKQSLSVTD  396

Query  360  AVLLALNKADL--KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+
Sbjct  397  AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLD  453



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDG PFC+ S+++++ TT AQ  FS+LA+S+PE+K+   I SF+L W DI+ L   I
Sbjct  391  QLSKDGTPFCLKSIDLLESTTVAQTSFSDLAMSVPEIKSGRGIFSFNLTWSDIKGLTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              PF+K+ LFRNP AKN G F+TL DFL+   N TS+SGVLI VENAAYLAEK+GL VTD
Sbjct  451  LAPFSKYTLFRNPKAKNAGTFLTLSDFLSLTKNQTSLSGVLIIVENAAYLAEKQGLSVTD  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNS  509
             V+ AL+ A      ++KV I S +SSVL+KF   +KYE VY I E + D  N+
Sbjct  511  VVIKALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTKYELVYQIDESVGDATNA  564



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (72%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT DGIPFC+GS+++ + T   +  F+NL+ +  +L   + I +++L W  IQ+L+  I
Sbjct  392  QMTNDGIPFCLGSIDLKEKTNTGESIFTNLSTTNSDLNIIDGILAYNLTWSQIQTLKPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ + +FRNP AK+ G  M L DFL FA NA+S+SGVLI++ENAAYLAEK+GLGV D
Sbjct  452  SNPYSIYSMFRNPAAKHVGNLMQLSDFLAFAHNASSISGVLISIENAAYLAEKQGLGVAD  511

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA       K++MI S+DS+VL KF + S YE VY I E ISDI N+TILE
Sbjct  512  AVLDALSKAGYNNQTAKRIMITSSDSAVLSKFKSTSNYELVYLIDEIISDILNTTILE  569



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  278  QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  337

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            ++P+++F++FRNP  KN GKF++L +FL    N +SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  338  ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKN-SSVSGVLIGIENAAYLAEKQSLSVTD  396

Query  360  AVLLALNKADL--KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+
Sbjct  397  AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLD  453



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDG PFC+ S+++++ TT AQ  FS+LA+S+PE+K+   I SF+L W DI+ L   I
Sbjct  391  QLSKDGTPFCLKSIDLLESTTVAQTSFSDLAMSVPEIKSGRGIFSFNLTWSDIKGLTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              PF+K+ LFRNP AKN G F+TL DFL+   N TS+SGVLI VENAAYLAEK+GL VTD
Sbjct  451  LAPFSKYTLFRNPKAKNAGTFLTLSDFLSLTKNQTSLSGVLIIVENAAYLAEKQGLSVTD  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNS  509
             V+ AL+ A      ++KV I S +SSVL+KF   +KYE VY I E + D  N+
Sbjct  511  VVIKALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTKYELVYQIDESVGDATNA  564



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S N+ID +  A  +F NL  + PE+++   I SF LNW DIQ+L   I
Sbjct  384  QMSKDGIPFCLSSANLIDSSNVATTKFRNLMTTAPEIQSGTGIFSFSLNWSDIQTLTPAI  443

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            ++P+++F++FRNP  KN GKF++L +FL    N +SVSGVLI +ENAAYLAEK+ L VTD
Sbjct  444  ASPYSQFKIFRNPANKNAGKFLSLSEFLVLVKN-SSVSGVLIGIENAAYLAEKQSLSVTD  502

Query  360  AVLLALNKADL--KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            AVL AL+KA    +T+KVMI S +SSVLM    N+ Y+ VY + E I D  N T+L+
Sbjct  503  AVLAALSKAGFSNQTEKVMIKSTNSSVLMNIKENANYKLVYEVDENIRDANNDTVLD  559



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 125/176 (71%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  S+N+ID TT AQ  F++L   +PE+K  + I++F L WKDI+ L   I
Sbjct  389  QISKDGIPFCASSINLIDSTTVAQSPFNSLTAFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++KF LFRNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  449  SNPWSKFTLFRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIDIEYAAYLAEKQKLSITD  508

Query  360  AVLLALNKADLKTKK---VMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA   ++    V I S +SSVLMKF   + YE VY I+EEI D  +STI
Sbjct  509  AVMNTLSKAGFDSQTALDVKIQSANSSVLMKFKEKTSYELVYKIEEEIGDAPSSTI  564



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 125/176 (71%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  S+N+ID TT AQ  F++L   +PE+K  + I++F L WKDI+ L   I
Sbjct  389  QISKDGIPFCASSINLIDSTTVAQSPFNSLTAFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++KF LFRNP++K  GK++TL DFL  A  ++S+SGVLI +E AAYLAEK+ L +TD
Sbjct  449  SNPWSKFTLFRNPMSKTGGKYLTLSDFLALAKRSSSLSGVLIDIEYAAYLAEKQKLSITD  508

Query  360  AVLLALNKADLKTKK---VMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA   ++    V I S +SSVLMKF   + YE VY I+EEI D  +STI
Sbjct  509  AVMNTLSKAGFDSQTALDVKIQSANSSVLMKFKEKTSYELVYKIEEEIGDAPSSTI  564



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q+TKDGIPFCM S+N+ID TT +Q  F N + +IPE+   +AI +FDL W++IQSL   I
Sbjct  394  QITKDGIPFCMSSINLIDSTTISQSPFINRSKNIPEISPNDAIFAFDLTWEEIQSLSPSI  453

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             +P++ K+ LFRNP  +N+G F TL DFL  A NA ++SGVLI +ENAAYLA+ +GL VT
Sbjct  454  LSPYSSKYALFRNPRFRNKGNFTTLPDFLAMAKNAGTLSGVLIQIENAAYLAKDQGLSVT  513

Query  357  DAVLLALNKADLKTK---KVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  515
            DAVL +L+KA    +   KV+I S DS+VLMKF   N  YE VY +   ISD+ N+T+
Sbjct  514  DAVLSSLSKAGYDNQTAVKVLIQSPDSAVLMKFKQENKNYELVYKVDPPISDVLNTTV  571



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+   I +F+L W DI+SL   I
Sbjct  391  QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGIGIFAFNLTWNDIKSLTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451  LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E I D  N+ +
Sbjct  511  AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETIGDAANAAV  566



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+   I +F+L W DI+SL   I
Sbjct  391  QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGIGIFAFNLTWNDIKSLTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451  LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E I D  N+ +
Sbjct  511  AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETIGDAANAAV  566



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ ++N+ID T  AQ  + +LA +IPEL+  + I++F+L W  IQ+L   I
Sbjct  402  QMSKDGIPFCLSTINLIDSTKVAQTNYGSLAANIPELEKGSGIYTFNLTWSQIQTLTPAI  461

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NP+A ++LFRNP  +N GKF+TL DFL  A N +S+SGVLI++E+AAYL EK+ L VTD
Sbjct  462  ANPYAIYKLFRNPKFRNAGKFLTLSDFLALAKNTSSLSGVLISIEHAAYLIEKQQLPVTD  521

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTI  515
            AVL AL+KA  + +    VMI S +S+VLMKF + K Y+ VY + E I D  ++TI
Sbjct  522  AVLGALSKAGYENQTAIDVMIQSTNSAVLMKFKDKKNYKLVYKVDENIRDALDATI  577



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  ++N+ID TT AQ  FSNL   IPE+K  + I++F L W++I+SL   I
Sbjct  391  QISKDGIPFCSSNINLIDSTTVAQSSFSNLTTVIPEIKAGSGIYTFSLTWENIKSLTPII  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ + LFR+P  KN GK++TL DFLT A  ++S+SGVLI +E+A YLAE++GL VTD
Sbjct  451  SNPWSSYTLFRSPRNKNAGKYLTLSDFLTLAQKSSSLSGVLIGIEHAPYLAEEQGLSVTD  510

Query  360  AVLLALNKADLKTKK---VMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL KA    +    V I S +SSVLMKF   + YE VY I+E+I D  +STI
Sbjct  511  TVIAALRKAGFDNRTAPDVKIQSTNSSVLMKFKEKTNYELVYKIEEDIGDALSSTI  566



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 124/176 (70%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q+++DGIPFC  S+N+ID TT AQ +FSNL   IP++K  + I++F L W+DI+SL   I
Sbjct  392  QISRDGIPFCSSSINLIDSTTVAQSRFSNLTTVIPKIKAGSGIYTFSLTWEDIKSLTPII  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP++ + L+R+P  KN GK++TL DFLT A  ++S+SGVLI +E+A YLAE++GL VTD
Sbjct  452  SNPWSTYTLYRSPRTKNAGKYLTLSDFLTLAQKSSSLSGVLIGIEHATYLAEEQGLSVTD  511

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL KA L       V I S +SSVLMKF   + Y RVY I+E I D  +S+I
Sbjct  512  KVIAALRKAGLDNWTAPDVKIQSTNSSVLMKFKEKTNYGRVYKIEENIGDALSSSI  567



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  391  QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGSGIFAFNLTWNDIKILTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451  LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+ +
Sbjct  511  AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANAAV  566



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+ TT AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  391  QMSKDGTPFCLNSIDLIESTTVAQSSFSKFAMTIPEIKSGSGIFAFNLTWNDIKILTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK+RLFRNP +KN G  + L DFL+   N TS+SGV I VENAAYLA+K+GL V D
Sbjct  451  LNPFAKYRLFRNPRSKNAGTLLALSDFLSLTKNQTSLSGVAIIVENAAYLADKQGLSVID  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+ +
Sbjct  511  AVIGALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANAAV  566



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  315  QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  374

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE +G GVTD
Sbjct  375  SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAE-QGFGVTD  433

Query  360  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I
Sbjct  434  AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASI  489



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  S+N+ID TT AQ  FSNL   +PE+K  + I++F L WKDI+ L   I
Sbjct  389  QISKDGIPFCASSINLIDSTTVAQSXFSNLTTVVPEIKAGSGIYTFSLAWKDIEGLTXTI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP +K+ LFRNP  K  GK++TL DFL  A  ++S+SGVLI +E AAYLAE++ L VTD
Sbjct  449  SNPSSKYALFRNPRFKTGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQRLSVTD  508

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA    K    V I S +SSVLMKF   + YE VY I+E I D  +STI
Sbjct  509  AVMNTLSKAGFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTI  564



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  397  QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE +G GVTD
Sbjct  457  SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAE-QGFGVTD  515

Query  360  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I
Sbjct  516  AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASI  571



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 129/176 (73%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDG P C+GS+N+ID T  AQ  FSNL+ +IPE+   + I +FD++W+DI SL   I
Sbjct  397  QMTKDGTPICLGSINLIDSTDVAQSSFSNLSKTIPEIMQGSGIFTFDMSWRDILSLTTAI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  KN GKF+TL +FL  A +A+S+ GVLI +ENAAYLAE +G GVTD
Sbjct  457  SSPQSEYKLFRNPKFKNVGKFLTLSEFLAMAKSASSLQGVLIAIENAAYLAE-QGFGVTD  515

Query  360  AVLLALNKA--DLKT-KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV  AL++A  D +T +KVMI S++SSVLMKF   S Y+ VY + E+I   Q ++I
Sbjct  516  AVFDALSEAGYDKQTAQKVMIQSSNSSVLMKFKGKSNYKLVYKVDEDIGGAQQASI  571



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 125/178 (70%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFCM S+N+ID TT +Q  F N + +IPE+   + + +FDL W++I+SL   I
Sbjct  395  QISKDGIPFCMSSINLIDSTTISQSPFINRSTNIPEISPNDGVFAFDLTWEEIKSLTPSI  454

Query  180  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ AK+ LFRNP  +N G+F TL DFL  A NA+++SGVLI +ENAAYLA K G  VT
Sbjct  455  LNPYSAKYTLFRNPRFRNSGEFRTLPDFLALAKNASTLSGVLIQIENAAYLA-KHGFSVT  513

Query  357  DAVLLALNKADLKTK---KVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  515
            DAVL +L++A    +   KV+I S DS+VL+KF   N  YE VY + E ISD+ N+T+
Sbjct  514  DAVLSSLSEAGYDNQTAVKVLIQSPDSAVLIKFKQENKNYELVYKVDEPISDVLNTTV  571



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 119/176 (68%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC  S+N+ID TT AQ  FSNL   +PE+K  + I++F L WKDI+ L   I
Sbjct  389  QISKDGIPFCASSINLIDSTTVAQSGFSNLTTFVPEIKAGSGIYTFSLAWKDIEGLTPTI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP + + LFRNP  K  GK++TL DFL  A  ++S+SGVLI +E AAYLAE++ L VTD
Sbjct  449  SNPSSNYALFRNPRFKTGGKYLTLSDFLALAKKSSSLSGVLIGIEYAAYLAEEQRLSVTD  508

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA    K    V I S +SSVLMKF   + YE VY I+E I D  +ST+
Sbjct  509  AVMNTLSKAGFDNKTALNVKIQSTNSSVLMKFKEKTSYELVYKIEENIGDTLSSTV  564



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 121/177 (68%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S ++ + TTA +  FS  A+SIPE+K  N I +F+L W DI+ L   I
Sbjct  389  QMSKDGIPFCLSSADLGESTTAVKSSFSRYAMSIPEIKPGNGIFTFNLTWTDIKGLTPSI  448

Query  180  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NPF AK+ L R+P  KN G F+TL DFL    N TS+SGVLI VENAAYLAEK+GL VT
Sbjct  449  VNPFFAKYSLVRDPKYKNAGTFVTLSDFLLLTKNQTSLSGVLIIVENAAYLAEKQGLSVT  508

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            DAV+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D+ ++ +
Sbjct  509  DAVIDALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDVADAAV  565



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT DG P C+ S+N+ID TT AQ QFSNL  +IP++   + I SF+L+W +I++L   I
Sbjct  241  QMTMDGTPICLSSINLIDSTTVAQSQFSNLTTTIPQIMPGSGIFSFNLSWSEIKTLTPII  300

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  KN G F+TL +FLT A+NA+S+ GVLI++ENA +L E +G  VT+
Sbjct  301  SSPQSQYKLFRNPRFKNAGTFLTLSEFLTIASNASSLQGVLISIENAPFLLE-QGFAVTN  359

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI
Sbjct  360  AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTI  415



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIP C+GS+N+I+ T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397  QMTKDGIPICLGSINLIESTDIVRTGFSNLTTTVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  +N GK++ L +FL  A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457  SSPQSQYKLFRNPKFQNAGKYLQLSEFLRMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI
Sbjct  516  AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTI  571



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 120/170 (71%), Gaps = 5/170 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+GT  A+  FS   ++IPE+KT + I +F+L W +I++L   I
Sbjct  388  QMSKDGTPFCLNSIDLIEGTAVAKSNFSKFGMTIPEIKTGSGIFAFNLTWNEIKTLTPSI  447

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPFAK++LFRNP +KN G  ++L DFL+   N TS+SG+ I VENAAYLAEK+GL V D
Sbjct  448  SNPFAKYKLFRNPKSKNSGNLVSLSDFLSLTKNQTSLSGISIIVENAAYLAEKQGLSVID  507

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISD  497
            AV+ AL+ A      ++KV I S +SSVL+KF   + YE VY I E + D
Sbjct  508  AVINALSNAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDEIVGD  557



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++I+ T  AQ  FS  A++IPE+KT + I +F+L W DI+ L   I
Sbjct  393  QMSKDGTPFCLNSIDLIESTAVAQSNFSKFAMTIPEIKTGSGIFAFNLTWNDIKDLTPSI  452

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK+RLFRNP +KN G+  +L  FL+   N TS+SG+ I+VENAAYLAEK+GL V D
Sbjct  453  LNPFAKYRLFRNPKSKNSGRLTSLSHFLSLTKNQTSLSGISISVENAAYLAEKQGLSVID  512

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ AL+ A      ++KV I S +SSVL+KF   + YE VY I E + D  ++ +
Sbjct  513  AVINALSSAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDEIVGDAASAAV  568



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+ S+++ + T  AQ  FS  A++IPE+K+ + I +F+L W DI+ L   I
Sbjct  398  QISKDGIPFCLSSIDLFESTNVAQSSFSGYAMTIPEIKSSSGIFTFNLTWADIKGLTPSI  457

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+ K+ LFRNP  K  G F+TL DFL+   N TS+SGVLI VENAAYLAE +G  VTD
Sbjct  458  INPYTKYTLFRNPKYKKAGTFVTLSDFLSLTKNHTSLSGVLIIVENAAYLAENQGFSVTD  517

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL KA      ++KV I S +SSVL+KF   + YE VY I E +SD  N+ +
Sbjct  518  KVIDALRKAGYDKPGSQKVYIQSTNSSVLLKFKEKTNYELVYKIDETVSDAANAAV  573



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 126/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT DG P C+ S+N+ID TT AQ QFSNL  +IP++   + I SF+L+W +I++L   I
Sbjct  397  QMTMDGTPICLSSINLIDSTTVAQSQFSNLTTTIPQIMPGSGIFSFNLSWSEIKTLTPII  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  KN G F+TL +FLT A+NA+S+ GVLI++ENA +L E +G  VT+
Sbjct  457  SSPQSQYKLFRNPRFKNAGTFLTLSEFLTIASNASSLQGVLISIENAPFLLE-QGFAVTN  515

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI
Sbjct  516  AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTI  571



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397  QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457  SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI
Sbjct  516  AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTI  571



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397  QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457  SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI
Sbjct  516  AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTI  571



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIP C+GS+N+I  T   +  FSNL  ++PE+   + I +++L+W DI+SL+  I
Sbjct  397  QMTKDGIPICLGSINLIQSTDIVRTGFSNLTETVPEIMQSSGIFTYNLSWSDIKSLKPVI  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P ++++LFRNP  +N GK++ L +FL+ A   +S++GVLI++ENAAYLA K+G GVTD
Sbjct  457  SSPQSQYKLFRNPKFQNAGKYLKLSEFLSMANTTSSLNGVLISIENAAYLA-KQGFGVTD  515

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL ALN+A      T+KVMI S+ SSVLMKF   + Y+ VY I E+I   Q+STI
Sbjct  516  AVLKALNEAGYDKQTTQKVMIQSSSSSVLMKFKGKTNYQLVYKIDEDIGGAQSSTI  571



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDGIP C+GS++++ GTT AQ QF++ + +IPE++    I +F L WK+IQSL+  I
Sbjct  387  QMTKDGIPICLGSIDLLYGTTVAQSQFNSRSSNIPEIQETPGIFTFSLTWKEIQSLKPAI  446

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPF  + LFRNP  KN G F++LDDFL F A + S+SGVLI++ENAAY+ E  GL V D
Sbjct  447  RNPFMDYNLFRNPAYKNAGSFLSLDDFLAF-AKSKSLSGVLISIENAAYIVENLGLSVID  505

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV+ AL K+   +   +K+MI S +SSVL+KF   + Y+ VY I E I D   ++I++
Sbjct  506  AVVDALKKSGHNNQTNQKIMIQSTNSSVLIKFKEKTNYQLVYKIDEVIRDADKASIMD  563



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDGIPFC+ S++  + TT AQ  FS   +SIPE+K+ + I +F+L W DI+ L   I
Sbjct  399  QISKDGIPFCLSSIDHYESTTVAQSSFSGYDMSIPEIKSCSGIFTFNLTWDDIKGLTPSI  458

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+++++LFRNP  KN G F+TL DFL+   N TS+SGVLI VENAAYLA+ +G  VTD
Sbjct  459  FNPYSEYKLFRNPKYKNAGTFVTLSDFLSLTKNHTSLSGVLIIVENAAYLAKNQGFSVTD  518

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL KA      ++KV I S +SSVL+KF   + YE VY I E +SD  N+ +
Sbjct  519  KVIDALRKAGYDKPGSQKVYIQSTNSSVLLKFKEKTNYELVYKIYETVSDAANAAV  574



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 127/176 (72%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT DG P C+ S+N+ID TT AQ +F+NL  +IP++ + + I +F+L+W  I++L   I
Sbjct  412  QMTMDGTPICLSSINLIDSTTVAQSEFNNLTTTIPQIMSGSGIFTFNLSWSGIKTLTPII  471

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            ++P ++++LFRNP  KN GKF+TL +FLT A+NA+S+ GVLI++ENA +L E +G  +TD
Sbjct  472  ASPQSQYKLFRNPRFKNAGKFLTLSEFLTMASNASSLQGVLISIENAPFLLE-QGFAITD  530

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL AL+KA    K   KVMI S+ SSVLMKF + + Y+ VY + E+I   Q+STI
Sbjct  531  AVLDALSKAGYGNKTDQKVMIQSSSSSVLMKFKSQTNYDLVYKVDEDIGGAQSSTI  586



>ref|XP_009385529.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=622

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA + F   A  +PE++ +N I SFDL W +IQSL+ +++
Sbjct  258  QMSKDGVVFCLDSADLMGHTTAIKTFMPRATVVPEIQKENGIFSFDLTWSEIQSLKPELT  317

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
             P ++  L RNP AKN+GKFMTL DFL FA  +T V+GVLI +ENA YL  KKGLG+ +A
Sbjct  318  TPLSQSGLARNPAAKNQGKFMTLTDFLEFAKKST-VAGVLINIENAGYLVSKKGLGIVEA  376

Query  363  VLLALNKAD---LKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A    L  K+V+I S+D++VL  F  NS Y+RV  +KE ISD    T+ E
Sbjct  377  VSTALTNASYDKLPKKQVLIQSDDTAVLSAFKKNSGYKRVLYVKETISDAPKPTVDE  433



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC  S+N+ID TT AQ  F+N  + +PE+K  + I++F L W  I+ L   I
Sbjct  390  QMSKDGIPFCSSSINLIDSTTVAQSPFNNYTMVVPEIKVGSGIYTFSLTWDQIKKLTPTI  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            S+P   F L+RNP  K+ G ++ L +FLT A N++S+SGV+I +E AAYL EKKGL VTD
Sbjct  450  SSPQKDFTLYRNPRFKSAGTYLKLSEFLTLAKNSSSLSGVIIGIEYAAYLIEKKGLSVTD  509

Query  360  AVLLALNKADLKTKK---VMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  LNKA    +    VMI S +SSVLMKF   +KY+ VY I+E+I    + T+
Sbjct  510  AVITELNKAGFGNQTALDVMIQSTNSSVLMKFKEKTKYKLVYEIEEDIGGAPDKTV  565



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  402  QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  461

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  462  SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  521

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I
Sbjct  522  AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAI  578



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  402  QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  461

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  462  SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  521

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I
Sbjct  522  AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAI  578



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + + S+PE++  N I SFDL W +I+SL+  ++
Sbjct  408  QMSKDGVAFCLDSADLMGDTTAVDSFMSRSASVPEIQKNNGIFSFDLTWSEIESLKPLLA  467

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NP +   L RNP AKN+GKFMTL  FL FA N+T VSG+LI++ENA YLA KKGL + +A
Sbjct  468  NPLSSANLVRNPAAKNQGKFMTLAKFLDFAKNST-VSGILISIENAPYLASKKGLDIVNA  526

Query  363  VLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD   S + E
Sbjct  527  VSSALINAIYDKQTTQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDASKSAVDE  583



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC+ S+++ +   A Q  FSN + S+PE+ +   I +F L W +IQSL   I
Sbjct  424  QMSSDGVPFCLRSIDLRNSIAALQNTFSNRSTSVPEISSVPGIFTFSLTWPEIQSLTPAI  483

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  +R+FRNP  KN GK ++L  FL  A   TS+SGVLI+VENAAYL EK+GL V  
Sbjct  484  SNPFRVYRIFRNPREKNSGKLISLSQFLDLAKTYTSLSGVLISVENAAYLREKQGLDVVQ  543

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       T KVMI S +SSVL+ F   SKYE VY I+E I +I++S I
Sbjct  544  AVLDTLTEAGYSNGTTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETIGNIRDSAI  600



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + + S+PE++  N I SFDL W +I+SL+  ++
Sbjct  408  QMSKDGVAFCLDSADLMGDTTAVDSFMSRSASVPEIQKNNGIFSFDLTWSEIESLKPLLA  467

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NP +   L RNP AKN+GKFMTL  FL FA N+T VSG+LI++ENA YLA KKGL + +A
Sbjct  468  NPLSSANLVRNPAAKNQGKFMTLAKFLDFAKNST-VSGILISIENAPYLASKKGLDIVNA  526

Query  363  VLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD   S + E
Sbjct  527  VSSALINAIYDKQTTQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDASKSAVDE  583



>ref|XP_006474608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Citrus sinensis]
Length=789

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 7/170 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S ++I  TTAA  F + A S+PE++ +  I SFDL W +IQSL+ QIS
Sbjct  424  QMSKDGVAFCLESPDLIGKTTAATVFMSKATSVPEIQKERGIFSFDLTWTEIQSLKPQIS  483

Query  183  NPFAKFR--LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +PF K    + RNP AKN+GKF+TLD FL F A   +VSGVLI + NAAYLA KKGLGV 
Sbjct  484  SPFDKSNPPIIRNPEAKNKGKFVTLDGFLEF-AKTKAVSGVLININNAAYLASKKGLGVV  542

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEIS  494
            DAV  AL+ A      T++VMI S+DSSVL KF +   Y++V  I++E+S
Sbjct  543  DAVTKALSNATFDKQSTQQVMIQSDDSSVLSKFQDVPAYKKVLHIRKEVS  592



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT+DGIP C GS+N+ID T  AQ +F+    +IP++++   I +F+L W++I+ L+  I
Sbjct  391  QMTQDGIPICSGSINLIDTTNVAQSKFNTRTTNIPQIQSTPGIFTFNLTWEEIKKLKPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  + LFRNPV KN+G+F +LDDF+ FA   +    VLI++E+AAYL E  G  V D
Sbjct  451  SNPFLDYGLFRNPVHKNDGQFFSLDDFMAFAKGNS--LPVLISIEHAAYLVENLGFNVID  508

Query  360  AVLLALNKADL--KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV++ALNK+    + +KVMI S +SSVLMKF   + Y+ VY + E ISDI +S I
Sbjct  509  AVVVALNKSGYNNENQKVMIQSTNSSVLMKFMEKTNYKLVYSVDEFISDIDDSAI  563



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC  S+++ D TT AQ  F N  + +PE + +  I++F L W  I++LQ  I
Sbjct  386  QMSKDGIPFCSSSISLNDITTVAQSSFQNFTMVVPEFQAEGRIYTFSLTWDQIKTLQPSI  445

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP   ++L+RNP  +  G ++ L DFL  A N +SVSGVLI++E AAYLAEK+GL VTD
Sbjct  446  SNPQEYYKLYRNPRFRRAGTYVKLSDFLNMAKNRSSVSGVLISIEYAAYLAEKQGLSVTD  505

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  LNKA L  +    +MI S +SSVLMKF   SK + VY I+E I D  ++T+
Sbjct  506  AVITELNKAGLDNQTGLDIMIQSTNSSVLMKFKEKSKCKLVYKIEEVIRDALHTTL  561



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 119/178 (67%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+N+ D T   Q  F N + ++PE+ +   I+SF L W +IQ+L+  I
Sbjct  392  QMSSDGIPFCLSSINLGDSTNVVQSPFRNRSTAVPEIGSLPGIYSFSLAWSEIQTLRPAI  451

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+++ F LFRNP  K+ GKF+TL DFL  A N++S++GVLI+VENA YL EK+GL   
Sbjct  452  ENPYSREFTLFRNPREKSSGKFVTLSDFLNLAKNSSSLAGVLISVENATYLREKQGLDAV  511

Query  357  DAVLLALNKADLKTK----KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +A    K    +VMI S +SSVL++F   S+YE VY ++E I DI +S I
Sbjct  512  KAVLDTLTEAGYSNKTTTTRVMIQSTNSSVLVEFKKQSRYETVYKVEEVIRDILDSAI  569



>gb|KDO59429.1| hypothetical protein CISIN_1g005894mg [Citrus sinensis]
Length=671

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 119/170 (70%), Gaps = 7/170 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+K+G+ FC+ S ++I  TTAA  F + A S+PE++ +  I SFDL W +IQSL+ QIS
Sbjct  306  QMSKEGVAFCLESPDLIGKTTAATVFMSKATSVPEIQKERGIFSFDLTWTEIQSLKPQIS  365

Query  183  NPFAKFR--LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +PF K    + RNP AKN+GKF+TLD FL F A   +VSGVLI + NAAYLA KKGLGV 
Sbjct  366  SPFDKSNPPIIRNPEAKNKGKFVTLDGFLEF-AKTKAVSGVLININNAAYLASKKGLGVV  424

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEIS  494
            DAV  AL+ A      T++VMI S+DSSVL KF +   Y++V  I++E+S
Sbjct  425  DAVTKALSNATFDKQSTQQVMIQSDDSSVLSKFQDVPAYKKVLHIRKEVS  474



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  389  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  448

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL F + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  449  NPFTATGFLRNPANKNGGKFTTLADFLEF-SKAKAVTGVLINIENAAYLASKKGLGVVDA  507

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ E
Sbjct  508  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSLEE  564



>ref|XP_010483369.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Camelina sativa]
Length=542

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  179  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIE  238

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  239  NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDA  297

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I E
Sbjct  298  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSIEE  354



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 111/177 (63%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  451  NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F T   Y RV  I +EI D    +I E
Sbjct  510  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFETVPPYTRVLSIDKEIGDAPKPSIEE  566



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  406  QMSKDGVAFCLDSADLVGDTTAMDSFMSRSALVPEIQKNNGIFSFDLTWSEIESLKPLLA  465

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF+   L RNP AKN+GKFMTL  FL FA  +T VSG+LI++ENA YLA KKGL + +A
Sbjct  466  NPFSSTNLVRNPAAKNQGKFMTLAKFLDFAKTST-VSGILISIENAPYLASKKGLDIVNA  524

Query  363  VLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T+KV+I S+D+SVL  F N S Y+RV+ + E ISD   S + E
Sbjct  525  VSSALINASYDKQTTQKVLIQSDDTSVLSTFKNSSSYKRVFKVGETISDASKSAVDE  581



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 116/176 (66%), Gaps = 9/176 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++   TT A  +F N   +IPE+K  + I++F L W +I++L   I
Sbjct  387  QMSKDGIPFCLSSIDLSMSTTVANTKFRNHTATIPEIKNGSGIYTFSLTWNEIKTLTPSI  446

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              P+ K+ LFRNP  KN+G F+TL +FL+ A      SG+LI++ENAAYLAEK+GL VT+
Sbjct  447  LKPYEKYLLFRNPKFKNQGNFVTLSEFLSLAKG----SGILISIENAAYLAEKRGLSVTN  502

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL  L KA     K+ KVMI S  SSVL  F N SKYERVY + E I D  +  +
Sbjct  503  AVLNTLKKAGYDKPKSPKVMIQSTHSSVLKIFKNKSKYERVYKVDENIHDADDKAV  558



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 118/176 (67%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC+ S ++ + T  A+  FSN +  +PE+     I++F L W +IQSL   I
Sbjct  401  QMSMDGVPFCLSSFDIGNSTMVARSSFSNRSSIVPEISPVAGIYTFSLTWAEIQSLAPAI  460

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NPF ++ +FRNP  KN GK ++L DFL  A N++S++GVL++VENAAYL EK+GL V  
Sbjct  461  ANPFREYNMFRNPREKNSGKLISLSDFLNLARNSSSLTGVLLSVENAAYLREKQGLDVVK  520

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       KKVMI S +SSVL++F   S+YE VY I+E I DI +S +
Sbjct  521  AVLDTLGEAGFSNRTAKKVMIQSTNSSVLIEFKQKSRYETVYKIEEAIRDILDSAV  576



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 6/176 (3%)
 Frame = +3

Query  6    MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            M+ DG PFC  S+++ + TT A   F N + ++PE+ +   I++F L W +IQ+L   IS
Sbjct  394  MSSDGTPFCSSSIDLGNSTTVALSPFRNRSTTVPEISSVGGIYTFSLTWPEIQTLTPAIS  453

Query  183  NPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NP+++ F LFRNP  KN GK ++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454  NPYSRGFSLFRNPKEKNAGKLLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I
Sbjct  514  AVLDTLTQTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAI  569



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 119/179 (66%), Gaps = 8/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ SV++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  402  QMSLDGIPFCLNSVDLGESTNIVQSPFRNRSSTVPEIAPLGGLYSFSLTWSEIQTLRPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +NP+ + F LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENAAYL EK+GL V 
Sbjct  462  TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKNSTSLAGVLISVENAAYLREKQGLDVV  521

Query  357  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  522  KAVLDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAI  580



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++ + TT A  Q  N A +IPE+K ++ I++F L W +I++L   I
Sbjct  392  QMSKDGIPFCLSSIDLSESTTVADTQLKNRATTIPEIKYRSGIYTFSLTWDEIKTLTPSI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+ K+ L RNP +KN GK +TL DFL+     T  S +LI++ENAAYLAEK+ L VTD
Sbjct  452  LNPYEKYILSRNPKSKNLGKLITLSDFLSL----TEGSRILISIENAAYLAEKQNLRVTD  507

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I    +S I
Sbjct  508  AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIGGAADSAI  560



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 117/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++ + TT A  Q  N A +IPE+K ++ I++F L W +I++L   I
Sbjct  379  QMSKDGIPFCLSSIDLSESTTVADTQLKNRATTIPEIKYRSGIYTFSLTWDEIKTLTPSI  438

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+ K+ L RNP +KN GK +TL DFL+     T  S +LI++ENAAYLAEK+ L VTD
Sbjct  439  LNPYEKYILSRNPKSKNLGKLITLSDFLSL----TEGSRILISIENAAYLAEKQNLRVTD  494

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I    +S I
Sbjct  495  AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIGGAADSAI  547



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++++ TT A  QF N A +I E+K ++ I++F L W +I++L   I
Sbjct  392  QMSKDGIPFCLSSIDLLESTTVADTQFKNRATTILEIKFRSGIYTFSLTWDEIKTLTPSI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+ K+ L RNP +KN GK +TL DFL+        S +LI++ENAAYLAEK+ L VTD
Sbjct  452  LNPYEKYILSRNPKSKNLGKLITLSDFLSLNEG----SHILISIENAAYLAEKQNLHVTD  507

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I D  +S I
Sbjct  508  AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIRDAADSAI  560



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++++ TT A  QF N A +I E+K ++ I++F L W +I++L   I
Sbjct  392  QMSKDGIPFCLSSIDLLESTTVADTQFKNRATTILEIKFRSGIYTFSLTWDEIKTLTPSI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+ K+ L RNP +KN GK +TL DFL+        S +LI++ENAAYLAEK+ L VTD
Sbjct  452  LNPYEKYILSRNPKSKNLGKLITLSDFLSLNEG----SHILISIENAAYLAEKQNLHVTD  507

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL AL KA  ++ KVMI S  SSVL  F + SK+ERVY + E I D  +S I
Sbjct  508  AVLDALQKAKPRSHKVMIQSTHSSVLKIFKDKSKFERVYKVDENIRDAADSAI  560



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  405  QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  464

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  465  SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  524

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I
Sbjct  525  AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAI  581



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  382  QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  441

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  442  SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  501

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I
Sbjct  502  AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAI  558



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++ D T   Q  FS  + ++PE+     I++F+L W +IQ+L   I
Sbjct  405  QMSSDGIPFCSSSIDLKDTTMVVQTPFSKRSTTVPEISPNGGIYTFNLTWPEIQNLTPAI  464

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N GK M+L  FL  A N+T++SGVLI+V+NAAYL EK+GL V  
Sbjct  465  SNPYKVYDMVRNPEKRNAGKLMSLSQFLGLAKNSTTLSGVLISVDNAAYLREKQGLDVVK  524

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL  L ++       T KVMI S +SSVL+ F N SKYE VY I+E I DI +S I
Sbjct  525  AVLETLTESGYSNGTTTTKVMIQSTNSSVLVDFKNQSKYETVYRIEETIRDISDSAI  581



>ref|XP_009396661.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=744

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTAA  F   A  +PE++  N I SFDL W +IQSL+  ++
Sbjct  385  QMSKDGVAFCLDSADLMGDTTAAAAFMPRAAMVPEIQQNNGIFSFDLTWSEIQSLKPALT  444

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P ++  L RNP AK+EGKFMTL DFL FA  +T VSG+LI +ENAAYLA KKGLG  DA
Sbjct  445  SPMSQSGLARNPAAKSEGKFMTLADFLQFAKKST-VSGILINIENAAYLASKKGLGAVDA  503

Query  363  VLLALNKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A    K+V I S+D++VL  F  NS Y+RV  +KE ISD    T+ E
Sbjct  504  VSTALRNASYD-KQVYIQSDDTAVLSAFKKNSGYQRVLHVKETISDAPKPTVEE  556



>dbj|BAC42822.1| GPI-anchored protein [Arabidopsis thaliana]
Length=359

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 111/176 (63%), Gaps = 5/176 (3%)
 Frame = +3

Query  6    MTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQISN  185
            M+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI N
Sbjct  1    MSKDGIAFCHDAADLTASTTAMTIFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIEN  60

Query  186  PFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDAV  365
            PF      RNP  KN GKF+TL DFL F + A +V+GV+I +ENAAYLA KKG+GV DAV
Sbjct  61   PFTATGFQRNPANKNAGKFITLADFLDF-SKAKAVTGVMINIENAAYLASKKGIGVVDAV  119

Query  366  LLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
              AL K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ E
Sbjct  120  KSALAKSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDE  175



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +3

Query  6    MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            M+ DG PFC  S+++ + TT A   F N + ++PE+ +   I++F L W +IQ+L   IS
Sbjct  394  MSSDGTPFCSSSIDLGNSTTVALSPFRNRSTTVPEISSLGGIYTFSLTWPEIQTLTPVIS  453

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NP+   F  FRNP  KN GKF++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454  NPYRGAFSFFRNPKMKNAGKFLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I
Sbjct  514  AVLDTLTETGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAI  569



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC  S+N+ID T   Q  FSNL  S+P++K+   I +F L W  IQ L+  I
Sbjct  378  QMSKDGKPFCFSSINLIDSTDVVQSDFSNLTTSVPQIKSDTGIFTFSLTWDQIQQLKPVI  437

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            ++P++ + L+RNP   N GKF+TL  FL    +  S+SG+LI++++AAYLAE++GL VTD
Sbjct  438  ASPYSAYTLYRNPRNINVGKFITLSAFLDLTKSTKSLSGILISIDHAAYLAEEQGLSVTD  497

Query  360  AVLLALNKADLKT---KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AVL AL+KA   T    KV+I S++S+VL KF   + YE VY I E+I  I   T+
Sbjct  498  AVLDALSKAGFDTLTAPKVLIQSSNSAVLQKFKEKNNYELVYKIDEKIRSIDEPTL  553



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG P C+GS+++ + TT A   F N + ++PEL +   I++F L W +IQ+L   I
Sbjct  393  QMSSDGTPICLGSIDLGNSTTVALTAFRNRSTTVPELGSVGGIYTFSLTWPEIQTLTPAI  452

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+   RLFRNP  KN GK  +L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  453  SNPYGVSRLFRNPNQKNAGKLFSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  512

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L           KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  513  AVLDTLTHTGYSNNTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAI  568



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 119/179 (66%), Gaps = 8/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ SV++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  402  QMSLDGIPFCLNSVDLGESTNIVQSPFRNRSATVPEIAPLGGLYSFSLTWSEIQTLRPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +NP+ + F LFRNP  ++ GK ++L DFL  A ++TS++GVLI+VENAAYL EK+GL V 
Sbjct  462  TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKSSTSLAGVLISVENAAYLREKQGLDVV  521

Query  357  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  522  KAVLDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAI  580



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   160 bits (406),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S ++ + T   Q  F N + ++PE+     ++SF L W +IQ+L+  I
Sbjct  287  QMSLDGIPFCLNSADLGESTNIVQSPFRNRSSTVPEIAPLGGLYSFSLTWSEIQTLRPAI  346

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +NP+ + F LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENAAYL EK+GL V 
Sbjct  347  TNPYNRDFNLFRNPKERSSGKLVSLSDFLNLAKNSTSLAGVLISVENAAYLREKQGLDVV  406

Query  357  DAVLLALNKADLK-----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A+L  L KA        TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  407  KAILDTLTKAGYSNATTTTKKVMIQSTNSSVLVDFKKQSRYETVYQVEETIRDILDSAI  465



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  267  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIE  326

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL   + A +V+GVLI +ENAAYLA KKGLGV D 
Sbjct  327  NPFTSTGFLRNPANKNAGKFTTLVDFLEI-SKAKAVTGVLINIENAAYLASKKGLGVVDV  385

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I E
Sbjct  386  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSIEE  442



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++   T  AQ    N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  350  QMSSDGTPFCSSSIDLGKTTMVAQTPLRNRSTNVPEISSLGGIYTFSLTWPEIQTLTPAI  409

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  +N GK ++L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  410  SNPYRTYNMFRNPNERNAGKLVSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  469

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  470  AVLDTLTETGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAI  525



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 117/171 (68%), Gaps = 5/171 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ D +PFC+ S+++ + +  A+  FSN + ++PE+    AI++F L W +IQ+L   I
Sbjct  391  QMSMDSVPFCLSSIDLGNSSMIARSPFSNRSSTVPEISPVPAIYTFSLTWPEIQTLTPAI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NPF  + +FRNP  KN GK ++L DFL+ A N++S++GVL++VENAAYL EK+GL V  
Sbjct  451  ANPFTIYNMFRNPSEKNAGKLISLSDFLSLAKNSSSLTGVLLSVENAAYLREKQGLDVVK  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDI  500
            AVL  L +A      TKKVMI S +SSVL+ F   S+YE VY I+E I DI
Sbjct  511  AVLDTLGEAGFNNRTTKKVMIQSTNSSVLIDFKQKSQYETVYKIEETIRDI  561



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   161 bits (408),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC+ S+++ + T A Q  F N + ++PEL T + ++SF L W +IQ+L   I
Sbjct  401  QMSSDGVPFCLSSIDLGESTNAFQSPFRNRSATVPELDTLSKLYSFSLAWSEIQTLTPAI  460

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +NP+ K + LFRNP  ++ GK ++L DFL  A N+TS++GVLI+VENA+YL EK+GL V 
Sbjct  461  TNPYNKDYNLFRNPRERSSGKLVSLSDFLNLAKNSTSLAGVLISVENASYLREKQGLDVI  520

Query  357  DAVLLAL------NKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L      N     TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  521  KAVLDTLTESGYGNAKTTTTKKVMIQSTNSSVLVDFKKQSRYETVYKVEETIRDILDSAI  580



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++   T  AQ    N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  392  QMSSDGTPFCSSSIDLGKTTMVAQTPLRNRSTNVPEISSLGGIYTFSLTWPEIQTLTPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  +N GK ++L DFL  A N+TS+SGVLI+VENAAYL E +GL V  
Sbjct  452  SNPYRTYNMFRNPNERNAGKLVSLSDFLNLAKNSTSLSGVLISVENAAYLRENQGLDVVK  511

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  512  AVLDTLTETGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAI  567



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 117/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   +TA   F + A S+PE++  N + SFDL W +IQSL+ QI 
Sbjct  391  QMSKDGIAFCHDSADLTVSSTAMATFMSRATSVPEIQPTNGVFSFDLTWAEIQSLKPQIQ  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF AK  + RNP  KN GKF+TLDDFL F+    +V+GVL+ ++NAAYLA KKGLG+ D
Sbjct  451  SPFIAKVGISRNPANKNAGKFVTLDDFLKFSKE-KAVTGVLVNIQNAAYLASKKGLGIVD  509

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL K+ L    T++V+I S+DSSVL  F     Y RV  I +EI D   +++ E
Sbjct  510  AVKSALTKSTLDKQTTQRVLIQSDDSSVLAGFEAVPPYTRVLSIDKEIGDAPKASVDE  567



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 9/176 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDG+PFC+ S+++   TT A  +F N    IPE++  + I++F L W +I++L   I
Sbjct  391  QLSKDGVPFCLSSIDLSTSTTVADTKFRNRTAIIPEIQNGSGIYTFSLTWNEIKTLTPSI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              P+AK+ LFRNP  KN+GKF+TL DFL+ A      S VLI++ENAAYLA K+GL VT 
Sbjct  451  LKPYAKYTLFRNPKFKNQGKFVTLSDFLSLAKG----SRVLISIENAAYLASKRGLSVTK  506

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +VL AL KA     K++K+MI S  SSVL  F + SKYERVY + E I D  +  I
Sbjct  507  SVLNALQKAGYDKQKSRKIMIQSTHSSVLKIFKDKSKYERVYKVDENIHDADDKAI  562



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393  QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+++ F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL EK+GL V 
Sbjct  453  SNPYSRRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREKQGLDVV  512

Query  357  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  513  KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAI  569



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (68%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393  QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+++ F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL EK+GL V 
Sbjct  453  SNPYSRRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREKQGLDVV  512

Query  357  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  513  KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAI  569



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 9/176 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KDG+PFC+ S+++   TT A  +F N    IPE++  + I++F L W +I++L   I
Sbjct  414  QLSKDGVPFCLSSIDLSTSTTVADTKFRNRTAIIPEIQNGSGIYTFSLTWNEIKTLTPSI  473

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              P+AK+ LFRNP  KN+GKF+TL DFL+ A      S VLI++ENAAYLA K+GL VT 
Sbjct  474  LKPYAKYTLFRNPKFKNQGKFVTLSDFLSLAKG----SRVLISIENAAYLASKRGLSVTK  529

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            +VL AL KA     K++K+MI S  SSVL  F + SKYERVY + E I D  +  I
Sbjct  530  SVLNALQKAGYDKQKSRKIMIQSTHSSVLKIFKDKSKYERVYKVDENIHDADDKAI  585



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDG P C+ S+N++D T  AQ  FS    +I EL+  + I +F+L W+DI+SL   I
Sbjct  391  QMTKDGTPICLSSINLMDSTKVAQTPFSTFTTTITELQKGSGIFTFNLTWEDIRSLTPAI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVS-GVLITVENAAYLAEKKGLGVT  356
            SNP++ FRL RNP AK  GK ++L DFL+ A  A S+S GVLI +E+AA+L  K GL VT
Sbjct  451  SNPYSTFRLSRNPAAKTAGKLVSLSDFLSIAKEANSLSGGVLIGIEHAAFLV-KVGLSVT  509

Query  357  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK--YERVYGIKEEISDIQNSTI  515
            DAVL AL+KA   ++ T +VMI S +SSVL +F   K  YE VY + E I D  ++TI
Sbjct  510  DAVLDALSKAGYDNVTTPRVMIQSTNSSVLKEFKEKKKNYELVYRVDENIRDASDATI  567



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 121/178 (68%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++  + I SFDL+W DIQ+LQ Q++
Sbjct  372  QMSKDGVAFCLDSVDVTRDTTAAATFMSLSTTIPEIQQSSGIFSFDLSWSDIQALQPQLT  431

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF  K  L RNP  KN+GKF+TL +FL   A   +V+G+LI +ENAAYLA +KGL +  
Sbjct  432  SPFENKGGLPRNPANKNKGKFLTLAEFLEL-AKVKAVTGILINIENAAYLASQKGLDIVS  490

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL+ A      T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + E
Sbjct  491  AVNTALSNATFDKQSTQKVLIQSDDTSVLSKFQNVPAYTRVLYLKDEISDAPKTPVGE  548



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 116/178 (65%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+K GIPFC+ S+++I+ T  AQ  FS L   IPE+K+ N I +FDL W DI++L   +
Sbjct  397  QMSKGGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSM  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP++   L+RNP    +G F+TL DFL      TS+ GV+IT+ENAAYLA K+ L VT+
Sbjct  457  LNPYSINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTE  516

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E + D  +S IL+
Sbjct  517  AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIVGDAVDSAILD  574



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 116/178 (65%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+K GIPFC+ S+++I+ T  AQ  FS L   IPE+K+ N I +FDL W DI++L   +
Sbjct  397  QMSKGGIPFCLSSIDLIESTNVAQSNFSKLGKIIPEIKSGNGIFTFDLAWDDIKTLTPSM  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP++   L+RNP    +G F+TL DFL      TS+ GV+IT+ENAAYLA K+ L VT+
Sbjct  457  LNPYSINSLYRNPKYNKKGHFLTLSDFLNLPKGQTSLLGVVITIENAAYLARKQNLSVTE  516

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E + D  +S IL+
Sbjct  517  AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIVGDAVDSAILD  574



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 119/178 (67%), Gaps = 8/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMTKDG P C+ S+N++D T  AQ  FS    +I EL+  + I +F+L W+DI+SL   I
Sbjct  391  QMTKDGTPICLSSINLMDSTKVAQTPFSTFTTTITELQKGSGIFTFNLTWEDIRSLTPAI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVS-GVLITVENAAYLAEKKGLGVT  356
            SNP++ FRL RNP AK  GK ++L DFL+ A  A S+S GVLI +E+AA+L  K GL VT
Sbjct  451  SNPYSTFRLSRNPAAKTAGKLVSLSDFLSIAKEANSLSGGVLIGIEHAAFLV-KVGLSVT  509

Query  357  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKFTNSK--YERVYGIKEEISDIQNSTI  515
            DAVL AL+KA   ++ T +VMI S +SSVL +F   K  YE VY + E I D  ++TI
Sbjct  510  DAVLDALSKAGYDNVTTPRVMIQSTNSSVLKEFKEKKKNYELVYRVDENIRDASDATI  567



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 116/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ    N + ++PEL +   I++F L W +IQ+L   I
Sbjct  350  QMSSDGTPFCSSSIDLGNTTMVAQTPLRNRSTNVPELSSLGGIYTFSLTWPEIQTLTPAI  409

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  +N GK ++L +FL  A N+TS+SGVLI+VENAAYL E +G+ V  
Sbjct  410  SNPYRTYNMFRNPNERNAGKLVSLTEFLNLAKNSTSLSGVLISVENAAYLRENQGIDVVK  469

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +    ++ TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  470  AVLDTLTQTGYTNITTKKVMIQSTNSSVLLDFKKQSRYETVYKVEETIRDILDSAI  525



>ref|XP_006603452.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=425

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 116/176 (66%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PF + S+++I+ TT AQ  FS  +++IPE+K+ + I +F+L W DI +L   I
Sbjct  64   QMSKDGTPFFLNSIDLIESTTVAQSSFSKFSMTIPEIKSSSGIFAFNLTWNDINNLTPSI  123

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NPFAK RLFRN + KN G  +TL  FL+   N TS+S V I VENA YL +K+GL V D
Sbjct  124  LNPFAKCRLFRN-LPKNAGALLTLSYFLSLTKNQTSLSDVAIIVENATYLVDKQGLSVID  182

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL+KA      ++KV I S +SSVL+KF   + YE VY I E + D  N+T+
Sbjct  183  VVISALSKAGYDKPGSQKVYIQSTNSSVLLKFKEKTSYELVYKIDETVGDAANATV  238



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = +3

Query  6    MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            M+ DG PFC  S+++ + TT A   F N +  +PE+ +   I++F L W +IQ+L   IS
Sbjct  394  MSSDGTPFCSSSIDLGNSTTVALTPFRNRSTIVPEISSLGGIYTFSLTWPEIQTLTPAIS  453

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NP+   F  FRNP  KN GKF++L DFL  A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  454  NPYRGAFSFFRNPKMKNAGKFLSLSDFLNLAKNSTSLSGVLISVENAAYLREEQGLDVVK  513

Query  360  AVLLAL---NKADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L     ++  TKKVMI S +SSVL+ F   S+YE VY I+E I DI +S I
Sbjct  514  AVLDTLTMTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKIEENIRDILDSAI  569



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 119/178 (67%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+++ + T   Q  F N + ++PELK+   I+SF L W +IQ+L+  I
Sbjct  402  QMSSDGIPFCLSSIDLGESTNVVQSPFRNRSATVPELKSLAGIYSFSLAWSEIQTLRPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  462  ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDAV  521

Query  357  DAVLLALNKADLKTK----KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A+L +L +A    K    +VMI S +SSVL+ F   S+YE VY ++E ISDI +S I
Sbjct  522  KAILDSLTEAGYSNKTTTTRVMIQSTNSSVLVDFKKQSRYETVYKVEEAISDILDSAI  579



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG  FC+ + ++ D T  AQ QFSNL+ ++PE+ +   I++F L W +IQ+L   I
Sbjct  401  QMSSDGKCFCLSTADLKDSTLVAQSQFSNLSTTVPEISSDVGIYTFSLTWPEIQNLTPAI  460

Query  180  SNPFAKF-RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNPF +   +FRNP  +N GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  461  SNPFRESSNMFRNPNERNSGKLISLSEFLELAKKSTSLSGVLIRVENAAYLREKQGLDVV  520

Query  357  DAVLLALNKADL----KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             AVL  L +A       T KVMI S +SSVL+ F N SKYE VY I+E I DI++S I
Sbjct  521  KAVLDTLTEAGYTNGNTTTKVMIQSTNSSVLVDFKNKSKYETVYKIEEIIRDIRDSAI  578



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+N+ + T   Q  F N + ++PE+ +   I+SF L W +IQ+L+  I
Sbjct  401  QMSSDGIPFCLSSINLGESTNVVQSPFRNRSTTVPEIGSLPGIYSFSLAWSEIQTLRPAI  460

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+++ F +FRNP  ++ GKF++L DFL  A N++S++GVLI+VENA YL EK+GL   
Sbjct  461  ENPYSREFTMFRNPRERSSGKFVSLSDFLNLAKNSSSLTGVLISVENATYLREKQGLDAV  520

Query  357  DAVLLALNKADLKTK----KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +A    K    +VMI S +SSVL+ F   S+YE VY ++E I DI ++ I
Sbjct  521  KAVLDTLTEAGYSNKTTTTRVMIQSTNSSVLIDFKKQSRYETVYKVEETIRDILDTAI  578



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDAADLTASTTAMTIFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF+TL DFL F + A +V+GV+I +ENAAYLA KKGLGV DA
Sbjct  451  NPFTATGFQRNPANKNAGKFITLADFLDF-SKAKAVTGVMINIENAAYLASKKGLGVVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ E
Sbjct  510  VKSALAKSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDE  566



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  396  QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  455

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  456  SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  515

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  516  AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAI  571



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  396  QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  455

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  456  SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  515

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  516  AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAI  571



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 120/178 (67%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG  FC+ + ++ D T  AQ QFSNL+ ++PE+++   I++F L W +IQ+L   I
Sbjct  419  QMSSDGKCFCLSTADLKDSTLVAQSQFSNLSTTVPEIRSDVGIYTFSLTWPEIQNLTPAI  478

Query  180  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+ + + +FRNP  KN GK ++L +FL  A ++TS+SGVLI VENAAYL EK+GL V 
Sbjct  479  SNPYQSSYNMFRNPNEKNSGKLISLSEFLELAEHSTSLSGVLIRVENAAYLREKQGLDVV  538

Query  357  DAVLLALNKADLKTK----KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +A    +    KVMI S +SSVL+ F   SKYE VY I+E I DI++S I
Sbjct  539  KAVLDTLTEAGYTNENTKTKVMIQSTNSSVLVDFKKQSKYETVYKIEEIIRDIRDSAI  596



>dbj|BAD94535.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=378

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 108/177 (61%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SF L W +IQS++ QI 
Sbjct  16   QMSKDGIAFCHDAADLSASTTARTTFMSRATSVPEIQPTNGIFSFGLTWAEIQSVKPQIE  75

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL     A +V+GVLI ++NAAYLA KKGLGV D 
Sbjct  76   NPFTATGFQRNPANKNAGKFTTLADFLEL-GKAKAVTGVLINIQNAAYLASKKGLGVVDV  134

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D   ++I E
Sbjct  135  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKTSIEE  191



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIG  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL +FL F + A  V GV+I +ENAAYLA KKGLGV DA
Sbjct  451  NPFTSTGFVRNPANKNVGKFTTLTEFLEF-SKAKKVPGVMINIENAAYLASKKGLGVVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T++V+I S+DSSVL  F     Y RV  I +EI D    +I E
Sbjct  510  VKSALANSTLDKQSTQRVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGDAPKPSIDE  566



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  + A   F + +  + E++ ++ I SFDL W +IQ+L  Q++
Sbjct  385  QMSKDGVAFCLNSADLLGSSNAMTSFMSRSTMVSEIQPKSGIFSFDLTWSEIQTLTPQLT  444

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P     L RNP  KN+GKF+TL DFL F A A +VSG+LI +ENAAYLA KKGL + DA
Sbjct  445  SPLPNSGLARNPANKNQGKFITLSDFLDF-AKAKAVSGILIDIENAAYLASKKGLSIIDA  503

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A      T++VMI S+D+SVL KF N   Y+RV  IKE I D+   T+ E
Sbjct  504  VTAALSNATFDKQATQQVMIQSDDTSVLSKFKNVPGYKRVLSIKEIIGDVPKQTVEE  560



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 116/177 (66%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  + A   F + +  + E++ ++ I SFDL W +IQ+L  Q++
Sbjct  385  QMSKDGVAFCLNSADLLGSSNAMTSFMSRSTMVSEIQPKSGIFSFDLTWSEIQTLTPQLT  444

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P     L RNP  KN+GKF+TL DFL F A A +VSG+LI +ENAAYLA KKGL + DA
Sbjct  445  SPLPNSGLARNPANKNQGKFITLSDFLDF-AKAKAVSGILIDIENAAYLASKKGLSIIDA  503

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A      T++VMI S+D+SVL KF N   Y+RV  IKE I D+   T+ E
Sbjct  504  VTAALSNATFDKQATQQVMIQSDDTSVLSKFKNVPGYKRVLSIKEIIGDVPKQTVEE  560



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIG  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL +FL F + A +V GVLI +ENAAYLA KKGLGV DA
Sbjct  451  NPFTSTGFLRNPANKNVGKFTTLAEFLEF-SKAKAVPGVLINIENAAYLASKKGLGVIDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI      ++ E
Sbjct  510  VKSALTNSTLDKQSTQKVLIQSDDSSVLASFEAVPPYTRVLSIDKEIGGAPKPSVDE  566



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++ DG PFC+ S+++ + TT +   F N + ++PEL +  AI++F L W +IQ+L   I
Sbjct  407  QLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAEIQTLTPAI  466

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+    LFRNP  KN GK  +L DFL+ A N+TS+SGVLI+VENAAYL E++GL V  
Sbjct  467  SNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLREEQGLDVVK  526

Query  360  AVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +   ++    KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  527  AVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAI  582



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDAADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL  +    +V+GVLI +ENAAYLA KKGLG+ DA
Sbjct  451  NPFTSTGFLRNPANKNAGKFTTLADFLELSKE-KAVTGVLINIENAAYLASKKGLGIVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ E
Sbjct  510  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVEE  566



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++I+ T  A   FS L   IPE+K+ N I +FDL W DI+SL   +
Sbjct  396  QMSKDGIPFCLSSIDLIESTDVALSSFSKLGKIIPEIKSGNGIFTFDLAWDDIKSLAPSM  455

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP++   L+RNP +  +G+F+TL DFL      TS+ GV+I +ENAAYLA K+ L VT+
Sbjct  456  LNPYSTSSLYRNPKSNKKGQFLTLLDFLNLTKAQTSLLGVVIIIENAAYLARKQNLSVTE  515

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L+KA        KVMI S +SSVL+KF   +KYE VY I E I D  +S I
Sbjct  516  AVIDTLSKAGYDKPGAPKVMIQSTNSSVLLKFKEKTKYELVYKIDEIIRDAVDSAI  571



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 119/177 (67%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ    N + S+PE+ + N I++F L W +IQ+L   I
Sbjct  393  QMSSDGKPFCSSSIDLGNTTMVAQSPLRNRSTSVPEISSVNGIYTFTLTWPEIQTLTPAI  452

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP++ +F +FRNP  +N GK ++L +FL  A N+T++SGVLI+VENAAYL E +GL V 
Sbjct  453  SNPYSSRFNMFRNPNERNSGKLLSLSEFLNLAKNSTTLSGVLISVENAAYLREMQGLDVV  512

Query  357  DAVLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL AL +   ++  T KVMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  513  KAVLDALTETGYSNRTTTKVMIQSTNSSVLVDFKKQSQYETVYKVEETIRDILDSAI  569



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 119/180 (66%), Gaps = 10/180 (6%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQ+L+  I
Sbjct  390  QMSSDGKPFCSSSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQTLKPAI  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  KN GKF+ L +FL+ A N+TS+SGVLI+VE A YL EK+GL V  
Sbjct  450  SNPYRAYNMFRNPNEKNSGKFILLSEFLSLAKNSTSLSGVLISVEKAVYLREKQGLDVVK  509

Query  360  AVLLAL------NKADLKTKKVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L      N +  KT KVMI S +SSVL+ F   +SKYE VY ++E+I DI +S I
Sbjct  510  AVLDTLTETGYSNGSTTKT-KVMIQSTNSSVLVDFKKQSSKYETVYKVEEKIGDISDSAI  568



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+N+ D TT  Q  +SN +  +PE+ +   I++F L W +IQ+L   I
Sbjct  402  QMSSDGIPFCLSSINLGDSTTVTQTLYSNRSTPVPEISSVAGIYTFSLTWPEIQNLTPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+ + +R+ RNP  KN G  ++L  FL  A N TS+SGVLI+VENAAYL EK+GL V 
Sbjct  462  SNPYFRVYRISRNPKEKNSGTLISLSQFLDLAKNYTSLSGVLISVENAAYLREKQGLDVV  521

Query  357  DAVLLALNK----ADLKTKKVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTI  515
             AVL  L K        T KVMI S +SSVL+ F    KYE VY I+E IS+I +  I
Sbjct  522  QAVLDTLTKTGYNNGTTTTKVMIQSTNSSVLVDFRKQIKYETVYKIEETISNIHDYAI  579



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++    I SFDL+W DIQ+LQ Q++
Sbjct  385  QMSKDGVAFCLDSVDVTRDTTAAASFMSLSTTIPEIQESAGIFSFDLSWSDIQTLQPQLT  444

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF  K  L RNP  K++GKF+TL +FL   A   +V+G+LI +ENAAYLA +KGL +  
Sbjct  445  SPFENKGGLPRNPANKSKGKFLTLAEFLEL-AKVKAVTGILINIENAAYLASQKGLDIVS  503

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  A   A L    T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + E
Sbjct  504  AVNTAFGNATLGKESTQKVLIQSDDTSVLSKFKNVPAYSRVLYLKDEISDAPRTPVEE  561



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC+ S ++   T A   F + A S+PE++  NAI SFDL W +IQSL+ QI 
Sbjct  391  QMSKDGIAFCLDSADLTKSTNAMTTFMSRATSVPEIQPTNAIFSFDLTWAEIQSLKPQIE  450

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN GKFM+L DFL   + A +V+GVLI V+NAAYLA KKGLGV D
Sbjct  451  SPFLTSGGFQRNPANKNAGKFMSLVDFLEL-SKAKAVTGVLINVQNAAYLASKKGLGVVD  509

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L    T+KVMI S+DSSVL  F     + RV  I +EI D    ++ E
Sbjct  510  AVKSALTNSTLDKQSTQKVMIQSDDSSVLASFEAVPPFTRVLSIDKEIGDAPKPSVEE  567



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ SV++   TTAA  F +L+ +IPE++  + I SFDL+W DIQ+LQ Q++
Sbjct  385  QMSKDGVAFCLDSVDVTRDTTAAATFMSLSTTIPEIQQSSGIFSFDLSWSDIQTLQPQLT  444

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF  K  L RNP  KN+GKF++L +FL   A   +V+G+LI +ENAAYLA +KGL +  
Sbjct  445  SPFENKGGLPRNPANKNKGKFLSLAEFLEL-AKVKAVTGILINIENAAYLASQKGLDIVS  503

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  A      T+KV+I S+D+SVL KF N   Y RV  +K+EI D   + + E
Sbjct  504  AVNTALGNATFDKQSTQKVLIQSDDTSVLSKFQNVPAYSRVLYLKDEIGDAPKTPVGE  561



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 116/178 (65%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG  FC+ + ++ D T  AQ QFSN   ++PE+ +   I++F L W +IQ+L   I
Sbjct  438  QMSSDGKSFCLSTADLKDSTLIAQSQFSNRLTTVPEISSVPGIYTFSLTWPEIQNLTPAI  497

Query  180  SNPFAKF-RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+  F  +FRNP  KN GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  498  SNPYQSFYNMFRNPNEKNSGKLISLSEFLELAKKSTSISGVLIRVENAAYLREKQGLDVV  557

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L KA       T KVMI S +SSVL+ F + SKY  VY I+E ISDI++S I
Sbjct  558  KAVLGTLTKAGYNDGNTTIKVMIQSTNSSVLVDFKSESKYTTVYKIEETISDIRDSAI  615



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG  FC+ + ++ D T  AQ QFS+ + ++PE+ T   I++F L W +IQ+L   I
Sbjct  401  QMSSDGKSFCLSTADLKDSTLVAQSQFSDRSTTVPEISTVPGIYTFSLTWPEIQNLTTAI  460

Query  180  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+ + + +FRNP  KN GK ++L +FL  A  +TS+SGVLI VENAAYL EK+GL V 
Sbjct  461  SNPYQSSYNMFRNPNEKNSGKLISLSEFLELAKKSTSLSGVLIRVENAAYLREKQGLDVV  520

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AV+  L +A       T KVM+ S +SSVL+ F + SKYE VY I+E ISDI +S I
Sbjct  521  KAVIDTLTEAGYSNGNTTLKVMVQSTNSSVLVDFKSQSKYETVYKIEETISDIGDSAI  578



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 113/177 (64%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDAADLTASTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +PF      RNP  KN GKF+TL +FL F + A +V+GVLI +ENAAYLA KKGLGV DA
Sbjct  451  SPFTATGFQRNPANKNAGKFITLAEFLDF-SKAKAVAGVLINIENAAYLASKKGLGVVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL K+ L    T+KV+I S+D+SVL  F     Y RV  I++EI      ++ E
Sbjct  510  VKSALAKSTLDKQSTQKVLIQSDDTSVLASFEAVPPYTRVLSIEKEIGGAPKPSVDE  566



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM++DG+ FC+ S ++   TTA   F + + SIPE++ +  I SFDL W +IQ+L+ QI 
Sbjct  393  QMSEDGVAFCLDSADLTGDTTAMPTFMSRSSSIPEVQKEKGIFSFDLTWSEIQTLKPQIV  452

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF +   + RNP A+N+GKFMTL DFL F A A +VSG+LI +ENAAYLA KKGL + D
Sbjct  453  SPFGQNAGYQRNPEAQNKGKFMTLTDFLEF-AKAKAVSGILINIENAAYLASKKGLDMVD  511

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            +V  AL  A     +T++V+I S+D+SVL KF     Y+R+  IKEEI D    T+ E
Sbjct  512  SVTKALGNATFDKQQTQQVLIQSDDTSVLSKFQGVPAYKRLLRIKEEIGDAPKLTVDE  569



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  396  QMSKDGVAFCLDSADLMGDTTAMDSFMSRSALLPEIQKSNGIFSFDLTWSEIESLKPMLA  455

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NP +   L RNP AKN GKFMTL  FL FA ++T VSG+LI +ENA YLA KKGL +  A
Sbjct  456  NPLSSANLVRNPAAKNLGKFMTLAKFLDFAKSST-VSGILINIENAPYLASKKGLDIVTA  514

Query  363  VLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD     + E
Sbjct  515  VSSALINASYDKQITQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDAPKPAVDE  571



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG P C+GS+++   TTA+  F N + +I +++    I SFDL+W +IQSLQ  I 
Sbjct  396  QMTKDGTPICLGSIDLQADTTASSSFINRSTTITDIQMTAGIFSFDLSWAEIQSLQPVIQ  455

Query  183  NPFAKFR-LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P ++   L RNP   N+GKFMTL DFLTF     S+SG+LI +E AAYLAEK+GLGV D
Sbjct  456  SPASRGNGLIRNPAYVNQGKFMTLSDFLTFGKE-NSISGILIRIEYAAYLAEKRGLGVID  514

Query  360  AVLLALNKADLKT---KKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             V+ AL+ A       ++VMI S DSSVL  F   +KY+ VY ++  IS +QN  I
Sbjct  515  TVITALHDAGYDNQMRQQVMIQSTDSSVLTAFKQKTKYKIVYEVENAISGVQNMAI  570



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 109/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  + ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDAADLSASTTARTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSVKPQIE  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL DFL     A +V+GVLI ++NAAYLA KKGLGV D 
Sbjct  451  NPFTATGFQRNPANKNAGKFTTLADFLEL-GKAKAVTGVLINIQNAAYLASKKGLGVVDV  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D   ++I E
Sbjct  510  VKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKTSIEE  566



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 116/179 (65%), Gaps = 8/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIP C+ S+++ +     Q  F N + ++PE++    I+SF L+W +IQ+L+  I
Sbjct  398  QMSSDGIPLCLSSIDLGESMDVVQSPFRNRSATVPEIRPLAGIYSFSLSWSEIQTLKPAI  457

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+++ + LFRNP  KN GK ++L DFL  A N+TS++GVLI+VENAAYL EK+G  V 
Sbjct  458  MNPYSRDYNLFRNPREKNSGKLVSLSDFLNLAKNSTSLTGVLISVENAAYLREKQGFDVV  517

Query  357  DAVLLALNKADL-----KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
              VL  L KA        T KVMI S +SSVL+ F   S+Y+ VY ++E I DI +S I
Sbjct  518  KVVLDTLTKAGYGNATTTTTKVMIQSTNSSVLVDFKKQSRYQTVYEVEETIRDILDSAI  576



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+N+ + T   Q  F N + ++PEL +   I+SF+L W +IQ+L+  I
Sbjct  404  QMSSDGIPFCLTSINLGESTNVVQSPFRNRSATVPELNSLAGIYSFNLAWSEIQTLRPAI  463

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  464  ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDAV  523

Query  357  DAVLLALNKADLKTK----KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A L +L +A    K    +VMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  524  KATLDSLTEAGYSNKTTTTRVMIQSTNSSVLVDFKKQSRYETVYKVEEAIRDILDSAI  581



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+++ + T   Q  + N + ++PELK+   I+SF L W +IQ+L+  I
Sbjct  402  QMSSDGIPFCLSSIDLGESTNVVQSPYRNRSATVPELKSFPGIYSFSLAWSEIQTLRPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ K F LFRNP  ++ GK ++L DFL  A N++++ GVLI+VENA+YL EK+GL   
Sbjct  462  ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSTLVGVLISVENASYLREKQGLDSV  521

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A L +L +A       T++VMI S +SSVL+ F   S+YE VY ++E I DI +S I
Sbjct  522  KAALDSLTEAGYSNKATTRRVMIQSTNSSVLVDFKKQSRYETVYKVEEAIRDILDSAI  579



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 116/175 (66%), Gaps = 5/175 (3%)
 Frame = +3

Query  6    MTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            M+ DGIPFC  S+++ + TT A   F N + ++ EL +   I++F L W +IQ+L   IS
Sbjct  395  MSSDGIPFCSSSIDLGNTTTVALTPFRNRSTTVSELSSVGGIYTFSLTWPEIQTLTPAIS  454

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NP+  + + RNP  KN GK ++L DFL  A N+TS+SGVLI+VENAAY+ E++GL V  A
Sbjct  455  NPYRGYNMLRNPNKKNAGKLLSLADFLNLAKNSTSLSGVLISVENAAYMREEQGLDVVKA  514

Query  363  VLLALNK---ADLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            VL  L +   ++  TKKVMI S +SSVL+ F   S+YE VY ++E I DI +S +
Sbjct  515  VLDTLTQTGYSNSTTKKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRDILDSAV  569



>gb|KCW78936.1| hypothetical protein EUGRSUZ_C00368 [Eucalyptus grandis]
Length=737

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S ++   TTA   F + +  IPE++  + I SFDL W +IQSL+ Q+ 
Sbjct  379  QMSKDGVAFCLDSADLSGDTTAMPTFMSQSTVIPEIQQNSGIFSFDLTWSEIQSLKPQLV  438

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN+GKF+TL +FL   A + +VSGVLI +ENAAYLA KKGLG+ D
Sbjct  439  SPFGSDAGFQRNPANKNKGKFVTLSEFLEL-AKSKAVSGVLINIENAAYLASKKGLGIVD  497

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             V  AL+ A L    T++V+I S+DSSVL +F N S Y+RV  I+E+ISD     + E
Sbjct  498  TVSKALSNATLDKQSTQQVLIQSDDSSVLSQFKNVSTYKRVLTIEEKISDAPKQPVEE  555



>ref|XP_010050300.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=792

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 118/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S ++   TTA   F + +  IPE++  + I SFDL W +IQSL+ Q+ 
Sbjct  434  QMSKDGVAFCLDSADLSGDTTAMPTFMSQSTVIPEIQQNSGIFSFDLTWSEIQSLKPQLV  493

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN+GKF+TL +FL   A + +VSGVLI +ENAAYLA KKGLG+ D
Sbjct  494  SPFGSDAGFQRNPANKNKGKFVTLSEFLEL-AKSKAVSGVLINIENAAYLASKKGLGIVD  552

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             V  AL+ A L    T++V+I S+DSSVL +F N S Y+RV  I+E+ISD     + E
Sbjct  553  TVSKALSNATLDKQSTQQVLIQSDDSSVLSQFKNVSTYKRVLTIEEKISDAPKQPVEE  610



>ref|XP_009126795.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Brassica rapa]
Length=751

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC  S ++   T A   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388  QMSKDGMAFCHDSADITATTNAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF+    F RNP  KN GKFMTL DFL F   A +V+GVLI ++NAAYLA KKGLG+ D
Sbjct  448  SPFSTSGGFQRNPANKNAGKFMTLVDFLEF-GKAKAVTGVLINIQNAAYLASKKGLGIVD  506

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ E
Sbjct  507  AVKSALTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVDE  564



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+++   T   Q  F N + ++PEL + + I+SF L W +IQ+L+  I
Sbjct  317  QMSSDGIPFCLSSIDLGKSTNVVQSPFRNRSATVPELNSLSGIYSFSLTWSEIQTLRPAI  376

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ K F LFRNP  ++ GK ++L DFL  A N++S+ GVLI+VENA YL EK+GL   
Sbjct  377  ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSSLVGVLISVENATYLREKQGLDAV  436

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A L +L +A       T +VMI S +SSVL+ F  +S+YE VY ++E I DI +S I
Sbjct  437  KAALDSLMEAGYSNRTTTTRVMIQSTNSSVLVDFKKHSQYETVYKVEESIRDILDSAI  494



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQSL   I
Sbjct  390  QMSRDGKPFCSHSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQSLIPAI  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  K  GK + L +FL  A ++TS+SGVLI+VENA YL +K+GL +  
Sbjct  450  SNPYRVYNMFRNPNEKKSGKLILLSEFLKLAKHSTSLSGVLISVENAMYLRQKQGLNMVK  509

Query  360  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I E
Sbjct  510  AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIEE  568



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 118/179 (66%), Gaps = 6/179 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DG PFC  S+++ + T  AQ  F+  +  +PE+ + + I++F L W +IQSL   I
Sbjct  392  QMSRDGKPFCSHSIDLSNITNIAQTSFAQRSTHVPEISSNDGIYTFSLTWSEIQSLIPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  K  GK + L +FL  A ++TS+SGVLI+VENA YL +K+GL +  
Sbjct  452  SNPYRVYNMFRNPNEKKSGKLILLSEFLKLAKHSTSLSGVLISVENAMYLRQKQGLNMVK  511

Query  360  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I E
Sbjct  512  AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIEE  570



>emb|CDY32720.1| BnaA02g07820D [Brassica napus]
Length=752

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 115/175 (66%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ S ++I  TTAA      A S+PE++++N I SFDL W +IQSL+ QI 
Sbjct  391  QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKNGIFSFDLTWAEIQSLKPQIQ  450

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN GKFMTL DFL F +   +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  451  SPFLAADGFPRNPKNKNAGKFMTLADFLNF-SKTKAVTGVLINVQNAAYLASKKGLGIVD  509

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI E
Sbjct  510  AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEE  563



>ref|XP_009126782.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X2 [Brassica rapa]
Length=756

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ S ++I  TTAA      A S+PE+++++ I SFDL W +IQSL+ QI 
Sbjct  395  QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKSGIFSFDLTWAEIQSLKPQIQ  454

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN GKFMTL DFL F + A +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  455  SPFLAADGFPRNPKNKNAGKFMTLADFLKF-SKAKAVTGVLINVQNAAYLASKKGLGIVD  513

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI E
Sbjct  514  AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEE  567



>ref|XP_009126781.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Brassica rapa]
Length=738

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 116/175 (66%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ S ++I  TTAA      A S+PE+++++ I SFDL W +IQSL+ QI 
Sbjct  377  QMTKDGMAFCLDSTDLIPTTTAATTLMTRATSVPEIQSKSGIFSFDLTWAEIQSLKPQIQ  436

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN GKFMTL DFL F + A +V+GVLI V+NAAYLA KKGLG+ D
Sbjct  437  SPFLAADGFPRNPKNKNAGKFMTLADFLKF-SKAKAVTGVLINVQNAAYLASKKGLGIVD  495

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L  KKV+I S+DSSVL  F    +Y RV  I +EI D    TI E
Sbjct  496  AVKSALTSSKLD-KKVLIQSDDSSVLDSFKAVPQYTRVLSIDKEIGDAPKPTIEE  549



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T   Q  F N + ++PE+ +   I++F L W +IQ+L   I
Sbjct  393  QMSSDGKPFCSSSIDLGNTTMVTQTPFRNRSETVPEISSVGGIYTFSLTWPEIQTLTPAI  452

Query  180  SNPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+   +RL RNP  +N GK ++L +FL  A ++TS+SGVLI+VENAAYL EK+GL V 
Sbjct  453  SNPYRGGYRLSRNPKERNSGKLLSLSEFLNLAKDSTSLSGVLISVENAAYLREKQGLDVV  512

Query  357  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +    ++ T KVMI S +SSVL+ F   SKYE VY ++E I DI +S I
Sbjct  513  KAVLDTLTETGYNNITTTKVMIQSTNSSVLVDFKKQSKYETVYKVEETIRDILDSAI  569



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S+++   T   Q  F N + ++PEL + + I+SF L W +IQ+L+  I
Sbjct  402  QMSSDGIPFCLSSIDLGKSTNVVQSPFRNRSATVPELNSLSGIYSFSLTWSEIQTLRPAI  461

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
             NP+ K F LFRNP  ++ GK ++L DFL  A N++S+ GVLI+VENA YL EK+GL   
Sbjct  462  ENPYNKDFNLFRNPRERSSGKLVSLSDFLNLAKNSSSLVGVLISVENATYLREKQGLDAV  521

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             A L +L +A       T +VMI S +SSVL+ F  +S+YE VY ++E I DI +S I
Sbjct  522  KAALDSLMEAGYSNRTTTTRVMIQSTNSSVLVDFKKHSQYETVYKVEESIRDILDSAI  579



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 117/180 (65%), Gaps = 10/180 (6%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + T  AQ  F+  +  +PE+ + + +++F L W +IQ+L+  I
Sbjct  391  QMSSDGKPFCAHSIDLSNITNIAQTPFTKRSTHVPEISSNDGMYTFSLTWSEIQTLKPAI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  KN GKF+ L DFL  A  +TS+SGVLI+VE A YL EK+GL V  
Sbjct  451  SNPYRVYNMFRNPNEKNSGKFILLSDFLNLAKTSTSLSGVLISVEKAVYLREKQGLDVVK  510

Query  360  AVLLAL------NKADLKTKKVMIHSNDSSVLMKF--TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L      N +  KT KVMI S +SSVL+ F   +SKYE VY ++E+I DI +S I
Sbjct  511  AVLDTLTETGYSNGSTTKT-KVMIQSTNSSVLVDFKKQSSKYETVYKVEEKIGDISDSAI  569



>ref|XP_011017989.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=749

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (67%), Gaps = 6/175 (3%)
 Frame = +3

Query  12   KDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQISNPF  191
            KDG+ FC+ SV++   TTAA  F +L+ +IPE++    I SFDL+W DIQ+LQAQ+++PF
Sbjct  386  KDGVAFCLDSVDVTRDTTAAASFMSLSTTIPEIQDSAGIFSFDLSWSDIQTLQAQLTSPF  445

Query  192  -AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDAVL  368
             +K  L RNP  K++GKF+TL +FL   A   +V+G+LI +ENAAYLA +KGL +  AV 
Sbjct  446  ESKGGLPRNPANKSKGKFLTLAEFLEL-AKVKAVTGILINIENAAYLASQKGLDIVSAVN  504

Query  369  LALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             A   A      T+KV+I S+D+SVL KF N   Y RV  +K+EISD   + + E
Sbjct  505  TAFGNATFGKQSTQKVLIQSDDTSVLSKFMNVPAYSRVLYLKDEISDAPRTPVEE  559



>ref|XP_010928375.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL7-like [Elaeis guineensis]
Length=768

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + +  +PE++  N I SFDL W +I+SL+  ++
Sbjct  404  QMSKDGVAFCLDSADLMGDTTAMDSFMSRSALVPEIQKNNGIFSFDLTWSEIESLKPVLA  463

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NP +   L RNP AKN GK MTL  FL FA N+T VSG+LI +E+A YLA KKGL +  A
Sbjct  464  NPLSSANLVRNPAAKNMGKLMTLATFLDFAKNST-VSGILINIEHAPYLASKKGLDIVTA  522

Query  363  VLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T+KV+I S+D+SVL  F  NS Y+RV+ ++E ISD     + E
Sbjct  523  VSSALINASYDKQITQKVLIQSDDTSVLSMFKNNSSYKRVFKVEETISDSPKPAVDE  579



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC  S+++ + T  +Q  F+  +  +PE+ +   I++F L W +I++L   I
Sbjct  390  QMSSDGVPFCSRSIDLSNSTMISQTPFAQRSTLVPEISSNGGIYTFSLTWAEIRNLTTAI  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+  + +FRNP  KN GK + L +FL  A N+TS+SGVLI+VENA YL EK+GL V  
Sbjct  450  GNPYRSYAMFRNPNKKNSGKLILLSEFLNLARNSTSLSGVLISVENAVYLREKQGLDVVK  509

Query  360  AVLLALNKADLK---TK-KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +       TK KVMI S +SSVL++F   SKYE VY + E+ISDI +S I
Sbjct  510  AVLDTLTETGYSNGTTKTKVMIQSTNSSVLVEFKKQSKYEAVYKVDEKISDISDSAI  566



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 112/177 (63%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ D  PFC+ S+++ D T  AQ  FSN +  IPEL +   I++F L W +IQ+L   I
Sbjct  403  QMSSDRKPFCLSSIDLKDSTMVAQTTFSNRSTPIPELSSVPGIYTFSLTWPEIQNLTPVI  462

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            S PF   + +FRNP  +N GK ++L +FL  A N+TS+SGVLI+VENAAYL EK+GL V 
Sbjct  463  STPFRDSYNMFRNPNERNSGKLISLSEFLELAKNSTSLSGVLISVENAAYLREKQGLDVV  522

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +   +   T KVMI S +SSVL+ F    KYE VY I E I +I N  I
Sbjct  523  KAVLDTLTETGYENSTTTKVMIQSTNSSVLVDFKKQCKYETVYKIDETIGEILNYGI  579



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403  QMSSDGIPFCLNSTNLGESMNIVQTPFRNRSTTVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463  SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  357  DAVLLALNKADLK--TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I
Sbjct  523  KAVLDTLKESGYSNATKRVMIQSSNSSVLVDIKKQSRYETVYQVEETIRDIQDSAI  578



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403  QMSSDGIPFCLNSTNLGESMNIVQTPFRNRSATVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463  SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  357  DAVLLALNKA--DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I
Sbjct  523  KAVLDTLKESGYSYATKRVMIQSSNSSVLVDIKKQSRYETVYQVEETIRDIQDSAI  578



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 112/176 (64%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC+ S+++I+ T  AQ  FS L  +IPE+K+ N I +FDL W DI+SL   +
Sbjct  401  QMSKDGIPFCLSSIDLIESTNVAQSSFSRLGKTIPEIKSGNGIFTFDLAWNDIKSLSPLM  460

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP +   L+RNP    +G+++TL DFL      TS   V+I +ENAAYLA K+ L VTD
Sbjct  461  LNPHSMNNLYRNPEYNKKGQYLTLSDFLNLTKAHTSTLSVVIIIENAAYLARKQNLSVTD  520

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L++A        KVMI S +SSVL+KF   +KYE VY I E +    +S I
Sbjct  521  AVIDTLSRAGYDKPGAPKVMIQSTNSSVLLKFKEKAKYELVYKIDEIVGGAVDSAI  576



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 111/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC  S +++  TTA   F + A ++PE++  N I SFDL W +I SL+ QI 
Sbjct  386  QMSKDGMAFCQDSADLMPSTTAITTFMSRASTVPEIQATNGIFSFDLTWAEIISLKPQIE  445

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF     F RNP  KN G FMTL DFL F A A +V+GVLI ++NAAYLA KKG+GV D
Sbjct  446  SPFLTSTGFQRNPANKNVGNFMTLTDFLEF-AKAKAVTGVLINIQNAAYLASKKGIGVVD  504

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             V  AL  A L    T+KV+I S+DSSVL  F     Y RV  I +EI D    ++ E
Sbjct  505  VVKSALINATLDKQSTQKVLIQSDDSSVLTSFQGMPSYSRVLSIDKEIGDAPKPSVEE  562



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  391  QMSKDGIAFCHDSADLTTSTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIL  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF AK    RNP  KN GKFMTL DFL F+    +V+GVLI +ENAAYLA KKGLG+ D
Sbjct  451  SPFLAKGGFQRNPSNKNAGKFMTLADFLEFSKE-KAVTGVLINIENAAYLASKKGLGIVD  509

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             V  A+ K+ L    T+KV+I S+DSSVL  F     Y RV  I +EI D    +I E
Sbjct  510  TVQSAITKSTLDKQLTQKVLIQSDDSSVLSSFAAVPPYTRVLTIDKEIGDAPKPSIDE  567



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 117/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S N+ +     Q  F N + ++PE  +   ++SF+L W +IQ+L   I
Sbjct  403  QMSSDGIPFCLNSTNLGESMNIFQTPFRNRSTTVPEFNSLAGLYSFNLAWSEIQTLTPAI  462

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNP+++ F +FRNP  ++ GK ++L +FL  A N++S+ GVLI VE+AAYL EK+GL V 
Sbjct  463  SNPYSRNFHMFRNPRERSSGKLVSLSEFLNLANNSSSLVGVLINVEHAAYLREKQGLDVV  522

Query  357  DAVLLALNKADLK--TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
             AVL  L ++     TK+VMI S++SSVL+     S+YE VY ++E I DIQ+S I
Sbjct  523  KAVLDTLKESGYSNATKRVMIQSSNSSVLVDIRKQSRYETVYQVEETIRDIQDSAI  578



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++ + T  +   ++  ++++PE+ +   I++F L W +IQSL   I
Sbjct  428  QMSSDGIPFCSRSIDLSNSTVISHTPYAQRSINVPEISSNGGIYTFSLTWAEIQSLTPAI  487

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP   N GK + L +FL  A N+TS+SGVLI+VENA YL EK+GL V  
Sbjct  488  SNPYRLYSMFRNPDETNSGKLILLSEFLNLAKNSTSLSGVLISVENAVYLREKQGLDVVK  547

Query  360  AVLLALNKA----DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +      + T+KVMI S +SSVL+ F   SKY+ VY I++ ISDI ++ I
Sbjct  548  AVLDTLMETGYSNGITTEKVMIQSTESSVLVDFKEQSKYDTVYKIEKNISDISDAAI  604



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++KDG+PFC+ S ++   TTA   F +   +IPE++ +  + SF L W +IQ+L+ Q+ 
Sbjct  387  QLSKDGVPFCLASADLAGDTTAMMPFIDKKDTIPEIQPEIGVFSFALTWSEIQTLKPQLV  446

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +PFA   + RNP  KN GKF+TL +FL F A A +VSG+LI +ENAAYLA K+GL +  A
Sbjct  447  SPFANSSILRNPANKNLGKFVTLTEFLDF-AKAKAVSGILINIENAAYLASKQGLDIVGA  505

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  A      T++V+I S+D+SVL KF +   Y+RV  IKE+I D    ++ E
Sbjct  506  VATALTNATFDKQSTQQVLIQSDDTSVLSKFKDVPTYKRVLRIKEKIGDAPKPSVDE  562



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   151 bits (381),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 87/180 (48%), Positives = 122/180 (68%), Gaps = 8/180 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++ DGIPFC+GS+N+ D T AAQ  F + A   P+L  Q+ I +++L W  IQ+L   +
Sbjct  354  QISSDGIPFCLGSINLRDRTNAAQSAFLSQATDNPDLNIQSGIFTYNLTWSQIQTLSPAM  413

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAAN-ATSVSGVLITVENAAYLAEKKGLGV  353
             +P+A    L+RNP+A NEGKF+ L +FL FA+N ATSVS +LI VEN AYLA+ +GL +
Sbjct  414  YSPYAVGSSLYRNPIAANEGKFLQLSEFLAFASNNATSVSEILIGVENDAYLAQNQGLDL  473

Query  354  TDAVLLALNKADLKTKKVMIHSNDSSVLMKFTN----SKYERVYGIKEEISDIQNSTILE  521
            + AVL  L++   K KK++I S+DS+VL +F N    S YE VY ++E I  I NST+ E
Sbjct  474  SGAVLDVLSQFQPK-KKILIRSSDSAVLWRFKNNSSSSGYELVYLVEENIGGILNSTVSE  532



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 117/179 (65%), Gaps = 6/179 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + TT +Q  ++  +  +PE+ +   I++F L W +I++L   I
Sbjct  391  QMSSDGKPFCSRSIDLSNSTTISQTSYAQRSTHVPEISSNGGIYTFSLTWAEIRNLTPAI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NP+  + +FRNP  KN GK + L +FL  A ++TS+SGVLI+VEN  YL +K+GL +  
Sbjct  451  ANPYRLYNIFRNPNQKNSGKLILLSEFLNLAKHSTSLSGVLISVENVMYLRQKQGLNMVK  510

Query  360  AVLLALNKADLKTK----KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AVL  L +    T+    KVMI S DSSVL++F N SKYE VY +++ ISDI +S I E
Sbjct  511  AVLDTLTETAYSTRITTTKVMIQSTDSSVLVEFRNQSKYETVYKVEKTISDISDSAIKE  569



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S +++  TTA   F + + SIPE++ +N I SFDL W +IQSL+ Q++
Sbjct  389  QMSKDGVAFCLDSADLLGDTTAITTFMSKSSSIPEIQPKNGIFSFDLTWSEIQSLKPQLT  448

Query  183  N--PFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +  P     L RNP  K++GKF+TL +FL F A A +V+GVLI V NA YLA KKGL + 
Sbjct  449  SSIPQDMGGLPRNPANKDKGKFLTLAEFLDF-AKAKAVTGVLINVLNAPYLASKKGLDIV  507

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             AV  AL+ A L    T++VMI S+D++VL KF    KY RVY IK+ ISD    ++ E
Sbjct  508  GAVTTALSNATLDKQSTQQVMIQSDDTAVLAKFKEVPKYRRVYVIKDIISDAPKPSVDE  566



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 111/177 (63%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DG PFC  S+++ + T  AQ    N + ++ E+ +   I +F L W +IQSL   I
Sbjct  399  QMSRDGTPFCSSSIDLANSTMVAQTPLRNRSTTVHEISSVGGIFTFSLTWPEIQSLTPAI  458

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + +FRNP  K  GK ++L +FL  A N+TS+SGVLI+VENA YL +++GL V  
Sbjct  459  SNPYRAYNMFRNPNEKKSGKLISLSEFLNLAKNSTSLSGVLISVENAVYLRKEQGLDVVK  518

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L K        TK VMI S +SSVL  F   S+YE VY ++E ISDI +S I
Sbjct  519  AVLDTLTKTGYSNRTTTKNVMIQSTNSSVLADFKKQSQYETVYKVEETISDILDSAI  575



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 121/179 (68%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQ-SLQAQ  176
            Q+TKDGI  CM S+N+++ TT     FS+L   IPE+     I +F+L W++IQ +L+  
Sbjct  409  QVTKDGILICMSSINLMEVTTVTTSPFSSLLSVIPEIHDGPGIFTFNLTWEEIQKNLKPA  468

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP  ++ ++RNP+ KN+G FM+L DFL F  +   +SG+LI++ENAA+LAEK G  VT
Sbjct  469  ISNPEIQYNIYRNPLYKNDGNFMSLGDFLAFGRDK-DLSGILISIENAAFLAEKLGYSVT  527

Query  357  DAVLLALNKADLKT---KKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  521
            D V+ AL  +       ++VMI S +SSVL+KF   +KYE VY + E ISD+ NS+I++
Sbjct  528  DGVMRALQDSGYSNQTGQEVMILSKNSSVLIKFRQQTKYELVYMVDESISDMVNSSIMD  586



>emb|CDY43885.1| BnaC09g33580D [Brassica napus]
Length=751

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 113/178 (63%), Gaps = 10/178 (6%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N + S+DL W +IQSL+ QI 
Sbjct  391  QMSKDGIAFCHDSADLTASTTAMATFMSRATSVPEIQPTNGVFSYDLTWAEIQSLKPQIQ  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF  K  + RNP  KN GKF+TLDDFL F+    +V+GVL    NAAYLA KKGLG+ D
Sbjct  451  SPFITKVGITRNPANKNAGKFVTLDDFLKFSKE-KAVTGVL----NAAYLASKKGLGIVD  505

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL K+ L    T++V+I S+DSSVL  F     Y RV  I +EI D   +++ E
Sbjct  506  AVKSALTKSTLDKQTTQRVLIQSDDSSVLAGFEAVPPYTRVLSIDKEIGDAPKASVDE  563



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 120/179 (67%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+++ID T  A+ +F++   +I +LK    + +F+L W DI ++L+  
Sbjct  391  QVTKDGIPICMSSIDLIDVTNVAKSEFASQTTTINDLKAGPGVFTFNLTWDDISKNLKPM  450

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P  K+ LFRNP  KN G FM L DFL FA +   +SG++ITVENAA++AEK G GV 
Sbjct  451  ISSPMNKYLLFRNPRNKNAGNFMRLSDFLAFAKDK-DLSGIMITVENAAFMAEKLGFGVV  509

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I+E + D   S++ +
Sbjct  510  DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQETKYDLVYMIEESVRDAAPSSLAD  568



>ref|XP_009803613.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Nicotiana sylvestris]
Length=694

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ S++++  TTAA  F + A  +  +++   I SFDL W++IQSL+ Q+S
Sbjct  394  QMTKDGVAFCLPSIDLMPSTTAAGPFMSRAAKVDPIQSAMGIFSFDLTWEEIQSLKPQMS  453

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
              F    L R+P  KN GKF+TL DFL F A A +V GVLI VENAAYLA  KGL +  A
Sbjct  454  GGFNG-ELVRDPARKNVGKFVTLSDFLEF-AKAKAVPGVLINVENAAYLASNKGLDIVGA  511

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A L    T+KV+I S++SSVL KF     Y+RV  IKE++  + N T LE
Sbjct  512  VTTALSNATLDKNSTQKVLIMSSESSVLDKFKAIPTYQRVLHIKEQVGFVTNETALE  568



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG+PFC  S+++ + T  +Q  F+  +  +PE+ +   I++F L W +I++L   I
Sbjct  389  QMSSDGVPFCSRSIDLSNSTMISQTPFAQRSTLVPEISSSGGIYTFSLTWAEIRNLTPAI  448

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+  + +FRNP  KN GK + L +FL  A N+T +SGVLI+VENA YL EK+GL V  
Sbjct  449  GNPYRSYTMFRNPNKKNSGKLILLSEFLNLANNSTLLSGVLISVENAVYLREKQGLDVVK  508

Query  360  AVLLALNKADL---KTK-KVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +       TK KVMI S +SSVL++F   SKYE VY + E+ISDI +S I
Sbjct  509  AVLDTLTETGYGNGTTKTKVMIQSTNSSVLVEFKKQSKYEAVYKVDEKISDISDSAI  565



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 113/176 (64%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDGIPFC  S+++I  T  A+  FSNL+ SIPE++  + I +FDL W DI+SL   +
Sbjct  397  QMSKDGIPFCFNSIDLIKSTNVAKSSFSNLSKSIPEIQAGDGIFAFDLAWNDIKSLSLSM  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             N F++F L+RNP    +   +TL +FL F    TS+ GV+I +E A YLA ++ L V D
Sbjct  457  LNLFSEFNLYRNPKFNEKVSLLTLSEFLNFTQGHTSLLGVVIIIEKAPYLAREQNLSVID  516

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV   L+KA      T  VMI S+DSSVL+KF   +KYE VY I E +SDI +S +
Sbjct  517  AVSDTLSKAGYDKTGTPNVMIQSSDSSVLLKFKEKTKYELVYSIPEIVSDIVDSAL  572



>ref|XP_008361197.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=773

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 118/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W DIQSL+ QI 
Sbjct  399  QMSSDGVAFCLDTIDLNSGTNALSQFMTKSDTIPELQAEAGVFSFQLSWSDIQSLKPQIQ  458

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K ++ RNP  K+ GK +TL +FL F A   + +G+LI +ENAAYLA K GL +  
Sbjct  459  SPYGTKEKIVRNPANKDAGKLVTLKEFLEF-AKKNAATGILINIENAAYLASKAGLDIVG  517

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL+ A L    T++V+I S+D+SVL KF +SK Y+RV+ IKE+ISD    ++ E
Sbjct  518  TVSSALSNATLDKQSTQQVLIKSDDTSVLSKFKDSKNYKRVFNIKEKISDAPKESVAE  575



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 119/178 (67%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W DIQSL+ QI 
Sbjct  399  QMSSDGVAFCLDTIDLNSGTNALSQFMTNSDTIPELQAEAGVFSFQLSWSDIQSLKPQIQ  458

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K ++ RNP  K+ GK +TL +FL F A   +V+G+LI +ENAAYLA K GL +  
Sbjct  459  SPYGTKEKIVRNPANKDAGKLVTLKEFLEF-AKKNAVTGILINIENAAYLASKAGLDIVG  517

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNS-KYERVYGIKEEISDIQNSTILE  521
            AV  AL+ A L    T++V+I S+D+SVL KF ++  Y+RV+ IKE+ISD    ++ E
Sbjct  518  AVSSALSNATLDKQSTQQVLIKSDDTSVLSKFKDANNYKRVFNIKEKISDAPKESVAE  575



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 108/172 (63%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG PFC+ S+++ + TT A   F   + +I E+K  + I++F L W +I++L   I
Sbjct  396  QMSKDGTPFCLSSIDLSESTTVADTNFKTRSTTIQEIKNSSGIYTFSLTWDEIKTLTPSI  455

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
              P+ K+ L RNP  KN+GK +TL  FL+     T  S +LI++ENAAYLAEK+ L V +
Sbjct  456  LKPYGKYSLIRNPKLKNQGKLITLSKFLSL----TKGSLILISIENAAYLAEKQNLSVIN  511

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTI  515
            AVL ALNK    + KVMI S  SSVL  F  SK+ERVY + E I D   S I
Sbjct  512  AVLDALNKTKPTSYKVMIQSTHSSVLKIFDKSKFERVYKVDENIGDAAVSAI  563



>ref|XP_009803612.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ S++++  TTAA  F + A  +  +++   I SFDL W++IQSL+ Q+S
Sbjct  394  QMTKDGVAFCLPSIDLMPSTTAAGPFMSRAAKVDPIQSAMGIFSFDLTWEEIQSLKPQMS  453

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
              F    L R+P  KN GKF+TL DFL F A A +V GVLI VENAAYLA  KGL +  A
Sbjct  454  GGFNG-ELVRDPARKNVGKFVTLSDFLEF-AKAKAVPGVLINVENAAYLASNKGLDIVGA  511

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A L    T+KV+I S++SSVL KF     Y+RV  IKE++  + N T LE
Sbjct  512  VTTALSNATLDKNSTQKVLIMSSESSVLDKFKAIPTYQRVLHIKEQVGFVTNETALE  568



>gb|KHG04342.1| putative glycerophosphoryl diester phosphodiesterase 3 -like 
protein [Gossypium arboreum]
Length=540

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S ++   TTA   F   AVSIPE++ +  I SFDL W +IQSL+ ++ 
Sbjct  178  QMSKDGVAFCLDSPDLTRDTTAMSTFLTRAVSIPEIQKEKGIFSFDLTWTEIQSLKPKMF  237

Query  183  NPFAKFR-LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF +   L RNP AKN+GK ++L DFL FA   T   GVLI++ENA YLA KK L V D
Sbjct  238  SPFLQHSGLERNPEAKNKGKLISLSDFLGFA--KTKPVGVLISIENARYLASKKHLDVVD  295

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDI  500
            AV   L  A L+ K+VMI S+DS+VL KF   S Y+R++   EEIS +
Sbjct  296  AVTKTLKNASLENKQVMIQSDDSAVLSKFKGESGYKRLFRF-EEISGV  342



>gb|AAD10252.1| S222 [Triticum aestivum]
Length=461

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTT-AAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S++++D TT A+ QF++ A  I ++K    +++F+L W+DI  +L+  
Sbjct  149  QVTKDGIPICMSSIDLMDVTTVASSQFASQAGVISDIKAVAGVYTFNLTWEDIANNLKPM  208

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNPF +  L RNP  +N GKFM L DFL F A    +SG++ITVE+A+++AEK G GV 
Sbjct  209  ISNPFGQISLSRNPRNRNAGKFMRLSDFLAF-AKGEDLSGIMITVEHASFMAEKLGFGVV  267

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ A++ +       KKVMI S +SS L+KF   +KY  VY I E + D   S++ +
Sbjct  268  DAVIKAVDDSGYSKQTAKKVMIQSTNSSTLVKFKQLAKYNLVYKIDEVVKDAAPSSLAD  326



>gb|EAY86479.1| hypothetical protein OsI_07859 [Oryza sativa Indica Group]
Length=709

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S++++D TT +  QFS+    I ++K    ++SF+L W DI ++L+ +
Sbjct  350  QVTKDGIPICMSSIDLMDVTTVSTSQFSSQTTVIKDIKNGAGVYSFNLTWDDIAKNLKPK  409

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP   F ++RNP  KN G FM L DFL F A    +SGV+I++E+AA++AEK G GV 
Sbjct  410  ISNPMTTFDVYRNPRNKNAGSFMRLSDFLAF-AKGKELSGVMISIEHAAFMAEKLGFGVV  468

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY  VY ++E++ D   S++ +
Sbjct  469  DAVIKALDDSGYSKQTAQKVMIQSTNSSVLVKFKEQTKYNLVYMLEEDVRDAAPSSLAD  527



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQ-SLQAQ  176
            Q+T DGI  CM S++++D TT  +  FS+ A  IP++K    I++F+L W +IQ +LQ  
Sbjct  444  QVTHDGILICMKSIDLLDDTTVTRSPFSSYASIIPDIKRTPGIYTFNLTWNEIQKNLQPT  503

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            +S PF ++ L RNP  KN+G FMTL +FLTFA     +SG+LIT+ENAA++ EK G+GVT
Sbjct  504  MSAPFIEYNLVRNPRYKNKGNFMTLSEFLTFA-KGKDLSGILITIENAAFIVEKLGIGVT  562

Query  357  DAVLLALNKADLKTK---KVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
            DAV+ A++ A   T+   ++MI S +SSVL KF  ++KY+ VY I   + D  NS++
Sbjct  563  DAVINAISFAGYNTQTTPEIMIQSTNSSVLKKFRQHTKYKLVYKIDGPVGDAVNSSV  619



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+++ D T     QF++ AV I ++K    +++F+L W+DI ++L+  
Sbjct  299  QVTKDGIPICMSSIDLKDVTNVVTSQFASEAVIIKDIKADAGVYTFNLTWEDIAKNLKPT  358

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP +K+  +RNP  +N G FM L DFL FA +   +SG++ITVE A+++AEK G GV 
Sbjct  359  ISNPMSKYNTYRNPRNRNAGNFMKLSDFLAFAKD-KDLSGIMITVERASFMAEKLGFGVV  417

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +KVMI S +SSVLMKF   +KY  VY I E++ D   S++ +
Sbjct  418  DAVIKALDDSGYSKQTAQKVMIQSTNSSVLMKFRQQTKYNLVYMIDEDVKDAAPSSLAD  476



>ref|XP_010443532.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=546

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQS++ QI 
Sbjct  391  QMSKDGIAFCHDSADLTASTTAMTTFMSRATSVPEVQPTNGIFSFDLTWAEIQSVKPQIG  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF TL +FL F + A +V GV+I +ENAAYLA KKGLGV DA
Sbjct  451  NPFTSAGFVRNPANKNVGKFTTLAEFLEF-SKAKAVPGVMINIENAAYLASKKGLGVVDA  509

Query  363  VLLALNKADL---KTKKVMIHSNDSS-VLMKFTNSK  458
            V  AL  + L    T++V+I S+DSS  L++FT+++
Sbjct  510  VKSALANSTLDKQSTQRVLIQSDDSSYTLLQFTHTQ  545



>gb|KEH37864.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=912

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 117/177 (66%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG  FC+ + ++++ TTA  +F + + ++PE++T++ I SFDL W +IQSLQ QIS
Sbjct  549  QMTKDGTSFCLNTADLMEDTTAMTKFMSRSSNVPEIQTKSGIFSFDLTWNEIQSLQPQIS  608

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +PF      RNP  KN GKF+ L +FL   A A  V+G+LI + NAAYLA KKGL +  A
Sbjct  609  SPFGS-GFQRNPANKNSGKFVLLSEFLEL-AKAKEVTGILINISNAAYLASKKGLDIVGA  666

Query  363  VLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A      T++V+I S+DSSVL K+ + S Y+RV+ +++ I D    T+ E
Sbjct  667  VSTALSNATFDKQVTQQVLIQSDDSSVLSKYKDISSYKRVFLVEDNIGDTPKKTVDE  723



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S++++D TT +  QFS+    I ++K    ++SF+L W DI ++L+ +
Sbjct  390  QVTKDGIPICMSSIDLMDVTTVSTSQFSSQTTVIKDIKNGAGVYSFNLTWDDIAKNLKPK  449

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP   F ++RNP  KN G FM L DFL F A    +SGV+I++E+AA++AEK G GV 
Sbjct  450  ISNPMTTFDVYRNPRNKNAGSFMRLSDFLAF-AKGKELSGVMISIEHAAFMAEKLGFGVV  508

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY  VY ++E++ D   S++ +
Sbjct  509  DAVIKALDDSGYSKQTAQKVMIQSTNSSVLVKFKEQTKYNLVYMLEEDVRDAAPSSLAD  567



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM  DG PFC  S+++ D T  AQ  F N   ++ E+ +   +++F L W +IQ+L   I
Sbjct  301  QMCSDGTPFCSNSIDLGDSTMVAQTPFRNRLTTVSEISSNGGVYTFSLTWPEIQNLTPAI  360

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+    + RNP   N G  ++L  FL  A N+TS+SGVLI VEN  YL EK+GL V  
Sbjct  361  SNPYRSNSMLRNPNESNSGNLISLSQFLDLAKNSTSLSGVLIIVENVVYLREKQGLDVIR  420

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +    ++ T KVMI S +SSVL +F   SKYE VY I+E ISDI +S I
Sbjct  421  AVLDTLTETGYNNITTTKVMIQSTNSSVLREFKKQSKYETVYRIEETISDILDSAI  476



>ref|XP_002523503.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF38842.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=753

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 110/169 (65%), Gaps = 6/169 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FCM S ++   TTA   F + + +IPE++    I SFDL W +IQ+L+ Q+ 
Sbjct  388  QMSKDGVAFCMDSADLTGDTTAMTTFVSRSSTIPEIQPAAGIFSFDLTWTEIQTLRPQLV  447

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P     LF RNP +KN GKFMTL +FL F A   + SG+LI +ENAA+LA KKGL +  
Sbjct  448  SPLGNGNLFPRNPASKNAGKFMTLPEFLDF-AKTKAASGILINIENAAFLAAKKGLDIVT  506

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEIS  494
            AV  AL+ A      T++V+I S+D+SVL KF N   Y+RV  + EEIS
Sbjct  507  AVTTALSNATFDKQATQQVLIQSDDTSVLSKFLNIPAYKRVLYLGEEIS  555



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM++DGIPFC+ SVN+++ T A Q F NL  ++PE++    I SF L+W DIQ L   I+
Sbjct  404  QMSQDGIPFCLSSVNLLNNTQATQ-FRNLMSTVPEIQPAPGIFSFMLDWADIQGLTPMIA  462

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P++   L RNP ++N G+ ++L DFL  A N++S+SGVLI +ENA YLA  + L +T+A
Sbjct  463  SPYSSSFLLRNPRSRNAGRLVSLADFLDLANNSSSLSGVLIKIENAEYLAANQDLSITEA  522

Query  363  VLLALNKADLK----TKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTILE  521
            V  AL  +        KKVMI S  SSVL     + YE VY + E I    N TI +
Sbjct  523  VSEALELSGFNNNTAAKKVMIQSTSSSVLKAMRGNSYELVYHVDEIIRGALNDTIAD  579



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 110/175 (63%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+KDG+PFC  SVN+++ T   Q QF +L  ++ +++T+  I SF LNW DI+ L   I
Sbjct  391  QMSKDGVPFCSSSVNLMNTTLVGQTQFRSLISTVNDIQTKPGIFSFSLNWTDIKDLTPVI  450

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  + L+RNP A+N GK  +L DFL  A  ATS+SGV I +  A +LA K+GL +TD
Sbjct  451  SNPFPDYSLYRNPEARNAGKIQSLGDFLDLAKKATSLSGVSIRIGRANFLALKEGLSITD  510

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSKYERVYGIKEEISDIQNSTI  515
            AV  AL+KA       +KVMI S +SSVL      KY+ VY + E I    ++ I
Sbjct  511  AVKDALDKAGYDGPSAEKVMIVSTNSSVLKAMKGKKYKLVYDVDEGIRGAPDNAI  565



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGT-TAAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+++ D T     QF++ AV I ++K    +++F+L W+DI ++L+  
Sbjct  389  QVTKDGIPICMSSIDLKDVTNVVTSQFASEAVIIKDIKADAGVYTFNLTWEDIAKNLKPT  448

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP +K+  +RNP  +N G FM L DFL FA +   +SG++ITVE A+++AEK G GV 
Sbjct  449  ISNPMSKYNTYRNPRNRNAGNFMKLSDFLAFAKD-KDLSGIMITVERASFMAEKLGFGVV  507

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +KVMI S +SSVLMKF   +KY  VY I E++ D   S++ +
Sbjct  508  DAVIKALDDSGYSKQTAQKVMIQSTNSSVLMKFRQQTKYNLVYMIDEDVKDAAPSSLAD  566



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 119/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGI  CM SV+++D TT A+ QF++   +I  LK  + + +F+L W DI ++L+  
Sbjct  397  QVTKDGILICMSSVDLMDVTTVAKSQFASQVTTINSLKAGSGVFTFNLTWDDISKNLKPM  456

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP + + L+RNP  KN G FM L DFLTF AN   +SG++ITVE+AA++AE+ G GV 
Sbjct  457  ISNPMSTYNLYRNPRNKNAGNFMRLSDFLTF-ANGKDLSGIMITVEHAAFMAEELGFGVV  515

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       + VMI S +SSVL+KF   +KY  VY I+E + D   S++ +
Sbjct  516  DAVIKALDDSGYSKQTAQNVMIQSTNSSVLVKFKQETKYNLVYMIEESVRDAAPSSLAD  574



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTT-AAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S++++D TT A+ QF++ A  I ++K    +++F+L W+DI  +L+  
Sbjct  388  QVTKDGIPICMSSIDLMDVTTVASSQFASQAGVISDIKAVAGVYTFNLTWEDIANNLKPM  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNPF +  L RNP  +N GKFM L DFL F A    +SG++ITVE+A+++AEK G GV 
Sbjct  448  ISNPFGQISLSRNPRNRNAGKFMRLSDFLAF-AKGEDLSGIMITVEHASFMAEKLGFGVV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ A++ +       KKVMI S +SS L+KF   +KY  VY I E + D   S++ +
Sbjct  507  DAVIKAVDDSGYSKQTAKKVMIQSTNSSTLVKFKQLAKYNLVYKIDEVVKDAAPSSLAD  565



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ + TT A     N + ++PE+ +   I++F L W +I++L   I
Sbjct  406  QMSSDGTPFCSSSIDLGNTTTVALTPLRNRSTTVPEISSIGGIYTFSLTWPEIKNLTPVI  465

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NP+  + + RNP  KN GK ++L +FL  A N+TS+S VLI VENAAYL E +GL V  
Sbjct  466  TNPYRTYTMLRNPKEKNSGKLISLSEFLDLAKNSTSLSSVLINVENAAYLRENQGLDVIK  525

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDI  500
            AVL  L     K   T KVMI S +SSVL+ F   SKYE VY I+E IS+I
Sbjct  526  AVLDTLTDTGFKDSTTTKVMIQSTNSSVLVDFKKQSKYETVYKIEETISEI  576



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG P CM   ++   TTA   F + A+ I E++  + I SFDL W++IQ+L+  ++
Sbjct  391  QMTKDGFPICMTIADLTGDTTAMPSFMSRAIVIQEIQENSGIFSFDLTWEEIQTLKPVLN  450

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P     + RNP  KNEGKFM L DFL  A +  +V+GVLI VENA YLA KKGL +TD+
Sbjct  451  SPLGPAAMPRNPAVKNEGKFMALHDFLVLAKD-MNVTGVLINVENAFYLASKKGLSITDS  509

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN--SKYERVYGIKEEISDIQNSTILE  521
            VL  L  A      + +VMI S DS+VL K       Y+RVY I E ISD    T+ E
Sbjct  510  VLDTLRNASYDKENSPQVMIQSGDSAVLSKIKKVAPSYKRVYLIDEIISDANKLTVEE  567



>ref|XP_009594117.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Nicotiana tomentosiformis]
Length=784

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+  C+ S++++  TTAA  F + A  I  +++   I SFDL W++IQSL+ Q+S
Sbjct  394  QMTKDGVALCLPSIDLMPSTTAAGPFMSRAAKIDPIQSAMGIFSFDLTWEEIQSLKPQMS  453

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
              F    L R+P  KN GKF+TL DFL F A A +V GVLI +ENAAYLA  KGL +  A
Sbjct  454  GGFNG-ELARDPARKNVGKFVTLSDFLEF-AKAKAVPGVLINIENAAYLATNKGLDIVGA  511

Query  363  VLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A L    T+KV+I S++SSVL KF T   Y++V  IKE++  + N T LE
Sbjct  512  VTTALSNATLDKNLTQKVLIMSSESSVLDKFKTIPTYQKVLHIKEQVGFVTNETALE  568



>ref|XP_006279180.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12078.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=538

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  183  QMSNDGTPFCASSIDLGDSTMVAQTPFRNRQTTVSEISSDGGIYTFSLTWPEIQNLTPAI  242

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N G  + L  FL  A N+TS+S VLI+VEN  YL EK GL +  
Sbjct  243  SNPYRSYDMLRNPNERNSGNLILLSQFLDLAKNSTSLSSVLISVENVVYLREKLGLDLIK  302

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +        T KVMI S +SSVL+ F   SKY  VY I+E ISDI +S I
Sbjct  303  AVLDTLTETGYSNVNTTTKVMIQSTNSSVLLDFKKQSKYVTVYRIEETISDILDSAI  359



>gb|AES92567.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=753

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 113/177 (64%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDGI FC  ++++++ +TA  +F   + S+PEL+ +N I SFDL W +IQ+L+ Q+ 
Sbjct  396  QMTKDGIAFCANTIDLLEISTALPKFMARSSSVPELQPKNGIFSFDLTWTEIQTLKPQMV  455

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            NPF      RNP  KN GKF+TL +FL   A   +V G+LI ++NAAYLA KKGL +  A
Sbjct  456  NPFGN-EFQRNPANKNNGKFVTLPEFLDL-AKTKAVFGILIHIQNAAYLASKKGLDIVGA  513

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL+ A      T++V I S+DSSVL KF +   Y+RV  I+  I DI   T+ E
Sbjct  514  VTAALSNATFDKQATQQVFIQSDDSSVLSKFKDIPSYKRVLLIENIIDDIPVQTVEE  570



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTT-AAQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S++++D TT A+ QF++ A  I ++K    +++F+L W+DI  +L+  
Sbjct  387  QVTKDGIPICMSSIDLMDVTTVASSQFASQAGVISDIKAVAGVYTFNLTWEDIANNLKPM  446

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNPF +  L RNP  +N GKFM L DFL F A    +SG++ITVE+A+++AEK G GV 
Sbjct  447  ISNPFGQISLSRNPRNRNAGKFMRLSDFLAF-AKGKKLSGIMITVEHASFMAEKLGFGVV  505

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ A++ +       +KVMI S +SS L+KF   +KY  VY I E + D   S++ +
Sbjct  506  DAVIKAVDDSGYSKQSAQKVMIQSTNSSTLVKFKQLAKYNLVYKIDEVVKDAAPSSLAD  564



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 117/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W +IQSL+ QI 
Sbjct  403  QLSSDGVAFCLDTIDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWDEIQSLKPQIQ  462

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K +++RNP  K+ GK +TL DFL F +   +V+G+LI +ENAAYLA K GL +  
Sbjct  463  SPYGTKEKVYRNPANKDVGKLVTLSDFLEF-SKTKAVTGILINIENAAYLASKAGLDIVK  521

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL+ A      T++V+I S+D+SVL KF + K Y RV  IKE+ISD   +++ E
Sbjct  522  TVTSALSNATFDKQSTQQVLIKSDDTSVLSKFKDVKTYRRVLNIKEKISDAPKASVDE  579



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 116/176 (66%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            Q++KD + FC+ S+N+++ T  AQ  F NL+V  PE++ ++ I++F L    I++L+  I
Sbjct  386  QISKDQVLFCLSSINLLNSTDVAQTSFRNLSVLAPEIQKESGIYTFSLPMSQIRTLKPAI  445

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+   +LFRNP  +N G+F+ L +FL+ A N +S+SG++I VENAAYLAE +GLG+ D
Sbjct  446  SNPYMWTKLFRNPRNRNAGRFLILSEFLSLAKNYSSLSGIIIRVENAAYLAEHQGLGIVD  505

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L K+  K +   +++I S+D SVL KF   + +E VY +   I  I +S +
Sbjct  506  TVLDELRKSSQKNQTGPRILIMSSDISVLRKFKEATNHELVYEVDRNIRTISDSAV  561



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 117/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++ DG+ FC+ ++++  GT A  QF   + +IPEL+ +  + SF L+W +IQSL+ QI 
Sbjct  403  QLSSDGVAFCLDTIDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWHEIQSLKPQIQ  462

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K +++RNP  K+ GK +TL DFL F +   +V+G+LI +ENAAYLA K GL +  
Sbjct  463  SPYGTKEKVYRNPANKDVGKLVTLSDFLEF-SKTKAVTGILINIENAAYLASKAGLDIVK  521

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL+ A      T++V+I S+D+SVL KF + K Y RV  IKE+ISD   +++ E
Sbjct  522  TVTSALSNATFDKQSTQQVLIKSDDTSVLSKFKDVKTYRRVLNIKEKISDATKASVDE  579



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 109/176 (62%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ +G PFC+ S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  407  QMSSNGTPFCLSSIDLGDSTMVAQTPFRNRLTTVSEISSDGGIYTFSLTWPEIQNLTPAI  466

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+    + RNP   N    ++L  FL  A N+TS+SGVLI VEN  YL EK+GL V  
Sbjct  467  SNPYRSNSMLRNPNESNSVNLISLCQFLDLAKNSTSLSGVLIIVENVVYLREKQGLDVIR  526

Query  360  AVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +    ++ T KVMI S +SSVL++F   SKYE VY I+E ISDI +S I
Sbjct  527  AVLDTLTETGYNNITTTKVMIQSTNSSVLLEFKKQSKYETVYRIEETISDILDSAI  582



>ref|XP_008440682.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Cucumis melo]
Length=760

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 110/179 (61%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++KDG+PFCM   +++ GTT    FS    SIPE++ +  I SFDL W +I +L+ QIS
Sbjct  391  QLSKDGVPFCMEMADLLTGTTVITAFSGKTTSIPEIQAEPGIFSFDLTWAEILTLKPQIS  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NPF A   L RNP  KN+GKFMTL +FL F + A +VSG++I ++NAAYLA KKGL +  
Sbjct  451  NPFMASSGLARNPAFKNKGKFMTLPEFLEF-SKAKAVSGIMINIQNAAYLASKKGLDMVG  509

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN--SKYERVYGIKEEISDIQNSTILE  521
             V  AL  A      T++V I S+D+SVL  F N    + RV  +  +I D     + E
Sbjct  510  TVATALVNATFDKQSTQQVFIRSDDTSVLSIFMNKFPNFIRVLTVDSKIGDAPKEALEE  568



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            +M+ DG PFC  S+++   T   Q  F N +  IP++ +   I++F+L W +IQSL   I
Sbjct  359  KMSSDGKPFCSSSIDLTQSTMVIQSPFRNRSTIIPDISSDPGIYTFNLTWPEIQSLTPAI  418

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+  + +FRNP  KN G+ ++L +FL  A  +TS+ GVLI+VE   YL EK+GL V  
Sbjct  419  MNPYRSYNMFRNPNEKNSGRIISLSEFLHLANKSTSIYGVLISVEYVVYLREKQGLDVVK  478

Query  360  AVLLALNKADL----KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +        T KVMI S  SSVL+ F   SKYE VY ++E I DI +S I
Sbjct  479  AVLDTLTETGYSNGTSTTKVMIQSTHSSVLVDFKKKSKYETVYKVEETIRDISDSAI  535



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 106/177 (60%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            +M+ DG PFC  S+++   T   Q  F N +  IP++ +   I++F+L W +IQSL   I
Sbjct  392  KMSSDGKPFCSSSIDLTQSTMVIQSPFRNRSTIIPDISSDPGIYTFNLTWPEIQSLTPAI  451

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP+  + +FRNP  KN G+ ++L +FL  A  +TS+ GVLI+VE   YL EK+GL V  
Sbjct  452  MNPYRSYNMFRNPNEKNSGRIISLSEFLHLANKSTSIYGVLISVEYVVYLREKQGLDVVK  511

Query  360  AVLLALNKADL----KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +        T KVMI S  SSVL+ F   SKYE VY ++E I DI +S I
Sbjct  512  AVLDTLTETGYSNGTSTTKVMIQSTHSSVLVDFKKKSKYETVYKVEETIRDISDSAI  568



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 113/178 (63%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S N+++GT   Q  F N + ++PE+     I+SF L W +I++L+  +
Sbjct  274  QMSSDGIPFCLNSSNLLEGTNVFQSPFINRSSTVPEIAPHAGIYSFSLRWSEIKTLRLAM  333

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ++P++  F LFRNP  K+  K + L DFL  A  ++S+ GVLI+VEN AYL  K+G+ V 
Sbjct  334  THPYSLGFNLFRNPREKSSEKIVPLYDFLILANKSSSLVGVLISVENVAYLRGKQGIDVV  393

Query  357  DAVLLALNKADL--KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
              VL A  +A     TK+VMI S++S VL+ F   S YE VY ++E + DI +S I E
Sbjct  394  KEVLYAFKEACCIDATKRVMIQSSNSPVLVDFKKQSPYEIVYQVEENVGDIVDSAIEE  451



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGI  CM SV+++D TT  +  F++   +I +LK    + +F+L W DI ++LQ  
Sbjct  394  QVTKDGILICMSSVDLMDVTTVGKSSFTSQVTTINDLKAGPGVFTFNLTWDDISKNLQPM  453

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP + ++L+RNP  KN G FM L DFLTF A    +SG++ITVE+AA++AEK G GV 
Sbjct  454  ISNPMSTYKLYRNPRNKNAGNFMRLSDFLTF-AKGKDLSGIMITVEHAAFMAEKLGFGVV  512

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       + VMI S +SSVL KF   +KY  VY I+E + D   S++ +
Sbjct  513  DAVVKALDDSGYSKQTAQNVMIQSTNSSVLKKFKQETKYSLVYMIEEGVRDAAPSSLAD  571



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  405  QMSNDGTPFCASSIDLGDSTMVAQTPFRNRQTTVSEISSDGGIYTFSLTWPEIQNLTPAI  464

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N G  + L  FL  A N+TS+S VLI+VEN  YL EK GL +  
Sbjct  465  SNPYRSYDMLRNPNERNSGNLILLSQFLDLAKNSTSLSSVLISVENVVYLREKLGLDLIK  524

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +        T KVMI S +SSVL+ F   SKY  VY I+E ISDI +S I
Sbjct  525  AVLDTLTETGYSNVNTTTKVMIQSTNSSVLLDFKKQSKYVTVYRIEETISDILDSAI  581



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 117/179 (65%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+++ D TT A  QFS+    I ++K    ++SF+L W DI ++L+ +
Sbjct  387  QVTKDGIPICMSSIDLGDVTTVANSQFSSQTSVIKDIKASPGVYSFNLTWDDISKNLKPK  446

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP + ++L+RNP   N G FM L DFL F A    +SG++I++E+AA++A+  G GV 
Sbjct  447  ISNPMSTYKLYRNPRNMNAGNFMRLSDFLDF-AKGKDLSGIMISIEHAAFMAQNLGFGVV  505

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            DAV  AL+ +      T++VMI S +SSVL+KF   +KY  VY I+E + D   S+I +
Sbjct  506  DAVTKALDDSGYSKQTTQQVMIQSTNSSVLVKFKQQTKYNLVYMIEENVRDAAPSSIAD  564



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 105/177 (59%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DG PFC  S+++ D T  AQ  F N   ++ E+ +   I++F L W +IQ+L   I
Sbjct  405  QMSNDGTPFCASSIDLGDSTMVAQTPFRNRQTTVSEISSDGGIYTFSLTWPEIQNLTPAI  464

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+  + + RNP  +N G  + L  FL  A N+TS+S VLI+VEN  YL EK GL +  
Sbjct  465  SNPYRSYDMLRNPNERNSGNLILLSQFLDLAKNSTSLSSVLISVENVVYLREKLGLDLIK  524

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +        T KVMI S +SSVL+ F   SKY  VY I+E ISDI +S I
Sbjct  525  AVLDTLTETGYSNVNTTTKVMIQSTNSSVLLDFKKQSKYVTVYRIEETISDILDSAI  581



>emb|CDY12599.1| BnaA02g12670D [Brassica napus]
Length=408

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 110/177 (62%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+++G PFC  S+++   T AAQ    N +  IPE+ +   I++F L W +I +L   I
Sbjct  75   QMSREGKPFCSNSIDLEKSTMAAQTPLRNRSTIIPEISSHAGIYTFSLTWPEIYNLTPAI  134

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+      RNP  ++ G+ M+L +FL  A N+TS+SG+LI+VENA YL EKKGL +  
Sbjct  135  SNPY------RNPNERDSGRIMSLFEFLNLAKNSTSLSGILISVENAVYLREKKGLDLAK  188

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       TK+VMI S +SSVL+     SKYE VY +++ I DI +S I
Sbjct  189  AVLDTLKEAGYSNGTTTKRVMIQSTNSSVLVDIKKQSKYETVYKVEKTIDDISDSAI  245



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 118/179 (66%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTA-AQQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+T+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W+DI ++L+  
Sbjct  402  QVTQDGTLICMSSINLIDVTTVTGSPFSSHSSVIPEIQDGPGIFTFNLTWEDISKNLKPT  461

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P  K+RL+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  462  ISSPEIKYRLYRNPRYKNAGNFMRLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  520

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            D V+ AL  +       ++VMI S+ SSVL+KF   +KY+ +Y + E I D   S+I++
Sbjct  521  DGVIKALKDSGYNNQTVQEVMIQSSYSSVLVKFKQQTKYKLLYVVDESIRDAAPSSIVD  579



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++++ TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  407  QMSSDGIPFCSSSIDLVNSTTVGQTHLRNRSIIVPEISSVAGIFTFSLTWHEIQSLTPAI  466

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF +  + RNP  +N G  ++L +FL  A N+TS+SG+LI++EN  YL EKKGL V  
Sbjct  467  SNPFRENGMSRNPNERNSGNLISLYEFLNLAKNSTSLSGILISLENVVYLREKKGLDVVK  526

Query  360  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L +    + T KVMI S    VL+ F N S Y+ VY IKE I +I +S I
Sbjct  527  VVLNRLTETGYIVGTLKVMIQSTTRLVLVDFKNQSTYKTVYKIKETIGNITDSAI  581



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 112/176 (64%), Gaps = 6/176 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DGIPFC+ S+++I+ T  AQ  FSN + +IP +K+ + I +FDL W+DI++L   +
Sbjct  398  QMSQDGIPFCLRSIDLIESTNVAQTIFSNRSKTIP-IKSGSGIFAFDLAWEDIKNLTPSM  456

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
             NP++ + LFRN     +GKF+ L DFL      TS+ G +I +ENA YLA +K L VTD
Sbjct  457  FNPYSNYHLFRNQEYNKQGKFLRLTDFLNLIKGQTSLLGAVIIIENADYLAREKNLSVTD  516

Query  360  AVLLALNKADLKTK---KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+  L KA    +    VMI S +SSVL+KF   + YE VY I E + D  +S I
Sbjct  517  AVIDTLRKAGYDKQGAPNVMIQSTNSSVLLKFKEKTNYELVYRIDEIVGDAVDSAI  572



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 107/175 (61%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++ + TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  386  QMSSDGIPFCASSIDLANSTTVNQTHLRNRSIFVPEISSAAGIFTFSLTWHEIQSLTPAI  445

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF  + + RNP   N G  ++L +FL  A N++S+SGVLI++EN  YL EK+GL V  
Sbjct  446  SNPFRLYSMSRNPNEGNSGNLISLYEFLNLAKNSSSLSGVLISLENVIYLREKQGLDVVK  505

Query  360  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L +      T KVMI S  S VL+ F N SKYE VY I+E I +I +S I
Sbjct  506  VVLNRLTETGYIFGTLKVMIQSTTSLVLVDFKNQSKYETVYKIEETIGNIPDSAI  560



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 4/175 (2%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC  S+++++ TT  Q    N ++ +PE+ +   I +F L W +IQSL   I
Sbjct  405  QMSSDGIPFCSSSIDLVNSTTVGQTHLRNRSIIVPEISSVAGIFTFSLTWHEIQSLTPAI  464

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNPF +  + RNP  +N G  ++L +FL  A N+TS+SG+LI++EN  YL EKKGL V  
Sbjct  465  SNPFRENGMSRNPNERNSGNLISLYEFLNLAKNSTSLSGILISLENVVYLREKKGLDVVK  524

Query  360  AVLLALNKAD--LKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
             VL  L +    + T KVMI S    VL+ F N S Y+ VY IKE I +I +S I
Sbjct  525  VVLNRLTETGYIVGTLKVMIQSTTRLVLVDFKNQSTYKTVYKIKETIGNITDSAI  579



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 7/178 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM++DG PFC  S+N+ D TT AQ  F N + ++PE+ +   I++F L W +IQ L   I
Sbjct  393  QMSRDGKPFCSSSINLGDSTTVAQTPFRNRSATVPEISSVEGIYTFSLTWPEIQGLTPAI  452

Query  180  SNPFAK-FRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            SNPF + + + RNP  KN GK ++L +FL+ A N+TS+SGVLI+VE AAYL EK+GL V 
Sbjct  453  SNPFREAYNMLRNPNEKNSGKLLSLSEFLSLAKNSTSLSGVLISVEYAAYLREKQGLDVV  512

Query  357  DAVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
             AVL  L +        TK VMI S +SSVL+ F   S+Y+ VY ++E I DI +  I
Sbjct  513  KAVLDTLTETGYSNSTITKMVMIQSTNSSVLVDFKKQSQYKTVYKVEEMIRDILDPAI  570



>gb|KJB54927.1| hypothetical protein B456_009G054700 [Gossypium raimondii]
Length=771

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 109/168 (65%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC+ S ++   TTA   F   AVSIPE++ +  I SFDL W +IQSL+ ++ 
Sbjct  409  QMSKDGVAFCLDSPDLARDTTAMSTFLTRAVSIPEIQKEKGIFSFDLTWTEIQSLKPKMY  468

Query  183  NPFAKFR-LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF +   L RNP AKN+GK ++L DFL FA   T   GVLI++ENA YLA K  L V D
Sbjct  469  SPFEQNSGLERNPEAKNKGKLISLGDFLGFA--KTKPVGVLISIENARYLASKMHLDVVD  526

Query  360  AVLLALNKADLKTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDI  500
            AV   L  A L+ K+VMI S+DS+VL KF   S Y+R+    EEIS +
Sbjct  527  AVTKTLKNASLEKKQVMIQSDDSAVLSKFKGESGYKRLLRF-EEISGV  573



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            QMT+DG   CM S+N+ID TT     FS+    IPE++    I +F+L W++I ++L++ 
Sbjct  291  QMTQDGTLVCMSSLNLIDVTTVTTSPFSSRFSVIPEIQGVPGIFAFNLTWEEISKNLKST  350

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P   ++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  351  ISSPDVDYQLYRNPRYKNAGNFMKLSDFLDFAKD-KALSGVLISIENAAFLAEKLGYSVT  409

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
            D V+ AL  +       ++VMI S++SSVL+KF   +KY+ VY I E ISD   S+I
Sbjct  410  DGVIKALKDSGYDNQTVQEVMIQSSNSSVLVKFRQQTKYQLVYMIDESISDAAPSSI  466



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 116/178 (65%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+ DG+ FC+ + ++  GT A  QF   + +IPEL+ +  + SF L+W DI+SL+ Q+ 
Sbjct  399  QMSSDGVAFCLDTPDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWSDIKSLKPQMQ  458

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K ++ RNP  K+ GK +TL++FL F A   +V+G+LI +E AAYLA K GL V  
Sbjct  459  SPYGTKEKIVRNPANKHAGKLVTLNEFLEF-AKKNAVTGILINIEYAAYLASKAGLDVVG  517

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL+ A      T++V+I S+D+SVL KF ++K Y+RV  IKE+ISD    ++ E
Sbjct  518  TVSSALSNATFDKQSTQQVLIESDDTSVLAKFKDTKNYKRVLNIKEKISDATKESVAE  575



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 106/178 (60%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDGI FC  S ++   T A   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388  QMSKDGIAFCHDSADITATTNAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF+    F RNP  KN GKFMTL DFL F   A +V+G      NAAYLA KKGLG+ D
Sbjct  448  SPFSTSGGFQRNPANKNAGKFMTLVDFLEF-GKAKAVTG------NAAYLASKKGLGIVD  500

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV  AL  + L    T+ V+I S+DSSVL  F     Y RV  I +EI D    ++ E
Sbjct  501  AVKSALTNSTLDKQSTQNVLIQSDDSSVLSSFEAVPPYTRVLSIDKEIGDAPKPSVDE  558



>ref|XP_004143578.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cucumis sativus]
 gb|KGN48806.1| hypothetical protein Csa_6G501950 [Cucumis sativus]
Length=760

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++KDG+PFCM   +++ GTT    FS    SIPE++ +  I SFDL W +I +L+ QIS
Sbjct  391  QLSKDGVPFCMEMADLLTGTTVITAFSAKTTSIPEVQAEPGIFSFDLTWAEILTLKPQIS  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NPF A   L RNP  KN+GKFMTL +FL F + A +VSG++I ++NAAYLA +KGL +  
Sbjct  451  NPFMASSGLARNPAFKNKGKFMTLPEFLEF-SKAKAVSGIMINIQNAAYLASRKGLDMVG  509

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSKYE---RVYGIKEEISDIQNSTILE  521
             V  AL  A      T++V I S+D+SVL  F  +KY    RV  +  +I D     + E
Sbjct  510  TVATALVNATFDKQSTQQVFIRSDDTSVLSVF-KTKYPNFIRVLTVDSKIGDAPKEALEE  568



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 115/178 (65%), Gaps = 5/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+ DGIPFC+ S N+++GT   Q  F N + ++PE+     ++SF L W +I++L+  +
Sbjct  359  QMSSDGIPFCLNSSNLLEGTNVFQSPFINRSSTVPEIAPHAGLYSFSLRWTEIKTLRLAM  418

Query  180  SNPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ++P++  F LFRNP  K+  K ++L DFL  A  ++S+ GVLI+VEN AYL EK+G+ V 
Sbjct  419  THPYSLGFNLFRNPREKSSEKIVSLYDFLILANKSSSLVGVLISVENVAYLREKQGIDVV  478

Query  357  DAVLLALNKADL--KTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
              VL A  +A     TK+VMI S+++ VL+ F   S YE VY +++ + DI +S I E
Sbjct  479  KEVLYAFKEAYYINATKRVMIQSSNNPVLVDFKKQSPYEIVYQVEKNVGDIVDSAIEE  536



>gb|KDP38642.1| hypothetical protein JCGZ_03995 [Jatropha curcas]
Length=760

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 110/178 (62%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++ DG  FCM S ++   T A   F + + ++PE+K    I +FDL W +IQ+LQ ++S
Sbjct  389  QLSSDGTAFCMDSADVSVETNAMSNFMSRSSTVPEIKESAGIFTFDLTWAEIQTLQPRLS  448

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+    L  RNP  K  GKF+ L +FL F A A + +G+LI +ENA YLA KKGL +  
Sbjct  449  SPYGNDNLLPRNPAYKTAGKFLKLAEFLEF-AKAKAPTGILINIENAPYLASKKGLDIVS  507

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
            AV  AL KA      T+KV+I S+D+SVL KF   K Y+RV  +KEEISD    ++ E
Sbjct  508  AVSSALEKASFDKQSTQKVLIQSDDTSVLSKFKKIKAYQRVLHLKEEISDAPKKSVAE  565



>ref|XP_004160165.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cucumis sativus]
Length=760

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 9/180 (5%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++KDG+PFCM   +++ GTT    FS    SIPE++ +  I SFDL W +I +L+ QIS
Sbjct  391  QLSKDGVPFCMEMADLLTGTTVITAFSAKTTSIPEVQAEPGIFSFDLTWAEILTLKPQIS  450

Query  183  NPF-AKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            NPF A   L RNP  KN+GKFMTL +FL F + A +VSG++I ++NAAYLA +KGL +  
Sbjct  451  NPFMASSGLARNPAFKNKGKFMTLPEFLEF-SKAKAVSGIMINIQNAAYLASRKGLDMVG  509

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSKYE---RVYGIKEEISDIQNSTILE  521
             V  AL  A      T++V I S+D+SVL  F  +KY    RV  +  +I D     + E
Sbjct  510  TVAAALVNATFDKQSTQQVFIRSDDTSVLSIF-KTKYPNFIRVLTVDSKIGDAPKEALEE  568



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            QMT+DG   CM S+N+ID TT     FS+    IPE++    I +F+L W++I ++L++ 
Sbjct  403  QMTQDGTLVCMSSLNLIDVTTVTTSPFSSRFSVIPEIQGVPGIFAFNLTWEEISKNLKST  462

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P   ++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  463  ISSPDVDYQLYRNPRYKNAGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  521

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
            D V+ AL  +       ++VMI S++SSVL+KF   +KY+ VY I E ISD   S+I
Sbjct  522  DGVIKALKDSGYDNQTVQEVMIQSSNSSVLVKFRQQTKYQLVYMIDESISDAAPSSI  578



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 7/176 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT+DG+  C+GS+N++DGT   Q  F++ + +I +++    I +F+L W++I++L+  I
Sbjct  393  QMTQDGVSICLGSINLMDGTNVVQTDFNSRSTTIRQIQPIPGIFTFNLTWEEIKTLKPVI  452

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP   F L+RNP  K  G   +L DFL FA +      VLI++ENAAYLAE  GL VT+
Sbjct  453  SNPSRDFALYRNPAYKYAGSIFSLKDFLAFAKDKP--LSVLISIENAAYLAESLGLSVTN  510

Query  360  AVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            AV+ ALN++       +KVMI S++ SVL+KF   + Y+ VY I E+I D  +S+I
Sbjct  511  AVIDALNQSGYNNQTNQKVMIQSSNRSVLIKFKEKTNYQLVYKIDEDIRDADDSSI  566



>emb|CDP10204.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            Q++KDG  FC+ S ++I  TTAA  F + +  IPE++ +N I SFDL W +IQSL+ Q++
Sbjct  404  QLSKDGTAFCLPSADLIGTTTAASLFMDRSTRIPEIQDKNGIFSFDLTWTEIQSLKPQLA  463

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            + F    L RN   KN GKF+TL++FL   A   +V+GVLI +ENAAYLA  KGL +  A
Sbjct  464  SVFDG-PLARNLANKNAGKFVTLNEFLDL-AKKRAVTGVLINIENAAYLASNKGLDIVGA  521

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
            V  AL+ A +    T+KV+I S+DSSVL KF + K Y+RV  I ++IS     T  E
Sbjct  522  VTTALSNATMDKQSTQKVLIQSDDSSVLSKFQDIKTYQRVLAIDKDISGSTQETAQE  578



>gb|EMT03737.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Aegilops 
tauschii]
Length=1215

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 118/177 (67%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            +M+KDG+ FC+GS ++I  TTAA  F    V+I E++ ++ I SFDL+W +IQ+L+ +++
Sbjct  444  RMSKDGVAFCLGSADLIASTTAATTFMTKVVTISEIQNKSGIFSFDLSWSEIQTLKPELT  503

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
             PFA+  L RNP AKN GKF TL +FL F A +++VSG+LI +E+A YLA  +GLG+ DA
Sbjct  504  GPFAQAGLKRNPAAKNAGKFFTLPEFLHF-AKSSNVSGILIEIEDAPYLA-TRGLGLVDA  561

Query  363  VLLALNKA--DLKTK-KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  A  D ++K +V I S+DSSVL  F     ++RV  +   ISD    ++ E
Sbjct  562  VSGALVNASYDKESKQQVFIESDDSSVLSAFKKFPSFKRVLTVGTIISDASKPSVDE  618



>ref|XP_010315562.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Solanum lycopersicum]
Length=721

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 117/179 (65%), Gaps = 10/179 (6%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ SV++I  TTA+  F + +  +  L++   I SFD  W++IQSL+ Q+ 
Sbjct  382  QMTKDGVAFCLPSVDLISTTTASGPFMSRSTKVEALQSSMGIFSFDFTWEEIQSLKPQM-  440

Query  183  NPFAKF--RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
              F++F   L R+P  KN GKF+TL DFL F A A +VSGVLI +ENAA+LA  K L + 
Sbjct  441  --FSEFNGELARDPARKNMGKFVTLSDFLEF-AKAKAVSGVLINIENAAFLATNKDLDIV  497

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             AV  AL+ A L    T+KV+I S +SSVL KF + S Y++V  IK+++  + N T LE
Sbjct  498  GAVTTALSNATLDKQSTQKVLIMSGESSVLDKFKDISTYQKVLHIKKKVEFVTNETALE  556



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+N++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  388  QLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I+VE+AA++AE+ G  + 
Sbjct  448  ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KDLSGIMISVEHAAFVAEELGFDMV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            D+V+  L+ A       +KVMI S++SSVL+KF   +KY+ VY I EE+ D   S++
Sbjct  507  DSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFKQQTKYDLVYMINEEVKDAAPSSL  563



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CM S+N++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  388  QLTKDGIPICMSSINLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I+VE+AA++AE+ G  + 
Sbjct  448  ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KDLSGIMISVEHAAFVAEELGFDMV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            D+V+  L+ A       +KVMI S++SSVL+KF   +KY+ VY I EE+ D   S++
Sbjct  507  DSVIKTLDAAGYSNQTAQKVMIQSSNSSVLVKFKQQTKYDLVYMINEEVKDAAPSSL  563



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDGI FC  S +++  TTA   F +   S+PE++  + I SFDL W +IQSL+  + 
Sbjct  389  QMTKDGIAFCSESPDLMAYTTAMTTFMSRTSSVPEIQQHSGIFSFDLTWSEIQSLKPDLR  448

Query  183  NPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTDA  362
            +P     L RNP  KN+GKF+TL +FL F A A +V G++I +ENA YLA  KG  + D 
Sbjct  449  SPVPSVSLPRNPANKNKGKFLTLPEFLDF-AKAKAVPGIMIDIENAPYLA-SKGFDIVDI  506

Query  363  VLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            V  AL  A     +T+ VMI S+DS+VL KF +   Y++V+ I E IS +   T+ E
Sbjct  507  VASALRNASFDKQETQVVMIQSDDSAVLSKFKDVPSYQKVFHIYEIISSVPKETVEE  563



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CMGS+N++D TT A+  F++ A  + ++++   + +F+L W DI ++L+ +
Sbjct  388  QVTKDGIPVCMGSINLMDSTTVAKSPFASQAAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LAE+ G  + 
Sbjct  448  ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAEELGFDMV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTI  515
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++
Sbjct  507  DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQETKYDLVYMINEDVSDAAPSSL  563



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGI  CM SV++++ TT A+ QF++   +I +LK    + +F+L W DI ++L+  
Sbjct  395  QVTKDGILICMSSVDLMNATTVAKSQFASQVTTINDLKAGPGVFTFNLTWDDISKNLKPM  454

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            ISNP   F  +RNP  KN G FM L DFLTF A    +SG++ITVE+AA++AE+ G GV 
Sbjct  455  ISNPAIGFNQYRNPRNKNAGNFMRLSDFLTF-AKGKDLSGIMITVEHAAFMAEELGFGVV  513

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       + VMI S +SSVL+KF   +KY  VY I+E + D   S++ +
Sbjct  514  DAVIKALDDSGYSKQTAQSVMIQSTNSSVLVKFKQETKYNLVYMIEENVRDAAPSSLAD  572



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP C+ SVN++D TT A+ QF++    I ++++   + +F+L W DI ++L+ +
Sbjct  389  QLTKDGIPICISSVNLMDDTTVAKSQFASQTAVIKDIESVLGVFTFNLTWDDIVKNLRPK  448

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS PF+ F+L RNP  +N G FM L DFL F  +   +SG++I VE+AA+ AEK G  + 
Sbjct  449  ISTPFSSFKLDRNPRYRNAGNFMRLSDFLDFTKD-KELSGIMINVEHAAFAAEKLGFDMV  507

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            DAV+  L+ A       +KVMI S +SSVL+KF   +KY+ VY + EE+ D + S++
Sbjct  508  DAVIKTLDAAGYSNQTAQKVMIQSANSSVLVKFKQQTKYDLVYMVNEEVKDAEPSSL  564



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 115/177 (65%), Gaps = 6/177 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QMT+DG+P C+GS+N++D T   Q  F +   +I +++    I +F+L W +I++L+  I
Sbjct  394  QMTQDGVPICLGSINLMDNTNVIQTNFLSRLTTIQQIQPNPGIFTFNLTWDEIKTLKPSI  453

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +NPF    L+RNP  K  G   +L+DFL FA        VLI++ENA YLA+  GL +TD
Sbjct  454  ANPFIGSYLYRNPAYKYTGNIFSLEDFLAFAKGKP--LSVLISIENATYLAKSLGLSITD  511

Query  360  AVLLALNKADL-KTK-KVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV+ ALN +   +TK KVMI S++SSVL+KF   + Y+ VY + E+I D  +S+I++
Sbjct  512  AVIDALNHSGYNQTKQKVMIQSSNSSVLIKFKEKTNYQLVYKVDEDIRDADDSSIMD  568



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            QMT+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W++I ++L+  
Sbjct  366  QMTQDGTLICMSSINLIDVTTVTTSPFSSRSSVIPEIQGGPGIFTFNLTWEEISKNLKPT  425

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P  +++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  426  ISSPEVEYQLYRNPRYKNGGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  484

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
            D V+ AL  +       ++V I S++SSVL+KF   +KY+ +Y + E ISD   S+I
Sbjct  485  DGVIKALKDSGYSNQTVQEVTIQSSNSSVLVKFRQQTKYKLLYMVDESISDAAPSSI  541



>ref|XP_011460616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 113/178 (63%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+ DG+ FC+ S+++  GT A  QF   + ++PEL+++  + S  L W++IQSL+ ++ 
Sbjct  402  QMSSDGVAFCLDSIDLNSGTNALTQFMTRSETVPELQSETGVFSPRLTWEEIQSLKPELK  461

Query  183  NPFAKFR-LFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF   + L+RNP  K+ GK +TL +FL  A N  + +G+LI + NA YLA K GL +  
Sbjct  462  SPFGNNQGLYRNPANKDAGKLVTLTEFLELAKNK-ATTGILINIRNAPYLASKAGLDIVG  520

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL  A L    T+K+MI S+D+SVL KF + K YERV+ I+E+I  I   ++ E
Sbjct  521  TVTSALKNATLDQQSTQKIMIKSDDTSVLSKFADVKTYERVFSIEEKIGSIPKESLEE  578



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            QMT+DG   CM S+N+ID TT     FS+ +  IPE++    I +F+L W++I ++L+  
Sbjct  401  QMTQDGTLICMSSINLIDVTTVTTSPFSSRSSVIPEIQGGPGIFTFNLTWEEISKNLKPT  460

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P  +++L+RNP  KN G FM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  461  ISSPEVEYQLYRNPRYKNGGNFMKLSDFLDFAKDK-ALSGVLISIENAAFLAEKLGYSVT  519

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKFT-NSKYERVYGIKEEISDIQNSTI  515
            D V+ AL  +       ++V I S++SSVL+KF   +KY+ +Y + E ISD   S+I
Sbjct  520  DGVIKALKDSGYSNQTVQEVTIQSSNSSVLVKFRQQTKYKLLYMVDESISDAAPSSI  576



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 115/178 (65%), Gaps = 6/178 (3%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+ DG+ FC+ + ++  GT A  QF   + +IPEL+ +  + SF L+W DI+SL+ Q+ 
Sbjct  399  QMSSDGVAFCLDTPDLNSGTNALSQFMTKSETIPELQAEAGVFSFQLSWSDIKSLKPQMQ  458

Query  183  NPFA-KFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +P+  K ++ RNP  K+ GK +TL++FL F A   +V+G+LI +E AAYLA K GL V  
Sbjct  459  SPYGTKEKIVRNPANKDAGKLVTLNEFLEF-AKKNAVTGILINIEYAAYLASKAGLDVVG  517

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTNSK-YERVYGIKEEISDIQNSTILE  521
             V  AL+ A      T++V+I S+D+SVL KF ++K Y+RV  IKE+IS     ++ E
Sbjct  518  TVSSALSNATFDKQSTQQVLIESDDTSVLAKFKDAKNYKRVLNIKEKISXATKESVAE  575



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 108/178 (61%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QM+KDG+ FC  S ++   TTA   F + A S+PE++  N I SFDL W +IQSL+ QI 
Sbjct  388  QMSKDGMAFCHDSADLTATTTAMTTFMSRATSVPEIQPTNGIFSFDLTWAEIQSLKPQIQ  447

Query  183  NPFAKFRLF-RNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            +PF+    F RNP  KN GKFMTL DFL F   A +V+G      NAAYLA KKGLG+ D
Sbjct  448  SPFSTSGGFQRNPANKNAGKFMTLVDFLEF-GKAKAVTG------NAAYLASKKGLGIVD  500

Query  360  AVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
            AV   L  + L    T+KV+I S+DSSVL  F     Y RV  I++EI D    ++ E
Sbjct  501  AVKSGLTNSTLDKQSTQKVLIQSDDSSVLSSFEAVPPYTRVLSIEKEIGDAPKPSVDE  558



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 121/179 (68%), Gaps = 7/179 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W+DI ++L+ +
Sbjct  389  QITKDGIPVCMGSINLMDGTTVAKSPFASQIAVMKDIQSVLGVFTFNLTWEDIVKNLKPK  448

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LAE+ G  + 
Sbjct  449  ISTPLSTFALDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAEELGFDMV  507

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTILE  521
            DAV+ AL+ +       +K+MI S +SSVL+KF   +KY+ VY I E++ D   S++ +
Sbjct  508  DAVIKALDASGYNKQTAQKIMIQSTNSSVLVKFKQQTKYDLVYMINEDVRDAAPSSLAD  566



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAA-QQFSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+T+DG   CM S+N+ID TT     FS+L+  IPE++    I + +L W+DI ++L+  
Sbjct  402  QVTQDGTLICMSSINLIDVTTVTTSPFSSLSSVIPEIQDGPGIFTLNLTWEDISKNLKPT  461

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS+P  K++L RNP  KN GKFM L DFL FA +  ++SGVLI++ENAA+LAEK G  VT
Sbjct  462  ISSPEIKYQLHRNPRYKNAGKFMRLSDFLDFAKD-KALSGVLISIENAAFLAEKLGYSVT  520

Query  357  DAVLLALNKA---DLKTKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            D V+ AL  +   +   ++VMI S++SSVL+KF   +KY+ VY + E I     S++
Sbjct  521  DGVIKALKDSAYNNQTVQEVMIQSSNSSVLVKFKEQTKYKLVYMVDESIRAAAPSSV  577



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W DI ++L+ +
Sbjct  388  QVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LA + G  + 
Sbjct  448  ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAAELGFDMV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++
Sbjct  507  DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSSL  563



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQ-FSNLAVSIPELKTQNAIHSFDLNWKDI-QSLQAQ  176
            Q+TKDGIP CMGS+N++DGTT A+  F++    + ++++   + +F+L W DI ++L+ +
Sbjct  388  QVTKDGIPVCMGSINLMDGTTVAKSPFASQTAVMKDIESVLGVFTFNLTWDDIVKNLKPK  447

Query  177  ISNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
            IS P + F L RNP  +N G FM L DFL F+ +   +SG++I++E+AA+LA + G  + 
Sbjct  448  ISTPLSTFSLDRNPRYRNAGNFMRLSDFLDFSKD-KDLSGIMISIEHAAFLAAELGFDMV  506

Query  357  DAVLLALNKADLK---TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            DAV+ AL+ +       +KVMI S +SSVL+KF   +KY+ VY I E++SD   S++
Sbjct  507  DAVIKALDDSGYNKQTAQKVMIQSTNSSVLVKFKQQTKYDLVYMINEDVSDAAPSSL  563



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 110/177 (62%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQ-QFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQI  179
            QM+++G PFC  S+++   T AAQ    N +  IPE+ +   I++F L W +I +L   I
Sbjct  390  QMSREGKPFCSNSIDLEKSTMAAQTPLRNRSTIIPEISSHAGIYTFSLTWPEIYNLTPAI  449

Query  180  SNPFAKFRLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVTD  359
            SNP+      RNP  ++ G+ M+L +FL  A N+TS+SG+LI+VENA YL EKKGL +  
Sbjct  450  SNPY------RNPNERDSGRIMSLFEFLNLAKNSTSLSGILISVENAVYLREKKGLDLAK  503

Query  360  AVLLALNKADLK----TKKVMIHSNDSSVLMKF-TNSKYERVYGIKEEISDIQNSTI  515
            AVL  L +A       TK+VMI S +SSVL+     SKYE VY +++ I DI +S I
Sbjct  504  AVLDTLTEAGYSNGTTTKRVMIQSRNSSVLVDIKKQSKYETVYKVEKTIDDISDSAI  560



>ref|XP_006340583.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Solanum tuberosum]
Length=747

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 115/179 (64%), Gaps = 10/179 (6%)
 Frame = +3

Query  3    QMTKDGIPFCMGSVNMIDGTTAAQQFSNLAVSIPELKTQNAIHSFDLNWKDIQSLQAQIS  182
            QMTKDG+ FC+ SV++I  TTA+  F + A  +  L++   I SFD  W++IQSL+ Q+ 
Sbjct  408  QMTKDGVAFCLPSVDLISTTTASGPFMSRATKVEALQSSMGIFSFDFTWEEIQSLKPQM-  466

Query  183  NPFAKF--RLFRNPVAKNEGKFMTLDDFLTFAANATSVSGVLITVENAAYLAEKKGLGVT  356
              F++F   L R+P  KN GKF+TL DFL F A   +V GVLI +ENAA+LA  K L + 
Sbjct  467  --FSEFNGELARDPARKNMGKFVTLSDFLEF-AKGKAVPGVLINIENAAFLAANKDLDIV  523

Query  357  DAVLLALNKADL---KTKKVMIHSNDSSVLMKFTN-SKYERVYGIKEEISDIQNSTILE  521
             AV +AL+ A L    T+KV+I S +SSVL KF +   Y++V  IK+++  + N T LE
Sbjct  524  GAVTIALSNATLDKQSTQKVLIMSGESSVLDKFKDIPTYQKVLHIKKKVEFVTNETALE  582



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800