BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031M14

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    172   9e-48   Nicotiana tomentosiformis
ref|XP_011086756.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    172   1e-47   Sesamum indicum [beniseed]
ref|XP_009785204.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    171   3e-47   Nicotiana sylvestris
ref|XP_011086755.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    170   8e-47   Sesamum indicum [beniseed]
ref|NP_001275120.1|  NADH dehydrogenase [ubiquinone] flavoprotein...    169   2e-46   Solanum tuberosum [potatoes]
ref|XP_004232268.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    167   1e-45   Solanum lycopersicum
gb|KJB50332.1|  hypothetical protein B456_008G164400                    166   3e-45   Gossypium raimondii
emb|CBI21762.3|  unnamed protein product                                162   6e-45   Vitis vinifera
gb|KJB50333.1|  hypothetical protein B456_008G164400                    163   3e-44   Gossypium raimondii
ref|XP_009770074.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    162   7e-44   Nicotiana sylvestris
ref|XP_010644983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    162   7e-44   Vitis vinifera
ref|XP_002266661.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    162   1e-43   Vitis vinifera
ref|XP_009609277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    162   1e-43   Nicotiana tomentosiformis
gb|KJB08870.1|  hypothetical protein B456_001G109800                    160   3e-43   Gossypium raimondii
emb|CAN73193.1|  hypothetical protein VITISV_022287                     160   6e-43   Vitis vinifera
ref|XP_004310055.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    157   4e-42   Fragaria vesca subsp. vesca
ref|XP_008222059.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    155   2e-41   Prunus mume [ume]
emb|CDP13320.1|  unnamed protein product                                155   5e-41   Coffea canephora [robusta coffee]
ref|XP_008360129.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    154   9e-41   Malus domestica [apple tree]
ref|XP_002315622.1|  hypothetical protein POPTR_0010s06750g             153   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007045030.1|  51 kDa subunit of complex I                        153   2e-40   Theobroma cacao [chocolate]
ref|XP_011041538.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    153   2e-40   Populus euphratica
gb|KDP26775.1|  hypothetical protein JCGZ_17933                         152   3e-40   Jatropha curcas
gb|EYU42106.1|  hypothetical protein MIMGU_mgv1a005364mg                152   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_010248930.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    152   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008340188.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    152   5e-40   
ref|XP_008340187.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    152   7e-40   
ref|XP_010682836.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    151   8e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006484064.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    150   2e-39   Citrus sinensis [apfelsine]
ref|XP_004497858.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    150   2e-39   
ref|XP_002514955.1|  NADH-ubiquinone oxidoreductase flavoprotein,...    150   3e-39   Ricinus communis
ref|XP_009372324.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    149   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_011071205.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    149   4e-39   Sesamum indicum [beniseed]
ref|XP_010547695.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    149   6e-39   
gb|AES60212.2|  NADH-ubiquinone oxidoreductase 51 kDa subunit           148   9e-39   Medicago truncatula
ref|XP_004497859.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    148   1e-38   Cicer arietinum [garbanzo]
ref|XP_003589961.1|  NADH-quinone oxidoreductase subunit F              147   3e-38   
ref|XP_003535239.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    146   6e-38   Glycine max [soybeans]
ref|XP_007145867.1|  hypothetical protein PHAVU_007G274700g             145   9e-38   Phaseolus vulgaris [French bean]
ref|XP_006574505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    145   1e-37   Glycine max [soybeans]
gb|EPS65614.1|  hypothetical protein M569_09162                         145   2e-37   Genlisea aurea
ref|XP_009122464.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    144   2e-37   Brassica rapa
ref|XP_006399353.1|  hypothetical protein EUTSA_v10013394mg             144   3e-37   Eutrema salsugineum [saltwater cress]
ref|XP_006287433.1|  hypothetical protein CARUB_v10000637mg             144   5e-37   
gb|AAM65274.1|  NADH dehydrogenase                                      144   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196470.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        143   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423066.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    143   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010459420.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    143   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010452860.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    143   6e-37   
ref|XP_008443176.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    143   7e-37   Cucumis melo [Oriental melon]
ref|XP_007222426.1|  hypothetical protein PRUPE_ppa004904mg             142   2e-36   Prunus persica
ref|XP_010491494.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    141   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010546277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    140   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_009131078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    140   1e-35   Brassica rapa
ref|XP_002873369.1|  hypothetical protein ARALYDRAFT_487692             139   1e-35   
gb|KGN59382.1|  hypothetical protein Csa_3G815460                       139   2e-35   Cucumis sativus [cucumbers]
gb|AHA84169.1|  NADH-quinone oxidoreductase subunit F                   138   4e-35   Phaseolus vulgaris [French bean]
gb|ADN33976.1|  NADH-ubiquinone oxidoreductase flavoprotein             134   1e-33   Cucumis melo subsp. melo
ref|XP_009403957.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    131   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    130   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004136606.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    129   4e-32   
ref|XP_010911159.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    129   6e-32   Elaeis guineensis
ref|XP_009407142.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    129   1e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010025340.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    128   1e-31   Eucalyptus grandis [rose gum]
ref|NP_001148767.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit      127   3e-31   Zea mays [maize]
gb|ACL53142.1|  unknown                                                 127   3e-31   Zea mays [maize]
ref|XP_003557368.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    127   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_006827286.1|  hypothetical protein AMTR_s00010p00264240          127   4e-31   Amborella trichopoda
ref|XP_008799963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    126   5e-31   
ref|XP_006658044.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    127   5e-31   Oryza brachyantha
ref|XP_008799961.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    127   5e-31   Phoenix dactylifera
ref|XP_008799962.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    127   5e-31   
ref|XP_008799960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    127   6e-31   Phoenix dactylifera
gb|EMS64088.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...    126   7e-31   Triticum urartu
gb|EMT32185.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, m...    126   7e-31   
ref|XP_010025338.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    126   8e-31   Eucalyptus grandis [rose gum]
ref|NP_001141093.1|  uncharacterized protein LOC100273176               126   8e-31   Zea mays [maize]
gb|ACF84291.1|  unknown                                                 126   8e-31   Zea mays [maize]
ref|XP_004958515.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...    126   9e-31   Setaria italica
dbj|BAJ94094.1|  predicted protein                                      122   1e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006838360.1|  hypothetical protein AMTR_s00002p00015430          122   2e-29   Amborella trichopoda
dbj|BAG89406.1|  unnamed protein product                                121   3e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ40868.1|  hypothetical protein OsJ_25349                          122   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060455.1|  Os07g0645400                                       121   5e-29   
gb|EAZ04909.1|  hypothetical protein OsI_27090                          121   6e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006438083.1|  hypothetical protein CICLE_v10033600mg             120   8e-29   
ref|XP_001754412.1|  predicted protein                                  115   7e-27   
ref|XP_002977599.1|  hypothetical protein SELMODRAFT_443575             112   7e-26   Selaginella moellendorffii
gb|ACE96388.1|  esterase/lipase/thioesterase                            111   1e-25   Populus tremula [European aspen]
gb|ACE96363.1|  esterase/lipase/thioesterase                            111   1e-25   Populus tremula [European aspen]
gb|ACE96365.1|  esterase/lipase/thioesterase                            111   1e-25   Populus tremula [European aspen]
gb|ACE96369.1|  esterase/lipase/thioesterase                            111   1e-25   Populus tremula [European aspen]
ref|XP_001778863.1|  predicted protein                                  110   2e-25   
ref|XP_002975195.1|  hypothetical protein SELMODRAFT_150347             108   2e-24   
gb|KIY99198.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1          102   3e-22   Monoraphidium neglectum
ref|XP_011398745.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  99.8    3e-21   Auxenochlorella protothecoides
gb|KDD75042.1|  respiratory-chain NADH dehydrogenase                  99.0    4e-21   Helicosporidium sp. ATCC 50920
gb|KFB35861.1|  hypothetical protein ZHAS_00002799                    99.8    1e-20   Anopheles sinensis
ref|XP_005846008.1|  NADH:ubiquinone oxidoreductase 51 kD subunit     97.4    1e-20   Chlorella variabilis
ref|XP_003058710.1|  predicted protein                                97.1    3e-20   Micromonas pusilla CCMP1545
ref|XP_005650585.1|  NADH-ubiquinone oxidoreductase                   95.1    1e-19   Coccomyxa subellipsoidea C-169
gb|KHJ94492.1|  NADH oxidoreductase, F subunit                        95.1    2e-19   Oesophagostomum dentatum [nodule worm]
ref|XP_002503039.1|  predicted protein                                93.2    4e-19   Micromonas commoda
ref|XP_007514630.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit    93.2    8e-19   Bathycoccus prasinos
ref|XP_005534915.1|  NADH dehydrogenase I flavoprotein 51kDa subunit  92.4    1e-18   Cyanidioschyzon merolae strain 10D
emb|CBI40696.3|  unnamed protein product                              86.7    1e-18   Vitis vinifera
gb|ETN67150.1|  NADH-ubiquinone oxidoreductase flavoprotein 1 (nd...  92.0    2e-18   Anopheles darlingi [American malaria mosquito]
gb|EIE75829.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        91.7    2e-18   Rhizopus delemar RA 99-880
gb|EIE91504.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        91.7    2e-18   Rhizopus delemar RA 99-880
ref|XP_001847747.1|  NADH dehydrogenase flavoprotein 1, mitochond...  91.7    2e-18   Culex quinquefasciatus
gb|ETN68323.1|  NADH oxidoreductase, F subunit                        91.7    2e-18   Necator americanus
emb|CEF69460.1|  NADH dehydrogenase (Ubiquinone) flavoprotein 1       91.7    3e-18   Strongyloides ratti
tpg|DAA34498.1|  TPA: NADH dehydrogenase I subunit F                  86.3    4e-18   Amblyomma variegatum
ref|XP_007439249.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  90.5    5e-18   Python bivittatus
ref|XP_009012163.1|  hypothetical protein HELRODRAFT_104983           89.7    6e-18   Helobdella robusta
ref|XP_319184.4|  AGAP010039-PA                                       90.1    7e-18   Anopheles gambiae str. PEST
emb|CDJ87526.1|  unnamed protein product                              90.5    8e-18   Haemonchus contortus [red stomach worm]
gb|ABF18316.1|  mitochondrial NADH:ubiquinone oxidoreductase NDUF...  90.1    8e-18   Aedes aegypti
ref|XP_001658587.1|  AAEL007681-PA                                    90.1    9e-18   
emb|CEI93034.1|  Putative NADH dehydrogenase [ubiquinone] flavopr...  88.2    9e-18   Rhizopus microsporus
gb|EKC98180.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         90.1    1e-17   Trichosporon asahii var. asahii CBS 8904
ref|XP_002014219.1|  GL19080                                          89.7    1e-17   Drosophila persimilis
ref|XP_001357188.1|  GA21571                                          89.7    1e-17   Drosophila pseudoobscura pseudoobscura
ref|XP_002948368.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit    89.7    1e-17   Volvox carteri f. nagariensis
gb|AAL89893.1|  RE33648p                                              87.0    1e-17   Drosophila melanogaster
gb|KFH71991.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  89.4    2e-17   Mortierella verticillata NRRL 6337
ref|XP_003451045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.4    2e-17   Oreochromis niloticus
ref|XP_005864550.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.4    2e-17   Myotis brandtii
gb|KFV66989.1|  hypothetical protein N307_09226                       83.2    2e-17   Picoides pubescens
ref|XP_005333391.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.4    2e-17   Ictidomys tridecemlineatus
ref|XP_002631183.1|  C. briggsae CBR-NUO-1 protein                    89.0    2e-17   Caenorhabditis briggsae
gb|EFX78613.1|  hypothetical protein DAPPUDRAFT_53209                 88.6    2e-17   Daphnia pulex
ref|XP_006804891.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.0    2e-17   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008290476.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...  88.6    2e-17   Stegastes partitus
ref|XP_005472675.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.0    2e-17   Oreochromis niloticus
ref|XP_005177827.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  89.0    2e-17   Musca domestica
ref|XP_003969349.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.6    3e-17   Takifugu rubripes [tiger puffer]
ref|XP_003215041.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.6    3e-17   Anolis carolinensis [Carolina anole]
ref|XP_010739964.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.6    3e-17   
emb|CAG05422.1|  unnamed protein product                              85.5    3e-17   Tetraodon nigroviridis
gb|ETE69752.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  88.6    3e-17   Ophiophagus hannah
ref|XP_006010402.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.6    3e-17   Latimeria chalumnae
gb|AAB24883.1|  mitochondrial NADH:ubiquinone oxidoreductase 51 k...  84.3    3e-17   Homo sapiens [man]
gb|EMP26020.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        89.0    3e-17   Chelonia mydas [green seaturtle]
ref|XP_004541258.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.6    3e-17   Maylandia zebra
gb|AEE61949.1|  unknown                                               88.2    3e-17   Dendroctonus ponderosae
gb|ERE77238.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1        82.8    4e-17   Cricetulus griseus [Chinese hamsters]
gb|KIH53381.1|  putative NADH oxidoreductase, F subunit               88.6    4e-17   Ancylostoma duodenale
ref|XP_004531680.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.2    4e-17   Ceratitis capitata [medfly]
gb|EGT44910.1|  CBN-NUO-1 protein                                     88.2    4e-17   Caenorhabditis brenneri
ref|XP_004541259.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.2    4e-17   Maylandia zebra
ref|XP_010883102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.4    4e-17   
ref|XP_011194045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  88.2    4e-17   Zeugodacus cucurbitae [melon fruit fly]
gb|KHN76766.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  89.0    4e-17   Toxocara canis
gb|ETO35987.1|  hypothetical protein RFI_01076                        88.6    4e-17   Reticulomyxa filosa
tpg|DAA41609.1|  TPA: NADH-ubiquinone oxidoreductase subunit, mRNA    87.8    5e-17   
ref|XP_002038046.1|  GM17964                                          87.4    5e-17   Drosophila sechellia
gb|ACO12806.1|  NADH dehydrogenase flavoprotein 1, mitochondrial ...  87.8    5e-17   Lepeophtheirus salmonis
ref|XP_011403421.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.8    6e-17   Amphimedon queenslandica
ref|XP_002799509.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    6e-17   
ref|XP_011204925.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.8    6e-17   Bactrocera dorsalis [papaya fruit fly]
ref|XP_008282052.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.4    6e-17   Stegastes partitus
ref|XP_011204917.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.4    7e-17   Bactrocera dorsalis [papaya fruit fly]
ref|XP_008329578.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.4    7e-17   
ref|XP_010883100.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.4    7e-17   Esox lucius
ref|XP_002078321.1|  GD22602                                          87.4    8e-17   
ref|XP_001969499.1|  GG10139                                          87.4    8e-17   Drosophila erecta
ref|XP_002089130.1|  GE18950                                          87.4    8e-17   Drosophila yakuba
ref|NP_608987.1|  CG9140, isoform A                                   87.0    8e-17   Drosophila melanogaster
emb|CEG66995.1|  Putative NADH-ubiquinone oxidoreductase 51 kDa s...  87.0    9e-17   Rhizopus microsporus
ref|XP_010731123.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.0    9e-17   
emb|CDW52647.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       87.0    9e-17   Trichuris trichiura
ref|XP_003941287.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    9e-17   Saimiri boliviensis boliviensis
ref|XP_005243468.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  87.0    9e-17   
gb|ACE96395.1|  esterase/lipase/thioesterase                          86.3    1e-16   Populus tremula [European aspen]
gb|ACE96394.1|  esterase/lipase/thioesterase                          86.3    1e-16   Populus tremula [European aspen]
gb|ACE96393.1|  esterase/lipase/thioesterase                          86.3    1e-16   Populus tremula [European aspen]
ref|XP_008145081.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    1e-16   
gb|KFD48778.1|  hypothetical protein M513_10333                       86.7    1e-16   Trichuris suis
ref|XP_004073740.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    1e-16   Oryzias latipes [Japanese rice fish]
ref|XP_008145080.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    1e-16   Eptesicus fuscus
ref|XP_005796523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    1e-16   Xiphophorus maculatus
gb|EHJ68778.1|  NADH dehydrogenase flavoprotein 1 ubiquinone          86.7    1e-16   
ref|XP_002065333.1|  GK15392                                          86.7    1e-16   Drosophila willistoni
ref|XP_003117363.1|  CRE-NUO-1 protein                                86.7    1e-16   Caenorhabditis remanei
ref|XP_002435466.1|  NADH:ubiquinone oxidoreductase, NDUFV1/51kDa...  86.7    1e-16   Ixodes scapularis [blacklegged tick]
ref|XP_003083193.1|  PREDICTED P0503D09.102 gene product [Oryza s...  86.7    1e-16   Ostreococcus tauri
ref|XP_005796524.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    2e-16   Xiphophorus maculatus
ref|XP_005140501.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Melopsittacus undulatus
ref|XP_010790716.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.7    2e-16   Notothenia coriiceps [yellowbelly rockcod]
dbj|BAG62399.1|  unnamed protein product                              84.7    2e-16   Homo sapiens [man]
ref|XP_007962396.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.3    2e-16   Chlorocebus sabaeus
gb|AFK11344.1|  NADH dehydrogenase ubiquinone flavoprotein 1 prec...  86.3    2e-16   Callorhinchus milii [Australian ghost shark]
ref|NP_001164305.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  86.3    2e-16   Tribolium castaneum [rust-red flour beetle]
gb|KFO80505.1|  hypothetical protein N303_05672                       80.1    2e-16   Cuculus canorus
gb|ADI40704.1|  NADH dehydrogenase flavoprotein 1, 51kDa              84.3    2e-16   Cynopterus sphinx [greater short-nosed fruit bat]
ref|XP_004366877.1|  ubiquinone oxidoreductase                        86.3    2e-16   Cavenderia fasciculata
gb|AAB03672.1|  ndufv1                                                86.3    2e-16   Dictyostelium discoideum
gb|ACO10172.1|  NADH dehydrogenase flavoprotein 1, mitochondrial ...  86.3    2e-16   Osmerus mordax
ref|XP_003419441.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.3    2e-16   Loxodonta africana [African bush elephant]
ref|XP_002755638.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.3    2e-16   Callithrix jacchus [common marmoset]
ref|XP_003378967.1|  putative NADH oxidoreductase, F subunit          87.0    2e-16   Trichinella spiralis
ref|XP_002162472.2|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   
ref|XP_008420425.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.3    2e-16   Poecilia reticulata
ref|XP_009095507.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.5    2e-16   
ref|XP_636489.1|  ubiquinone oxidoreductase                           86.3    2e-16   Dictyostelium discoideum AX4
ref|XP_008048441.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Carlito syrichta
ref|XP_010773860.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  86.3    2e-16   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_496376.1|  Protein NUO-1                                       86.3    2e-16   Caenorhabditis elegans [roundworm]
ref|XP_005577102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   
ref|XP_010562605.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Haliaeetus leucocephalus
ref|NP_001266473.1|  NADH dehydrogenase (ubiquinone) flavoprotein...  85.9    2e-16   Gorilla gorilla [gorilla]
ref|XP_005529102.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005046765.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Ficedula albicollis
ref|NP_598427.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...  85.9    2e-16   Mus musculus [mouse]
ref|XP_008420426.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Poecilia reticulata
gb|EHH56026.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  85.9    2e-16   Macaca fascicularis [crab eating macaque]
dbj|BAE90673.1|  unnamed protein product                              85.9    2e-16   Macaca fascicularis [crab eating macaque]
sp|Q0MQI4.1|NDUV1_PONPY  RecName: Full=NADH dehydrogenase [ubiqui...  85.9    2e-16   Pongo pygmaeus [orang utan]
ref|NP_001032653.1|  uncharacterized protein LOC641566                85.9    2e-16   Danio rerio [leopard danio]
ref|XP_009183769.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   
ref|XP_003798357.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Otolemur garnettii
ref|XP_007565012.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    2e-16   Poecilia formosa
ref|NP_001274202.1|  NADH dehydrogenase (ubiquinone) flavoprotein...  85.9    2e-16   Macaca fascicularis [crab eating macaque]
sp|Q8HXQ9.1|NDUV1_MACFA  RecName: Full=NADH dehydrogenase [ubiqui...  85.9    3e-16   Macaca fascicularis [crab eating macaque]
ref|XP_010364628.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.9    3e-16   Rhinopithecus roxellana
ref|XP_005063380.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    3e-16   
ref|XP_003977673.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.5    3e-16   
gb|ABY55757.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1        83.2    3e-16   Drosophila silvestris
gb|EFA77854.1|  ubiquinone oxidoreductase                             85.5    3e-16   Heterostelium album PN500
gb|ADI40702.1|  NADH dehydrogenase flavoprotein 1, 51kDa              83.6    3e-16   Scotophilus kuhlii
ref|XP_003774247.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    3e-16   
gb|ADI40703.1|  NADH dehydrogenase flavoprotein 1, 51kDa              83.6    3e-16   Miniopterus schreibersii [Common bent-wing bat]
gb|AAQ63696.1|  NADH:ubiquinone oxidoreductase 51 kD subunit          85.5    3e-16   Chlamydomonas reinhardtii
gb|KFM58892.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  83.2    3e-16   Stegodyphus mimosarum
ref|XP_007518737.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.5    3e-16   Erinaceus europaeus [common hedgehog]
ref|XP_007518736.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.5    3e-16   Erinaceus europaeus [common hedgehog]
ref|XP_007550020.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.5    4e-16   
ref|XP_001702590.1|  NADH:ubiquinone oxidoreductase 51 kDa subunit    85.5    4e-16   Chlamydomonas reinhardtii
ref|XP_011379926.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    4e-16   Pteropus vampyrus
gb|EYB94292.1|  hypothetical protein Y032_0173g404                    85.5    4e-16   Ancylostoma ceylanicum
emb|CAM91788.1|  hypothetical protein                                 81.3    4e-16   Platynereis dumerilii
ref|XP_005850918.1|  hypothetical protein CHLNCDRAFT_56910            86.3    4e-16   Chlorella variabilis
emb|CDQ87460.1|  unnamed protein product                              85.1    4e-16   Oncorhynchus mykiss
ref|XP_005700086.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   
ref|XP_004759596.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    5e-16   
ref|NP_001026754.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  85.1    5e-16   Gallus gallus [bantam]
emb|CDS13291.1|  Putative NADH-ubiquinone oxidoreductase 51 kDasu...  85.1    5e-16   Lichtheimia ramosa
ref|XP_004759595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    5e-16   Mustela putorius furo [black ferret]
ref|XP_011379925.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    5e-16   Pteropus vampyrus
ref|XP_001988013.1|  GH10936                                          85.1    5e-16   Drosophila grimshawi
ref|XP_006743666.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Leptonychotes weddellii
ref|XP_004481672.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   
ref|XP_007171145.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    5e-16   Balaenoptera acutorostrata scammoni
ref|XP_864381.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...  84.7    5e-16   
ref|XP_003122487.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   
ref|XP_004393883.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Odobenus rosmarus divergens
ref|XP_003170860.1|  NADH-ubiquinone oxidoreductase subunit           85.1    5e-16   Nannizzia gypsea CBS 118893
ref|XP_001962320.1|  GF15407                                          85.1    5e-16   Drosophila ananassae
ref|XP_010709117.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Meleagris gallopavo [common turkey]
ref|XP_004437773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   
ref|XP_004393884.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Odobenus rosmarus divergens
ref|XP_004682622.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   
ref|XP_006743665.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Leptonychotes weddellii
ref|XP_008707306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Ursus maritimus [white bear]
ref|XP_851761.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...  84.7    5e-16   Canis lupus familiaris [dogs]
ref|XP_004481671.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Dasypus novemcinctus
ref|XP_003122486.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    5e-16   Sus scrofa [pigs]
ref|XP_011225862.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   Ailuropoda melanoleuca
ref|XP_003993754.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   Felis catus [cat]
ref|XP_002051457.1|  GJ12140                                          84.7    6e-16   Drosophila virilis
ref|XP_010819350.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  85.1    6e-16   Bos taurus [bovine]
ref|XP_007942874.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   Orycteropus afer afer
ref|XP_004682621.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   Condylura cristata
ref|XP_004437772.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_002002293.1|  GI13499                                          84.7    6e-16   Drosophila mojavensis
ref|XP_006641742.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.4    6e-16   
gb|EPY87516.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1-li...  84.7    6e-16   Camelus ferus
ref|XP_006072788.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|NP_009034.2|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...  84.7    6e-16   
dbj|BAD96781.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, ...  84.7    6e-16   
ref|XP_007450480.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_004019774.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
gb|EFB28979.1|  hypothetical protein PANDA_010233                     84.3    6e-16   
ref|XP_007450478.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_004278072.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|NP_001065293.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  84.7    6e-16   
ref|XP_007126990.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
emb|CAA76757.1|  NADH:ubiquinone oxidoreductase 51-kD subunit         84.7    6e-16   
ref|XP_006210772.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_006176052.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_004713643.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_001917609.2|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_007505720.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    6e-16   
ref|XP_004019773.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_004278073.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|XP_005598405.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
ref|NP_001159574.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  84.7    6e-16   
ref|XP_006072787.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    6e-16   
sp|P25708.2|NDUV1_BOVIN  RecName: Full=NADH dehydrogenase [ubiqui...  84.7    7e-16   
gb|EAW74654.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1, 5...  84.7    7e-16   
ref|XP_007942873.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    7e-16   
ref|XP_007094187.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    7e-16   
ref|XP_008508616.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...  84.7    7e-16   
ref|XP_005967115.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    7e-16   
ref|NP_777233.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1,...  84.7    7e-16   
ref|XP_006210771.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    7e-16   
ref|XP_010835982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    7e-16   
ref|XP_004329281.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...  84.7    7e-16   
gb|AGM32801.1|  NADH-ubiquinone oxidoreductase                        82.8    7e-16   
ref|XP_001421384.1|  predicted protein                                84.3    7e-16   
ref|XP_006176053.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    7e-16   
ref|XP_006893311.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    7e-16   
ref|XP_004713642.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    7e-16   
gb|ACI33487.1|  NADH dehydrogenase flavoprotein 1, mitochondrial ...  84.7    7e-16   
gb|ELR50720.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  84.3    7e-16   
ref|XP_010955042.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    7e-16   
gb|AAA30661.1|  NADH dehydrogenase                                    84.7    7e-16   
ref|XP_005903647.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.7    8e-16   
ref|XP_009898255.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_004549159.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006788169.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006893310.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006102550.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006980586.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_005351696.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006861118.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006771560.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_005351697.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_003452502.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
ref|XP_006102549.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    8e-16   
gb|EPQ06606.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  84.3    8e-16   
dbj|GAM25560.1|  hypothetical protein SAMD00019534_087350             84.3    9e-16   
ref|XP_003468355.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_003509972.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
gb|ELV09500.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  84.3    9e-16   
ref|XP_006171329.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_002844435.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit    84.7    9e-16   
ref|XP_008580125.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_004900065.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_005384364.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.0    9e-16   
ref|XP_005384363.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_004900064.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.3    9e-16   
ref|XP_004383708.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.0    1e-15   
ref|XP_004383707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.0    1e-15   
ref|XP_003468354.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.0    1e-15   
ref|NP_001006973.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  84.0    1e-15   
gb|KGO38080.1|  NADH ubiquinone oxidoreductase, F subunit             84.3    1e-15   
ref|XP_010864790.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  84.0    1e-15   
emb|CAH65683.1|  NADH-quinone oxidoreductase                          84.0    1e-15   
emb|CDH52430.1|  nadh dehydrogenase                                   84.0    1e-15   
ref|XP_007505721.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    1e-15   
gb|KGO78410.1|  NADH ubiquinone oxidoreductase, F subunit             84.0    1e-15   
gb|EKV04743.1|  hypothetical protein PDIG_87350                       84.0    1e-15   
ref|XP_006276947.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    1e-15   
ref|XP_011424780.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    1e-15   
ref|XP_008821129.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    2e-15   
ref|XP_008429844.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    2e-15   
ref|XP_001455133.1|  hypothetical protein                             83.6    2e-15   
ref|XP_001423954.1|  hypothetical protein                             83.2    2e-15   
ref|XP_008429845.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    2e-15   
ref|XP_001435452.1|  hypothetical protein                             83.6    2e-15   
ref|XP_010634093.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    2e-15   
gb|KDR18342.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  83.6    2e-15   
ref|XP_004627196.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
gb|KFO28327.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  83.6    2e-15   
ref|XP_008429843.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.6    2e-15   
ref|XP_004598277.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
ref|XP_004627195.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
ref|XP_004598276.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
ref|NP_001080215.1|  NADH dehydrogenase ubiquinone flavoprotein 1     83.2    2e-15   
ref|XP_003745829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
gb|KIX02114.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  83.2    2e-15   
ref|XP_001946240.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  83.2    2e-15   
ref|NP_001011491.1|  NADH dehydrogenase ubiquinone flavoprotein 1     83.2    2e-15   
ref|XP_004342489.2|  NADH:ubiquinone oxidoreductase NDUFV1            83.2    2e-15   
ref|XP_005798940.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.8    3e-15   
ref|XP_663233.1|  NUBM_ASPNG NADH-ubiquinone oxidoreductase 51 kD...  83.2    3e-15   
gb|KDN41902.1|  hypothetical protein RSAG8_07119                      80.1    3e-15   
ref|XP_004618539.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.8    3e-15   
ref|XP_004618538.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.8    3e-15   
ref|NP_001003747.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  82.8    3e-15   
ref|XP_004618537.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.8    3e-15   
ref|XP_004656824.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.8    3e-15   
gb|KIO03861.1|  hypothetical protein M404DRAFT_144702                 82.8    3e-15   
ref|XP_001430380.1|  hypothetical protein                             82.8    3e-15   
ref|XP_001213151.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  82.8    3e-15   
ref|XP_004656823.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.4    3e-15   
ref|XP_003293586.1|  ubiquinone oxidoreductase                        82.8    3e-15   
emb|CDS08258.1|  Putative NADH dehydrogenase                          82.8    3e-15   
gb|KGB32486.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  82.8    4e-15   
ref|XP_007256964.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.4    4e-15   
emb|CDH54053.1|  nadh dehydrogenase                                   84.0    4e-15   
emb|CAX75358.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       82.4    4e-15   
emb|CAX75357.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       82.4    4e-15   
emb|CAX70517.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       82.0    4e-15   
gb|KIW45166.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  82.8    4e-15   
gb|KIW45165.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  82.8    4e-15   
gb|AAW25108.1|  SJCHGC01665 protein                                   82.4    4e-15   
ref|XP_001637535.1|  predicted protein                                82.4    4e-15   
dbj|GAA82965.1|  mitochondrial proton-pumping NADH:ubiquinone red...  82.4    4e-15   
sp|Q92406.1|NDUV1_ASPNG  RecName: Full=NADH-ubiquinone oxidoreduc...  82.4    4e-15   
ref|XP_001401928.1|  NADH-ubiquinone oxidoreductase subunit           82.4    4e-15   
ref|XP_009173178.1|  hypothetical protein T265_08967                  82.8    5e-15   
ref|XP_004334975.1|  NADH oxidoreductase (quinone), F subunit         82.0    5e-15   
gb|KIV80975.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  82.4    5e-15   
ref|XP_008211165.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  81.3    5e-15   
gb|KIY47187.1|  NADH-ubiquinone oxidoreductase                        82.4    5e-15   
ref|XP_003746033.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.0    6e-15   
emb|CEP08398.1|  hypothetical protein                                 82.0    6e-15   
ref|XP_007719272.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  82.0    6e-15   
gb|EPB92081.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  82.0    6e-15   
ref|XP_009565108.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  81.6    6e-15   
ref|XP_007230636.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  82.0    6e-15   
gb|KIK28105.1|  hypothetical protein PISMIDRAFT_605119                82.0    6e-15   
ref|XP_011120306.1|  hypothetical protein AOL_s00054g688              82.0    6e-15   
gb|EJY76658.1|  NADH-quinone oxidoreductase, F subunit family pro...  82.4    7e-15   
gb|EJW75332.1|  hypothetical protein WUBG_13762                       78.2    7e-15   
ref|XP_005702818.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1   81.6    7e-15   
ref|XP_011109259.1|  hypothetical protein H072_3277                   81.6    8e-15   
ref|XP_002564700.1|  Pc22g06720                                       81.6    9e-15   
emb|CCX31452.1|  Similar to NADH-ubiquinone oxidoreductase 51 kDa...  81.6    9e-15   
ref|XP_011505585.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  81.3    9e-15   
gb|EPS33450.1|  hypothetical protein PDE_08412                        81.6    9e-15   
gb|KEF57794.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  81.6    1e-14   
ref|NP_001165788.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  81.3    1e-14   
gb|KIW49348.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  81.3    1e-14   
gb|EMD37755.1|  hypothetical protein CERSUDRAFT_114392                81.3    1e-14   
gb|KIW15937.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  81.3    1e-14   
gb|KIN04933.1|  hypothetical protein OIDMADRAFT_177285                81.3    1e-14   
gb|EUC53618.1|  NADH-ubiquinone oxidoreductase                        80.9    1e-14   
ref|XP_004929189.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  80.9    1e-14   
ref|XP_009158151.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  80.9    1e-14   
ref|XP_002115153.1|  conserved hypothetical protein                   80.5    2e-14   
ref|XP_001266908.1|  NADH-ubiquinone oxidoreductase, subunit F, p...  80.9    2e-14   
gb|EGC43211.1|  NADH-ubiquinone oxidoreductase                        80.9    2e-14   
gb|EZF34517.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  80.9    2e-14   
gb|EEH08161.1|  NADH-ubiquinone oxidoreductase                        80.9    2e-14   
ref|XP_003011447.1|  hypothetical protein ARB_02297                   80.9    2e-14   
ref|XP_002151246.1|  NADH-ubiquinone oxidoreductase, subunit F, p...  80.9    2e-14   
gb|EZF26364.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  80.9    2e-14   
dbj|GAN02266.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, m...  80.5    2e-14   
gb|ELU41204.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         80.5    2e-14   
gb|KIW00676.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  80.5    2e-14   
emb|CEL57343.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       80.1    2e-14   
ref|XP_002608782.1|  hypothetical protein BRAFLDRAFT_273832           80.1    3e-14   
ref|XP_003691837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  80.1    3e-14   
ref|XP_003020846.1|  hypothetical protein TRV_05072                   80.5    3e-14   
dbj|GAD94458.1|  NADH-ubiquinone oxidoreductase, subunit F, putative  80.1    3e-14   
emb|CDI99272.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       79.7    3e-14   
emb|CDS22456.1|  NADH dehydrogenase ubiquinone flavoprotein 1         79.7    3e-14   
ref|XP_391916.2|  PREDICTED: NADH dehydrogenase [ubiquinone] flav...  79.7    3e-14   
ref|XP_001820209.1|  NADH-ubiquinone oxidoreductase subunit           79.7    3e-14   
gb|KFX48514.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  80.9    3e-14   
ref|XP_011386722.1|  putative NADH2 dehydrogenase (ubiquinone) fl...  80.1    3e-14   
gb|KDE09084.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         79.7    4e-14   
ref|XP_002430129.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  79.7    4e-14   
ref|XP_006614078.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  79.7    4e-14   
ref|XP_008543074.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  79.3    4e-14   
gb|EUB56362.1|  NADH dehydrogenase [ubiquinone] flavoprotein          80.5    5e-14   
ref|XP_007730378.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  79.3    5e-14   
ref|XP_003707795.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  79.3    5e-14   
dbj|GAM41688.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit        80.1    5e-14   
gb|KIM36517.1|  hypothetical protein M413DRAFT_31570                  79.3    6e-14   
ref|XP_004520210.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  79.3    6e-14   
ref|XP_008550105.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  79.0    6e-14   
dbj|GAC73970.1|  hypothetical protein PANT_9d00361                    79.7    6e-14   
gb|KIJ98091.1|  hypothetical protein K443DRAFT_681044                 79.0    6e-14   
gb|EEH20908.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  79.0    7e-14   
ref|XP_010757543.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  79.0    8e-14   
emb|CDS26336.1|  NADH dehydrogenase (ubiquinone) flavoprotein 1       78.6    8e-14   
ref|XP_008721911.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  79.0    8e-14   
ref|XP_007911837.1|  putative nadh-ubiquinone oxidoreductase 51 k...  79.3    8e-14   
ref|XP_011055216.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  78.6    8e-14   
ref|XP_007867136.1|  NADH-ubiquinone oxidoreductase                   78.6    9e-14   
ref|XP_001887532.1|  predicted protein                                78.6    9e-14   
emb|CDM36631.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, m...  78.6    1e-13   
gb|KIR49749.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  78.6    1e-13   
emb|CDP91085.1|  Protein BM-NUO-1, isoform b                          78.6    1e-13   
ref|XP_002394009.1|  hypothetical protein MPER_06171                  76.3    1e-13   
gb|AAU14244.1|  hydrogenosomal NADH dehydrogenase 51 kDa subunit      78.2    1e-13   
gb|KGB75017.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         78.2    1e-13   
gb|EFW21501.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         78.6    1e-13   
ref|XP_003065710.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  78.6    1e-13   
ref|XP_003398732.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  78.2    1e-13   
ref|XP_003193778.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit    78.2    1e-13   
ref|XP_001746110.1|  hypothetical protein                             78.2    1e-13   
gb|KIR89249.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  78.2    1e-13   
ref|XP_001247741.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  78.6    1e-13   
ref|XP_007782152.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  78.6    1e-13   
ref|XP_003486092.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  78.2    1e-13   
gb|EWM22182.1|  nadh dehydrogenase                                    74.3    1e-13   
ref|XP_004934231.1|  PREDICTED: NADH dehydrogenase [ubiquinone] f...  73.2    1e-13   
gb|ETI31833.1|  NADH dehydrogenase [ubiquinone] flavoprotein 1, m...  78.2    1e-13   
ref|XP_002341788.1|  NADH-ubiquinone oxidoreductase, subunit F, p...  78.2    1e-13   
gb|KIW24941.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit, mi...  78.2    1e-13   
ref|XP_008914900.1|  NADH dehydrogenase [ubiquinone] flavoprotein...  78.2    1e-13   
gb|KIY68743.1|  NADH-ubiquinone oxidoreductase 51 kDa subunit         78.2    1e-13   
ref|XP_001894295.1|  NADH-ubiquinone oxidoreductase 51 kDa subuni...  78.2    1e-13   
ref|XP_001271969.1|  NADH-ubiquinone oxidoreductase, subunit F, p...  78.2    1e-13   



>ref|XP_009615859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=487

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTALVQR S++WGL GR +S QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGLLSLQRTALVQRSSERWGLYGRLFSTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>ref|XP_011086756.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=487

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV+R  + WGL+ R +S+QAA++ +TPQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRTALVRRSRENWGLSSRLFSSQAATSPSTPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKS  106



>ref|XP_009785204.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana sylvestris]
Length=487

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTALVQR S++WGL GR ++ QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGLLSLQRTALVQRSSERWGLYGRLFNTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>ref|XP_011086755.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=488

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP+KG+LSLQRTALV+R  + WGL+ R +S+QAA++ +TPQ+PPPPPPPEKTHFGGLKDE
Sbjct  3    APIKGILSLQRTALVRRSRENWGLSSRLFSSQAATSPSTPQAPPPPPPPEKTHFGGLKDE  62

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  63   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKS  107



>ref|NP_001275120.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Solanum tuberosum]
 emb|CAA58823.1| NADH dehydrogenase [Solanum tuberosum]
Length=487

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTAL QR S++WGL GR +S QAASTA+TPQ  PPPPPPE+THFGGLKD
Sbjct  1    MAPIKGLLSLQRTALAQRSSERWGLYGRLFSTQAASTASTPQPTPPPPPPERTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVIKGSDWIVNEMKKS  106



>ref|XP_004232268.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Solanum lycopersicum]
Length=487

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KGLLSLQRTAL QR S++WG  GR +S QAASTA+TPQ  PPPPPPE+THFGGLKD
Sbjct  1    MAPIKGLLSLQRTALAQRSSERWGQYGRLFSTQAASTASTPQPTPPPPPPERTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVIKGSDWIVNEMKKS  106



>gb|KJB50332.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=486

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL++ C ++W L  R +S Q A+TA+ PQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALLRACGERWKLGTRSFSTQGATTADAPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKS  106



>emb|CBI21762.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   162 bits (411),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            ++  MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFG
Sbjct  116  ITSQMAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFG  175

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKS
Sbjct  176  GLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKS  225



>gb|KJB50333.1| hypothetical protein B456_008G164400 [Gossypium raimondii]
Length=493

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP+KG+LSLQR AL++ C ++W L  R +S Q A+TA+ PQ+PPPPPPPEKTHFGGLKDE
Sbjct  9    APIKGILSLQRAALLRACGERWKLGTRSFSTQGATTADAPQAPPPPPPPEKTHFGGLKDE  68

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  69   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKS  113



>ref|XP_009770074.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009770075.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Nicotiana sylvestris]
Length=486

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV R S++WGL GR +S QAASTA+    P PP PPEKTHFG LKD
Sbjct  1    MAPIKGILSLQRTALVLRSSERWGLYGRLFSTQAASTASN-PQPTPPAPPEKTHFGDLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  60   EDRIFTNLYGLHDPYLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  105



>ref|XP_010644983.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Vitis vinifera]
Length=511

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            ++  MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFG
Sbjct  21   ITSQMAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFG  80

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKS
Sbjct  81   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKS  130



>ref|XP_002266661.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Vitis vinifera]
Length=487

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKS  106



>ref|XP_009609277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
 ref|XP_009609278.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=487

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQRTALV R S++ GL GR +S QAASTA+TPQ  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRTALVLRSSERLGLYGRLFSTQAASTASTPQPTPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP+LK A+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPYLKDAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>gb|KJB08870.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08871.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08872.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
 gb|KJB08873.1| hypothetical protein B456_001G109800 [Gossypium raimondii]
Length=486

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR A+ +  S++W L  R +S Q A+TA  PQ+PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAAMFRASSERWKLGIRSFSTQGATTAGAPQAPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEMKKS  106



>emb|CAN73193.1| hypothetical protein VITISV_022287 [Vitis vinifera]
Length=489

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDE  390
            AP++G+L+LQR ALV R S+KWG   R +S QAA+TA+  Q PPPPPPPEKTHFGGLKDE
Sbjct  4    APIRGILTLQRMALVSRQSKKWGPGCRAFSTQAATTASASQPPPPPPPPEKTHFGGLKDE  63

Query  391  DRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DRIFTN+YGLHDPFLKGA+KRGDWYRTKD+VLKG+DWIVNE+KKS
Sbjct  64   DRIFTNLYGLHDPFLKGAMKRGDWYRTKDIVLKGSDWIVNEMKKS  108



>ref|XP_004310055.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=486

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR  L +    KWGL  R  S QAASTA TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAVLARHHGAKWGLGYRLLSTQAASTATTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  106



>ref|XP_008222059.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Prunus mume]
Length=486

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSL R AL +   +KWGL  R +S Q A+TANTPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLPRAALARHHGEKWGLGLRSFSTQGATTANTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKD+V+KG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDIVIKGADWIVNEMKKS  106



>emb|CDP13320.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LS QR +LV++ S+ W L  R +S QAASTA+TPQ PPPPPPPEKTHFGGLKD
Sbjct  20   MAPIKGILSSQRISLVKQ-SEHWVLGSRLFSTQAASTASTPQPPPPPPPPEKTHFGGLKD  78

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTNVYGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNE+KKS
Sbjct  79   EDRIFTNVYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEMKKS  124



>ref|XP_008360129.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Malus domestica]
Length=486

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGAKWGLGFRSFSTQGAAPSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  106



>ref|XP_002315622.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
 gb|EEF01793.1| hypothetical protein POPTR_0010s06750g [Populus trichocarpa]
Length=485

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ SLQRTALV++ S++ G+  R +S QA + A  PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFSLQRTALVRQ-SERLGVGFRSFSTQAPTNAGAPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  105



>ref|XP_007045030.1| 51 kDa subunit of complex I [Theobroma cacao]
 gb|EOY00862.1| 51 kDa subunit of complex I [Theobroma cacao]
Length=486

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +  S++WGL  R +S Q A+T   PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALFRNSSERWGLGIRSFSTQGATTTGAPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA KRGDW+RTKDLVLKG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAQKRGDWHRTKDLVLKGADWIVNEMKKS  106



>ref|XP_011041538.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
 ref|XP_011016388.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Populus euphratica]
Length=485

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ SLQRTALV++ S++ G+  R +S QA + A  PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFSLQRTALVRQ-SERLGVGFRSFSTQAPTNAGAPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  105



>gb|KDP26775.1| hypothetical protein JCGZ_17933 [Jatropha curcas]
Length=486

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+LSLQR A+++R S +  +  R  S QAA+ A +PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILSLQRAAMIRRHSDRLDIGFRSLSTQAATNAGSPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  106



>gb|EYU42106.1| hypothetical protein MIMGU_mgv1a005364mg [Erythranthe guttata]
Length=487

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+K +LSL+RTA  QR  + WGL  + +S QAA+T+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKSILSLRRTAYAQRSGENWGLARKLFSTQAATTSPTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTNVYGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  61   EDRIFTNVYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKS  106



>ref|XP_010248930.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
 ref|XP_010248931.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Nelumbo nucifera]
Length=487

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP K +LSL R ALV+R S+KW    R +S Q A+T++TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPFKSILSLPRVALVRRSSEKWDSICRSFSTQFATTSSTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>ref|XP_008340188.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X2 [Malus domestica]
Length=502

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + T Q PPPPPP EKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGXKWGLAFRSFSTQGAAPSTTAQPPPPPPP-EKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  60   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  105



>ref|XP_008340187.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like isoform X1 [Malus domestica]
Length=510

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR AL +    KWGL  R +S Q A+ + T Q PPPPPP EKTHFGGLKD
Sbjct  1    MAPIKGILSLQRAALARHHGXKWGLAFRSFSTQGAAPSTTAQPPPPPPP-EKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  60   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  105



>ref|XP_010682836.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=495

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLN-GRFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            MAP++G+L LQR   +QR  + WG    R +S QAAST+NTPQ PPPPPPPEKTHFGGLK
Sbjct  1    MAPLRGILKLQRIGQLQRHYETWGAGYSRLFSTQAASTSNTPQPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   DEDRIFTNLYGIHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  107



>ref|XP_006484064.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Citrus sinensis]
 gb|KDO81963.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81964.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81965.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
 gb|KDO81966.1| hypothetical protein CISIN_1g011427mg [Citrus sinensis]
Length=486

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSLQR +LV+  S++  +  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPMKGVLSLQRASLVRCYSERLSVGLRSFSTQGASTASTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKS
Sbjct  61   EDRIFTNLYGMHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKS  106



>ref|XP_004497858.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=492

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            L P    ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFG
Sbjct  3    LLPGRITMRGILSLKRAVLVRQQSEKVGLGCRLFSTQGASTASTPQPPPPPPPPEKTHFG  62

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  63   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKS  112



>ref|XP_002514955.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
 gb|EEF47509.1| NADH-ubiquinone oxidoreductase flavoprotein, putative [Ricinus 
communis]
Length=486

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+ +LQR AL++R S +  +  R +S +A  +A + Q  PPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGIFNLQRAALIRRQSDRLAVGIRSFSTEATKSAGSSQPLPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNEVKKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEVKKS  106



>ref|XP_009372324.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Pyrus x bretschneideri]
Length=487

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLK  384
            MAP+KG+LSLQR AL      KWGL  R +S Q A+ + T Q PPPPPPP EKTHFGGLK
Sbjct  1    MAPLKGILSLQRAALACHHGAKWGLAFRSFSTQGAAPSTTAQPPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  61   DEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  107



>ref|XP_011071205.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Sesamum indicum]
Length=486

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP++G+LSLQRTAL+QR ++ W    R ++  AA+T+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIRGILSLQRTALIQRSAENWSQARRLFNT-AATTSTTPQPPPPPPPPEKTHFGGLKD  59

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTNVYGLHDPFLKGA+KRGDWYRTKDLVLKG DWIVNE+KKS
Sbjct  60   EDRIFTNVYGLHDPFLKGAMKRGDWYRTKDLVLKGADWIVNEIKKS  105



>ref|XP_010547695.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tarenaya hassleriana]
Length=486

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L+LQR A   + S ++    R +SAQAA+T+NTPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILALQRAASTWKQSNRFCPVVRSFSAQAATTSNTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>gb|AES60212.2| NADH-ubiquinone oxidoreductase 51 kDa subunit [Medicago truncatula]
Length=483

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSLKRAVLVRQHSEKLGLGVRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  61   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKS  103



>ref|XP_004497859.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=483

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSLKRAVLVRQQSEKVGLGCRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  61   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKS  103



>ref|XP_003589961.1| NADH-quinone oxidoreductase subunit F [Medicago truncatula]
Length=568

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LSPAMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFG  375
            +S +   ++G+LSL+R  LV++ S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFG
Sbjct  1    MSISWITMRGILSLKRAVLVRQHSEKLGLGVRLFSTQGASTASTPQPPPPPPPPEKTHFG  60

Query  376  GLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            GLKDEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  61   GLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKS  110



>ref|XP_003535239.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform 1 [Glycine max]
 gb|KHN10057.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LS+ RTALVQ  S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSV-RTALVQHHSEKLGLGFRVFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVVKGTDWIVNEMKKS  102



>ref|XP_007145867.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
 gb|ESW17861.1| hypothetical protein PHAVU_007G274700g [Phaseolus vulgaris]
Length=482

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
            QRTALVQ  S+K GL  R +S Q ASTA +PQ PPPPPPPEKTHFGGLKDEDRIFTN+YG
Sbjct  7    QRTALVQHRSEKLGLGLRLFSTQGASTATSPQPPPPPPPPEKTHFGGLKDEDRIFTNLYG  66

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            LHDPFLKGA+KRGDWYRTKDLV+KGTDWIVNE+KKS
Sbjct  67   LHDPFLKGAMKRGDWYRTKDLVIKGTDWIVNEMKKS  102



>ref|XP_006574505.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Glycine max]
 gb|KHN00283.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Glycine soja]
Length=482

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 1/103 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++G+LS+ RTALVQ  S+K GL  R +S Q ASTA+TPQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MRGILSV-RTALVQHRSEKLGLGFRLFSTQGASTASTPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIV+E+KKS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVSEMKKS  102



>gb|EPS65614.1| hypothetical protein M569_09162 [Genlisea aurea]
Length=512

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 102/137 (74%), Gaps = 10/137 (7%)
 Frame = +1

Query  121  IQSLGSQFLTSRPSHQRSVALRLRYLSPA--MAPVKGLLSLQRTALVQRCSQKWGLNGRF  294
            + ++GS   T R    R V   +    P   MAP+KG++SLQR ALV+    ++ +  RF
Sbjct  3    LSAVGS-ISTPRAIACRGVCSVIDVAKPVDPMAPIKGIVSLQRAALVR---NRY-IASRF  57

Query  295  YSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTK  474
            +SAQAA+    P +  PPPPPE+THFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTK
Sbjct  58   FSAQAATD---PANQQPPPPPERTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTK  114

Query  475  DLVLKGTDWIVNEVKKS  525
            DL+LKGTDWIVNE+KKS
Sbjct  115  DLILKGTDWIVNEMKKS  131



>ref|XP_009122464.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brassica rapa]
Length=486

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSVWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_006399353.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
 gb|ESQ40806.1| hypothetical protein EUTSA_v10013394mg [Eutrema salsugineum]
Length=486

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_006287433.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
 gb|EOA20331.1| hypothetical protein CARUB_v10000637mg, partial [Capsella rubella]
Length=546

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +1

Query  205  AMAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            +MAPV+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLK
Sbjct  60   SMAPVRGILGLQRAVSVWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLK  119

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  120  DEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  166



>gb|AAM65274.1| NADH dehydrogenase [Arabidopsis thaliana]
Length=486

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|NP_196470.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Arabidopsis thaliana]
 sp|Q9FNN5.1|NDUV1_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10002.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAM12970.1| NADH dehydrogenase [Arabidopsis thaliana]
 gb|AAP31964.1| At5g08530 [Arabidopsis thaliana]
 gb|AED91315.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Arabidopsis thaliana]
Length=486

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSIWKESNRLTPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_010423066.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Camelina sativa]
Length=486

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_010459420.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_010452860.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPVRGILGLQRAVSLWKDSNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_008443176.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
 ref|XP_008443177.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cucumis melo]
Length=486

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP +G+L LQ   L +R   +WG+  R +S+Q A+   +PQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPFRGMLYLQHRTLARRYIDQWGIGLRAFSSQGAAAPGSPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKS  106



>ref|XP_007222426.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
 gb|EMJ23625.1| hypothetical protein PRUPE_ppa004904mg [Prunus persica]
Length=486

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP+KG+LSL R AL +   +KWGL  R +S Q A+TA TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAPIKGILSLPRAALARHHGEKWGLGLRSFSTQGATTATTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YG HDPFLKGA+KRGDW+RTKD+V+KG DWIVNE+KKS
Sbjct  61   EDRIFTNLYGSHDPFLKGAMKRGDWHRTKDIVIKGADWIVNEMKKS  106



>ref|XP_010491494.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Camelina sativa]
Length=486

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MA V+G+L LQR   V + S +     R +S QAAST+ TPQ PPPPPPPEKTHFGGLKD
Sbjct  1    MAAVRGILGLQRAVSVWKESNRLAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>ref|XP_010546277.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=487

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L+LQR     +   ++    R +SAQ+A+T++TPQ PPPPPPPEKTHFGGL D
Sbjct  1    MAPVRGILALQRAVSNLKQCNRFCPALRSFSAQSATTSSTPQPPPPPPPPEKTHFGGLTD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGSDWIVNEMKKS  106



>ref|XP_009131078.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Brassica rapa]
Length=487

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGR-FYSAQAASTANTPQSpppppppEKTHFGGLK  384
            MAP++G+L LQR   + + S +   + R F + Q AST+ TPQ PPPPPPPEKTHFGGLK
Sbjct  1    MAPMRGILGLQRAVSIWKESNRLAPSLRSFSTTQGASTSTTPQPPPPPPPPEKTHFGGLK  60

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLVLKGTDWIVNE+KKS
Sbjct  61   DEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVLKGTDWIVNEMKKS  107



>ref|XP_002873369.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49628.1| hypothetical protein ARALYDRAFT_487692 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAPV+G+L LQR   + +   +     R +S QAAST+ TPQ PPPPPPPEKTHFGGL D
Sbjct  1    MAPVRGILGLQRAVSIWKEINRVAPALRSFSTQAASTSTTPQPPPPPPPPEKTHFGGLTD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKGTDWIVNE+KKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIVNEMKKS  106



>gb|KGN59382.1| hypothetical protein Csa_3G815460 [Cucumis sativus]
Length=486

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            MAP +G+L LQR +L +    +WG+  R +S+Q A+   +PQ P PPPPPEKTHFGGLKD
Sbjct  1    MAPFRGMLYLQRRSLARCYIDQWGIGLRAFSSQGAAAPGSPQPPAPPPPPEKTHFGGLKD  60

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKS
Sbjct  61   EDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKS  106



>gb|AHA84169.1| NADH-quinone oxidoreductase subunit F [Phaseolus vulgaris]
Length=482

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            +K  LSL RTALVQ   +  GL  R +S Q ASTA +PQ PPPPPPPEKTHFGGLKDEDR
Sbjct  1    MKRFLSL-RTALVQHRIENLGLGLRLFSTQGASTATSPQPPPPPPPPEKTHFGGLKDEDR  59

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YGLHDPFLKGA+KRGDW+RTKDLV+KGTDWIVNE+KKS
Sbjct  60   IFTNLYGLHDPFLKGAMKRGDWHRTKDLVIKGTDWIVNEMKKS  102



>gb|ADN33976.1| NADH-ubiquinone oxidoreductase flavoprotein [Cucumis melo subsp. 
melo]
Length=480

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  226  LLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFT  405
            +L LQ   L +R   +WG+  R +S+Q A+   +PQ PPPPPPPEKTHFGGLKDEDRIFT
Sbjct  1    MLYLQHRTLARRYIDQWGIGLRAFSSQGAAAPGSPQPPPPPPPPEKTHFGGLKDEDRIFT  60

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            N+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKS
Sbjct  61   NLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKS  100



>ref|XP_009403957.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=509

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +1

Query  160  SHQRSVALRLRYLSPAMAPVKGLLSLQRTALVQRCSQKWGLNG-RFYSAQAASTANTPQS  336
            + +R V+  L  +     P+K L S+ R  L++  S     +  R +S Q A+T +TPQ 
Sbjct  6    ASRRVVSTSLPAIKSGSVPLKNLSSIYRAGLIRHSSGWRSFSACRSFSTQTATTGSTPQP  65

Query  337  pppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEV  516
            PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYRTKDLV+KG+DWIVNE+
Sbjct  66   PPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVVKGSDWIVNEM  125

Query  517  KKS  525
            KKS
Sbjct  126  KKS  128



>ref|XP_009385396.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQ-KWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKD  387
            AP+K L  L RT LV   S  +     R  S QAA+T NTPQ PPPPPPPEKTHFGGLKD
Sbjct  9    APIKNLCLLYRTELVHHFSGWRLSSASRSLSTQAATTGNTPQPPPPPPPPEKTHFGGLKD  68

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YGLHDP LKGA+KRGDWYRTKDLV+KG+DWIVNE+KKS
Sbjct  69   EDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVIKGSDWIVNEIKKS  114



>ref|XP_004136606.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163967.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Cucumis sativus]
Length=480

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +1

Query  226  LLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFT  405
            +L LQR +L +    +WG+  R +S+Q A+   +PQ P PPPPPEKTHFGGLKDEDRIFT
Sbjct  1    MLYLQRRSLARCYIDQWGIGLRAFSSQGAAAPGSPQPPAPPPPPEKTHFGGLKDEDRIFT  60

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            N+YGLHDPFLKGA+KRGDW+RTKDLVLKG DWIVNEVKKS
Sbjct  61   NLYGLHDPFLKGAMKRGDWHRTKDLVLKGADWIVNEVKKS  100



>ref|XP_010911159.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Elaeis guineensis]
Length=523

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ P PPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  64   RSFSTQAATTASTPQPPSPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYR  123

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  124  TKDLVLKGSDWIVNEMKKS  142



>ref|XP_009407142.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=495

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 3/107 (3%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNG--RFYSAQAASTANTPQSpppppppEKTHFGGLK  384
            AP+K   S  +  L+    + W LN   R  S QAA+T +TPQ PPPPPPPEKTHFGGLK
Sbjct  9    APLKNFSSRYKAELLHH-FKTWRLNSACRSLSTQAATTGSTPQPPPPPPPPEKTHFGGLK  67

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YGLHDP LKGA+KRGDWYRTKDLVLKG+DWIVNE+KKS
Sbjct  68   DEDRIFTNLYGLHDPLLKGAMKRGDWYRTKDLVLKGSDWIVNEIKKS  114



>ref|XP_010025340.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=483

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 5/107 (5%)
 Frame = +1

Query  208  MAPVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLK  384
            MAP++GLLSL++T L++      G+  R +S + A TA+ P SPPPPPPP EKTHFGGLK
Sbjct  1    MAPMRGLLSLRKTILLR----GQGIGVRSFSTEGAKTASAPPSPPPPPPPPEKTHFGGLK  56

Query  385  DEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            DEDRIFTN+YG+ DPFLKGA+KRGDWYRTKDLVLKGTDWIV+EVKKS
Sbjct  57   DEDRIFTNLYGMRDPFLKGAMKRGDWYRTKDLVLKGTDWIVSEVKKS  103



>ref|NP_001148767.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACG32826.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
Length=504

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAVKRGDWYR  105

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLV+KG DWIVNE+KKS
Sbjct  106  TKDLVIKGADWIVNEMKKS  124



>gb|ACL53142.1| unknown [Zea mays]
 tpg|DAA41608.1| TPA: LOW QUALITY PROTEIN: NADH-ubiquinone oxidoreductase subunit 
[Zea mays]
Length=504

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYR
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAVKRGDWYR  105

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLV+KG DWIVNE+KKS
Sbjct  106  TKDLVIKGADWIVNEMKKS  124



>ref|XP_003557368.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Brachypodium distachyon]
Length=535

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAAST++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  75   GRSFSTQAASTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  134

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLV+KG DWIVNE+KKS
Sbjct  135  RTKDLVIKGADWIVNEMKKS  154



>ref|XP_006827286.1| hypothetical protein AMTR_s00010p00264240 [Amborella trichopoda]
 gb|ERM94523.1| hypothetical protein AMTR_s00010p00264240 [Amborella trichopoda]
Length=487

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R+ + QA +T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YG+HDPFLKGA+KRGDW R
Sbjct  25   RYLNTQAPTTSSTPQLPPPPPPPEKTHFGGLKDEDRIFTNLYGMHDPFLKGAMKRGDWCR  84

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  85   TKDLVLKGSDWIVNEMKKS  103



>ref|XP_008799963.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X4 [Phoenix dactylifera]
Length=488

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  29   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  88

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  89   TKDLVLKGSDWIVNEMKKS  107



>ref|XP_006658044.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Oryza brachyantha]
Length=504

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  105  RTKDLVLKGADWIVNEMKKS  124



>ref|XP_008799961.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Phoenix dactylifera]
Length=523

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  64   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  123

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  124  TKDLVLKGSDWIVNEMKKS  142



>ref|XP_008799962.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X3 [Phoenix dactylifera]
Length=502

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  43   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  102

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  103  TKDLVLKGSDWIVNEMKKS  121



>ref|XP_008799960.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Phoenix dactylifera]
Length=531

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+TA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDP LKGA+KRGDWYR
Sbjct  72   RSFSTQAATTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPLLKGAMKRGDWYR  131

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG+DWIVNE+KKS
Sbjct  132  TKDLVLKGSDWIVNEMKKS  150



>gb|EMS64088.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Triticum urartu]
Length=500

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  40   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  99

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLV+KG DWIVNE+KKS
Sbjct  100  RTKDLVIKGADWIVNEMKKS  119



>gb|EMT32185.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, mitochondrial 
[Aegilops tauschii]
Length=500

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDWY
Sbjct  40   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWY  99

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLV+KG DWIVNE+KKS
Sbjct  100  RTKDLVIKGADWIVNEMKKS  119



>ref|XP_010025338.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW61975.1| hypothetical protein EUGRSUZ_H04659 [Eucalyptus grandis]
Length=484

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 5/106 (5%)
 Frame = +1

Query  211  APVKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSppppppp-EKTHFGGLKD  387
            AP++GLLSL++T L++      G+  R +S + A TA+ P SPPPPPPP EKTHFGGLKD
Sbjct  3    APMRGLLSLRKTILLR----GQGIGVRSFSTEGAKTASAPPSPPPPPPPPEKTHFGGLKD  58

Query  388  EDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EDRIFTN+YG+ DPFLKGA+KRGDWYRTKDLVLKGTDWIV+EVKKS
Sbjct  59   EDRIFTNLYGMRDPFLKGAMKRGDWYRTKDLVLKGTDWIVSEVKKS  104



>ref|NP_001141093.1| uncharacterized protein LOC100273176 [Zea mays]
 gb|ACF85385.1| unknown [Zea mays]
Length=504

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 13/112 (12%)
 Frame = +1

Query  229  LSLQRTALVQ------RCSQKWGLNG-------RFYSAQAASTANTPQSpppppppEKTH  369
            +S +R A ++      R      LNG       R  S QAA+T++TPQ PPPPPPPEKTH
Sbjct  13   ISFERKAAIEYIHSLSRAQPARSLNGAGLCPASRSLSTQAATTSSTPQPPPPPPPPEKTH  72

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  73   FGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  124



>gb|ACF84291.1| unknown [Zea mays]
 gb|ACG32615.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Zea mays]
 gb|ACR36181.1| unknown [Zea mays]
 tpg|DAA63904.1| TPA: NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=504

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 13/112 (12%)
 Frame = +1

Query  229  LSLQRTALVQ------RCSQKWGLNG-------RFYSAQAASTANTPQSpppppppEKTH  369
            +S +R A ++      R      LNG       R  S QAA+T++TPQ PPPPPPPEKTH
Sbjct  13   ISFERKAAIEYIHSLSRAQPARSLNGAGLCPASRSLSTQAATTSSTPQPPPPPPPPEKTH  72

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  73   FGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWYRTKDLVIKGADWIVNEMKKS  124



>ref|XP_004958515.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Setaria italica]
Length=504

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +S QAA+T++TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YGLHDPFLKGA+KRGDW+R
Sbjct  46   RSFSTQAATTSSTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWHR  105

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLVLKG DWIVNE+KKS
Sbjct  106  TKDLVLKGADWIVNEMKKS  124



>dbj|BAJ94094.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90021.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            GR +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YGLHDPFLKGA+KRGDW 
Sbjct  45   GRSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGLHDPFLKGAMKRGDWN  104

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLV+KG DWIVNE+KKS
Sbjct  105  RTKDLVIKGADWIVNEMKKS  124



>ref|XP_006838360.1| hypothetical protein AMTR_s00002p00015430 [Amborella trichopoda]
 gb|ERN00929.1| hypothetical protein AMTR_s00002p00015430 [Amborella trichopoda]
Length=485

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            ++ LLS  R++L Q  S+      R +S QA +T++TPQ P PPPPPEKTHFGGLKDEDR
Sbjct  1    MRNLLSFPRSSLTQHYSKGLVPFNRSFSTQAPTTSSTPQPPSPPPPPEKTHFGGLKDEDR  60

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IFTN+YG++DPFLKGA+KRGDWY+TKDL+LKG+DWIVNE+KKS
Sbjct  61   IFTNLYGINDPFLKGAMKRGDWYQTKDLILKGSDWIVNEMKKS  103



>dbj|BAG89406.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94744.1| unnamed protein product [Oryza sativa Japonica Group]
Length=411

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  105  RTKDLVLKGADWIVNEMKKS  124



>gb|EAZ40868.1| hypothetical protein OsJ_25349 [Oryza sativa Japonica Group]
Length=514

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  55   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  114

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  115  RTKDLVLKGADWIVNEMKKS  134



>ref|NP_001060455.1| Os07g0645400 [Oryza sativa Japonica Group]
 dbj|BAC16718.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF22369.1| Os07g0645400 [Oryza sativa Japonica Group]
Length=504

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  45   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  104

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  105  RTKDLVLKGADWIVNEMKKS  124



>gb|EAZ04909.1| hypothetical protein OsI_27090 [Oryza sativa Indica Group]
Length=529

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  286  GRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            G+ +S QAA+T++TPQ PPPPPPPEKTHFG LKDEDRIFTN+YG HDPFLKGA+KRGDW+
Sbjct  70   GKSFSTQAATTSSTPQPPPPPPPPEKTHFGDLKDEDRIFTNLYGQHDPFLKGAMKRGDWH  129

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  130  RTKDLVLKGADWIVNEMKKS  149



>ref|XP_006438083.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
 gb|ESR51323.1| hypothetical protein CICLE_v10033600mg, partial [Citrus clementina]
Length=454

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  310  ASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLK  489
            ASTA+TPQ PPPPPPPEKTHFGGLKDEDRIFTN+YG+HDPFLKGA+KRGDW+RTKDLVLK
Sbjct  3    ASTASTPQPPPPPPPPEKTHFGGLKDEDRIFTNLYGMHDPFLKGAMKRGDWHRTKDLVLK  62

Query  490  GTDWIVNEVKKS  525
            G DWIVNEVKKS
Sbjct  63   GADWIVNEVKKS  74



>ref|XP_001754412.1| predicted protein [Physcomitrella patens]
 gb|EDQ80862.1| predicted protein [Physcomitrella patens]
Length=462

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            A + S A  P  PPPPPP EKTHFGGLKDEDRIFTN+YGLHDPFL GA KRGDWYRTKDL
Sbjct  5    ATSGSQATAPPPPPPPPPAEKTHFGGLKDEDRIFTNLYGLHDPFLAGAKKRGDWYRTKDL  64

Query  481  VLKGTDWIVNEVKKS  525
            V KGTDWIVNEVKKS
Sbjct  65   VHKGTDWIVNEVKKS  79



>ref|XP_002977599.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
 gb|EFJ21603.1| hypothetical protein SELMODRAFT_443575 [Selaginella moellendorffii]
Length=483

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +1

Query  289  RFYSAQAAS-TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWY  465
            RF S QAAS +A    +PPPPP  E+T FGGLKDEDRIFTN+YG+HDPFLKGA+ RGDW+
Sbjct  22   RFMSVQAASKSATPQPAPPPPPATERTSFGGLKDEDRIFTNLYGIHDPFLKGAMARGDWH  81

Query  466  RTKDLVLKGTDWIVNEVKKS  525
            RTKDLVLKG DWIVNE+KKS
Sbjct  82   RTKDLVLKGPDWIVNEMKKS  101



>gb|ACE96388.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  52



>gb|ACE96363.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96364.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96367.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96368.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96370.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96371.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96373.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96374.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96375.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96376.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96377.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96378.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96379.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96380.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96381.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96382.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96383.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96384.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96385.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96386.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96389.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96391.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  52



>gb|ACE96365.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96366.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  52



>gb|ACE96369.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96372.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96387.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96390.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96392.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=408

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGLKDEDRIFTNVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    FGGLKDEDRIFTNVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  52



>ref|XP_001778863.1| predicted protein [Physcomitrella patens]
 gb|EDQ56313.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = +1

Query  298  SAQAAS--TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRT  471
            SAQA S   A  P  PPPPPP EKT FGGLKDEDRIFTN+YG+HDPFL GA KRGDW+RT
Sbjct  2    SAQATSGPQATAPPPPPPPPPAEKTQFGGLKDEDRIFTNLYGIHDPFLAGAKKRGDWHRT  61

Query  472  KDLVLKGTDWIVNEVKKS  525
            KDLVLKGTDWIVNE+KKS
Sbjct  62   KDLVLKGTDWIVNEMKKS  79



>ref|XP_002975195.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
 gb|EFJ23980.1| hypothetical protein SELMODRAFT_150347 [Selaginella moellendorffii]
Length=460

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            E+T FGGLKDEDRIFTN+YG+HDPFLKGA+ RGDW+RTKDLVLKG DWIVNE+KKS
Sbjct  23   ERTSFGGLKDEDRIFTNLYGIHDPFLKGAMARGDWHRTKDLVLKGPDWIVNEMKKS  78



>gb|KIY99198.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Monoraphidium 
neglectum]
Length=462

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            E+T FGGLKD+DRIFTN+YG HDP++KGA+ RGDWYRTKDLVLKG+DW+V+++KKS
Sbjct  14   ERTSFGGLKDDDRIFTNIYGRHDPYIKGAMARGDWYRTKDLVLKGSDWVVDQMKKS  69



>ref|XP_011398745.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25849.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Auxenochlorella protothecoides]
Length=462

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT FGGL+D+DRIFTN+YG HDPFLKGA KRGDW+RTKDLV KG DWIV+++KKS
Sbjct  19   EKTSFGGLEDKDRIFTNIYGRHDPFLKGAEKRGDWHRTKDLVSKGADWIVDQMKKS  74



>gb|KDD75042.1| respiratory-chain NADH dehydrogenase [Helicosporidium sp. ATCC 
50920]
Length=458

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT FGGL+D+DRIFTN+YG HDPF+KGA KRGDWYRTKD+++KG DWIV+++KKS
Sbjct  25   EKTSFGGLEDKDRIFTNLYGKHDPFIKGAEKRGDWYRTKDILVKGADWIVDQMKKS  80



>gb|KFB35861.1| hypothetical protein ZHAS_00002799 [Anopheles sinensis]
Length=865

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 70/98 (71%), Gaps = 13/98 (13%)
 Frame = +1

Query  232  SLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNV  411
            +++ +A+V  CS++     R  SAQA  +A  PQ+        +T FGGL D+DRIFTN+
Sbjct  23   AIRSSAVVADCSKQ---QVRRQSAQA--SAPPPQT--------RTKFGGLADQDRIFTNL  69

Query  412  YGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            YG HD  LKGA+KRGDWY+TK+++LKGTDWI+NE+K S
Sbjct  70   YGRHDWRLKGALKRGDWYKTKEILLKGTDWILNEIKVS  107



>ref|XP_005846008.1| NADH:ubiquinone oxidoreductase 51 kD subunit, partial [Chlorella 
variabilis]
 gb|EFN53906.1| NADH:ubiquinone oxidoreductase 51 kD subunit, partial [Chlorella 
variabilis]
Length=444

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            E+T FGGL D+DRIFTN+YG HDPF+KGA KRGDWYRTKD+V KG+DW+V+++KKS
Sbjct  1    ERTTFGGLADKDRIFTNIYGRHDPFIKGAEKRGDWYRTKDIVSKGSDWVVDQMKKS  56



>ref|XP_003058710.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57165.1| predicted protein [Micromonas pusilla CCMP1545]
Length=468

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  373  GGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            GGLKDEDRIFTN+YG HDPFLKGA+KRGDWY TKDL+L G DWIVNE+K S
Sbjct  40   GGLKDEDRIFTNLYGKHDPFLKGAMKRGDWYNTKDLMLMGPDWIVNEIKAS  90



>ref|XP_005650585.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
 gb|EIE26041.1| NADH-ubiquinone oxidoreductase [Coccomyxa subellipsoidea C-169]
Length=467

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 6/79 (8%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +SAQA+    TP         EKT +GGL+DEDRIFTN+Y   DPF+KGA+ RGDWYR
Sbjct  19   RSFSAQASPPPPTPPPS------EKTTYGGLRDEDRIFTNLYRQGDPFIKGAMARGDWYR  72

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKDLV KG+DWIV E+KKS
Sbjct  73   TKDLVEKGSDWIVGEMKKS  91



>gb|KHJ94492.1| NADH oxidoreductase, F subunit [Oesophagostomum dentatum]
Length=477

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 5/73 (7%)
 Frame = +1

Query  307  AASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVL  486
            AA+ A TPQ  P     EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TKD++L
Sbjct  23   AATAAPTPQKKP-----EKTSFGNLKDSDRIFTNLYGRHDYRLKGALARGDWYKTKDIIL  77

Query  487  KGTDWIVNEVKKS  525
            KG++WI+NEV+ S
Sbjct  78   KGSEWIINEVRTS  90



>ref|XP_002503039.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64297.1| predicted protein [Micromonas sp. RCC299]
Length=441

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +TH GGL DEDRIFTN+YG HDPFLKGA+KRGDWY TK+L+L G DWIVNE+K S
Sbjct  10   RTH-GGLSDEDRIFTNLYGKHDPFLKGAMKRGDWYNTKELMLMGPDWIVNEMKAS  63



>ref|XP_007514630.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
 emb|CCO14870.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Bathycoccus prasinos]
Length=512

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 1/55 (2%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +TH GGL D+DRIFTN+YG HDPF+KGA+KRGDWY TK+LVL G DWI+NE+K S
Sbjct  80   RTH-GGLTDQDRIFTNLYGKHDPFIKGAMKRGDWYNTKELVLMGADWIINEIKAS  133



>ref|XP_005534915.1| NADH dehydrogenase I flavoprotein 51kDa subunit [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM80308.1| NADH dehydrogenase I flavoprotein 51kDa subunit [Cyanidioschyzon 
merolae strain 10D]
Length=495

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  298  SAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKD  477
            S+  A+ A  P+         +  +G LKD+DRIFTN+YG  D FL GA+KRGDWYRTKD
Sbjct  30   SSSVATGAPAPKPETWRASNAERSYGLLKDQDRIFTNLYGERDAFLDGALKRGDWYRTKD  89

Query  478  LVLKGTDWIVNEVKKS  525
            LVLKG DWI+NE+K S
Sbjct  90   LVLKGRDWIINEIKAS  105



>emb|CBI40696.3| unnamed protein product [Vitis vinifera]
Length=98

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGG KDED IFTN+YGLHDPFLK A+K G WY+T D+VLKG+DWIV+E+K+S
Sbjct  20   FGGPKDEDCIFTNIYGLHDPFLKSAMKMGGWYKTGDIVLKGSDWIVSEMKES  71



>gb|ETN67150.1| NADH-ubiquinone oxidoreductase flavoprotein 1 (ndufv1) [Anopheles 
darlingi]
Length=489

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 59/79 (75%), Gaps = 10/79 (13%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  SAQA  +A  PQ+        +T FGGL D+DRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  41   RRQSAQA--SAPPPQT--------RTKFGGLADQDRIFTNLYGRHDWRLKGALKRGDWYK  90

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+++LKGTDWI+NE+K S
Sbjct  91   TKEILLKGTDWILNEIKVS  109



>gb|EIE75829.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus delemar 
RA 99-880]
Length=458

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R ++++AA   N        P   KT FGGL DEDRIFTNVY  HD  LKGA+KRGDWY+
Sbjct  10   RTFASEAAPNPNA------NPITGKTSFGGLSDEDRIFTNVYSKHDYRLKGALKRGDWYK  63

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+LVLKG +WI+NE+K+S
Sbjct  64   TKELVLKGPEWIINEMKES  82



>gb|EIE91504.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus delemar 
RA 99-880]
Length=457

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 6/79 (8%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R ++++AA   N        P   KT FGGL DEDRIFTNVY  HD  LKGA+KRGDWY+
Sbjct  10   RTFASEAAPNPNA------NPITGKTSFGGLSDEDRIFTNVYSKHDYKLKGALKRGDWYK  63

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+LVLKG +WI+NE+K+S
Sbjct  64   TKELVLKGPEWIINEMKES  82



>ref|XP_001847747.1| NADH dehydrogenase flavoprotein 1, mitochondrial [Culex quinquefasciatus]
 gb|EDS26851.1| NADH dehydrogenase flavoprotein 1, mitochondrial [Culex quinquefasciatus]
Length=474

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 8/82 (10%)
 Frame = +1

Query  280  LNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGD  459
            LN +    QA  TA  PQ+        +T FGGL D+DRIFTN+YG HD  LKGA+KRGD
Sbjct  23   LNKQQVRHQAQLTAPPPQT--------RTTFGGLADQDRIFTNLYGRHDWRLKGALKRGD  74

Query  460  WYRTKDLVLKGTDWIVNEVKKS  525
            WY+TK+++LKGT+WI+NE K S
Sbjct  75   WYKTKEILLKGTEWIINETKAS  96



>gb|ETN68323.1| NADH oxidoreductase, F subunit [Necator americanus]
Length=469

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TKD++LKG++WI+NEV+ S
Sbjct  27   EKTSFGNLKDSDRIFTNLYGRHDYHLKGALARGDWYKTKDIILKGSEWIINEVRTS  82



>emb|CEF69460.1| NADH dehydrogenase (Ubiquinone) flavoprotein 1 [Strongyloides 
ratti]
Length=479

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKTHFG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI+ E+  S
Sbjct  36   EKTHFGDLSDEDRIFTNLYGKHDYRLKGALKRGDWYKTKEIILKGQDWIIKEISTS  91



>tpg|DAA34498.1| TPA_inf: NADH dehydrogenase I subunit F [Amblyomma variegatum]
Length=122

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG LKDEDRIF N+YG HD  LKGA+ RGDWY+TK++VLKG DWI++E+KKS
Sbjct  41   KTKFGPLKDEDRIFQNLYGRHDWRLKGAMSRGDWYKTKEIVLKGPDWIIDEIKKS  95



>ref|XP_007439249.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Python bivittatus]
Length=466

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KTHFG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K S
Sbjct  31   KKTHFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGIDWILNEIKIS  86



>ref|XP_009012163.1| hypothetical protein HELRODRAFT_104983 [Helobdella robusta]
 gb|ESO09731.1| hypothetical protein HELRODRAFT_104983 [Helobdella robusta]
Length=414

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG LKDEDR+FTN+YG HD  LKGA+KRGDWY+TK+++LKGTDWI  EVKKS
Sbjct  39   KTKFGNLKDEDRVFTNLYGRHDWRLKGALKRGDWYKTKEILLKGTDWIQGEVKKS  93



>ref|XP_319184.4| AGAP010039-PA [Anopheles gambiae str. PEST]
 gb|EAA13847.5| AGAP010039-PA [Anopheles gambiae str. PEST]
Length=472

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 10/79 (13%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  SAQA  +A  PQ+        KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  25   RLQSAQA--SAPPPQT--------KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWYK  74

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+++LKGTDWI+NE+K S
Sbjct  75   TKEILLKGTDWILNEMKVS  93



>emb|CDJ87526.1| unnamed protein product [Haemonchus contortus]
Length=513

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+NEV+KS
Sbjct  69   EKTTFGNLKDTDRIFTNLYGRHDYRLKGALARGDWYKTKEIILKGSEWIINEVRKS  124



>gb|ABF18316.1| mitochondrial NADH:ubiquinone oxidoreductase NDUFV1/51 kDa subunit 
[Aedes aegypti]
Length=486

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 10/79 (13%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  SAQA  +A  PQ+        KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  40   RQQSAQA--SAPPPQT--------KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWYK  89

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+++LKGTDWI+NE+K S
Sbjct  90   TKEILLKGTDWIINEIKVS  108



>ref|XP_001658587.1| AAEL007681-PA [Aedes aegypti]
 gb|EAT40595.1| AAEL007681-PA [Aedes aegypti]
Length=487

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 10/79 (13%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  SAQA  +A  PQ+        KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  40   RQQSAQA--SAPPPQT--------KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWYK  89

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK+++LKGTDWI+NE+K S
Sbjct  90   TKEILLKGTDWIINEIKVS  108



>emb|CEI93034.1| Putative NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus 
microsporus]
 emb|CEI91903.1| Putative NADH dehydrogenase [ubiquinone] flavoprotein 1 [Rhizopus 
microsporus]
Length=277

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L DEDRIFTN+Y  HD  LKGA+KRGDWY+TK+LVLKG +WI+NE+K+S
Sbjct  46   KTTFGSLSDEDRIFTNLYSKHDYRLKGALKRGDWYKTKELVLKGPEWIINEMKES  100



>gb|EKC98180.1| NADH-ubiquinone oxidoreductase 51 kDa subunit [Trichosporon asahii 
var. asahii CBS 8904]
Length=515

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R +++ AA    TP      P     H+GGLKD+DRIFTN+Y  HDP +KGA KRGDWYR
Sbjct  28   RTFASSAACNLATPADSTATPVR---HYGGLKDQDRIFTNLYLRHDPGIKGAEKRGDWYR  84

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TKD++LKG  WI+N +K+S
Sbjct  85   TKDILLKGDTWIINTIKES  103



>ref|XP_002014219.1| GL19080 [Drosophila persimilis]
 gb|EDW28215.1| GL19080 [Drosophila persimilis]
Length=477

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  S QA      P          KT FG L DEDRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  27   RLQSTQAPPAGTPPPQT-------KTKFGPLADEDRIFTNLYGRHDWRLKGALKRGDWYK  79

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK++VLKG +WI+NE+K S
Sbjct  80   TKEIVLKGPNWIINEIKTS  98



>ref|XP_001357188.1| GA21571 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL34256.1| GA21571 [Drosophila pseudoobscura pseudoobscura]
Length=477

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  289  RFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYR  468
            R  S QA      P          KT FG L DEDRIFTN+YG HD  LKGA+KRGDWY+
Sbjct  27   RLQSTQAPPAGTPPPQT-------KTKFGPLADEDRIFTNLYGRHDWRLKGALKRGDWYK  79

Query  469  TKDLVLKGTDWIVNEVKKS  525
            TK++VLKG +WI+NE+K S
Sbjct  80   TKEIVLKGPNWIINEIKTS  98



>ref|XP_002948368.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
 gb|EFJ50775.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Volvox carteri 
f. nagariensis]
Length=489

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 3/103 (3%)
 Frame = +1

Query  217  VKGLLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDR  396
            V  L S+Q T  +Q    K G+  R +S QA +  N    PPPPPPP KT FGGLKD+DR
Sbjct  8    VAQLASVQLTGALQEL--KTGVL-RAFSTQAPAAGNVAAPPPPPPPPAKTSFGGLKDDDR  64

Query  397  IFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            IF N+YG HD  +KGA+ RGDWY TK+LVLKG DWI++++KKS
Sbjct  65   IFQNIYGRHDTSIKGAMSRGDWYMTKELVLKGRDWIIDQMKKS  107



>gb|AAL89893.1| RE33648p [Drosophila melanogaster]
Length=239

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTS  98



>gb|KFH71991.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Mortierella verticillata NRRL 6337]
Length=473

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +T FG LKDEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI++E+K S
Sbjct  41   RTSFGSLKDEDRIFTNIYGFHDYKLKGALKRGDWYKTKEILLKGHDWILDEMKAS  95



>ref|XP_003451045.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Oreochromis niloticus]
Length=472

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ   P    +KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQQVKP----KKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  63

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKS  525
            RGDWY+TK+++LKG DWI+NEVK S
Sbjct  64   RGDWYKTKEIILKGQDWILNEVKIS  88



>ref|XP_005864550.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Myotis brandtii]
Length=466

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  304  QAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLV  483
            +A S+A  P        P+KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++
Sbjct  12   KAQSSAGPPDPLCLQTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEIL  71

Query  484  LKGTDWIVNEVKKS  525
            LKG DWI+ E+K S
Sbjct  72   LKGPDWILGEIKTS  85



>gb|KFV66989.1| hypothetical protein N307_09226, partial [Picoides pubescens]
Length=67

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L+DEDRIFTN+YG H+  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  4    KKTQFGSLRDEDRIFTNLYGRHEWRLQGALRRGDWYKTKEILLKGVDWILGEIKAS  59



>ref|XP_005333391.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ictidomys tridecemlineatus]
Length=494

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  313  STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKG  492
            S+A +P +  P   P+KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG
Sbjct  43   SSAGSPDTGSPQTAPKKTTFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKG  102

Query  493  TDWIVNEVKKS  525
             DWI+ E+K S
Sbjct  103  PDWILGEIKAS  113



>ref|XP_002631183.1| C. briggsae CBR-NUO-1 protein [Caenorhabditis briggsae]
 emb|CAP23643.1| Protein CBR-NUO-1 [Caenorhabditis briggsae]
Length=479

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 6/74 (8%)
 Frame = +1

Query  304  QAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLV  483
            ++A  ANTP         EKT FG LKD DRIFTN+YG HD  LKGA  RGDWY+TK+++
Sbjct  27   KSAQNANTPAKQ------EKTSFGNLKDSDRIFTNLYGRHDYRLKGAQARGDWYKTKEII  80

Query  484  LKGTDWIVNEVKKS  525
            LKG+DWI+ E+K S
Sbjct  81   LKGSDWILGELKTS  94



>gb|EFX78613.1| hypothetical protein DAPPUDRAFT_53209 [Daphnia pulex]
Length=437

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +T FG LKDEDRIFTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NEVKKS
Sbjct  2    QTKFGPLKDEDRIFTNLYGRHDWRLSGAMKRGDWYKTKEILLKGVDWILNEVKKS  56



>ref|XP_006804891.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Neolamprologus brichardi]
Length=471

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKS  525
            RGDWY+TK+++LKG DWI+NEVK S
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKIS  87



>ref|XP_008290476.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
flavoprotein 1, mitochondrial-like [Stegastes partitus]
Length=447

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG+DWI+NEVK S
Sbjct  32   KKTQFGPLSDQDRIFTNLYGRHDWRLKGALKRGDWYKTKEIILKGSDWILNEVKVS  87



>ref|XP_005472675.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Oreochromis niloticus]
Length=471

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTKFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKS  525
            RGDWY+TK+++LKG DWI+NEVK S
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKIS  87



>ref|XP_005177827.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Musca domestica]
Length=474

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FGGL D+DRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWI+NE+K S
Sbjct  47   FGGLADQDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIINEIKTS  98



>ref|XP_003969349.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Takifugu rubripes]
Length=472

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            +QA  +A T  +      P+KT FG L DEDRIFTN+YG HD  LKGA++RGDWY+TK++
Sbjct  20   SQAGVSAITRFNSTAQSTPKKTTFGPLADEDRIFTNLYGRHDWRLKGALRRGDWYKTKEI  79

Query  481  VLKGTDWIVNEVKKS  525
            +LKG DWI+NE+K S
Sbjct  80   LLKGVDWILNEIKVS  94



>ref|XP_003215041.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Anolis carolinensis]
Length=467

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K S
Sbjct  32   KKTQFGPLKDEDRIFTNLYGRHDWGLKGALSRGDWYKTKEILLKGVDWILNEIKTS  87



>ref|XP_010739964.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Larimichthys crocea]
Length=472

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            +Q   TA T  +      P+KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+TK++
Sbjct  20   SQGGVTAITRFNSTAQSAPKKTTFGPLADQDRIFTNLYGRHDWRLKGALKRGDWYKTKEI  79

Query  481  VLKGTDWIVNEVKKS  525
            +LKG DWI+NEVK S
Sbjct  80   LLKGVDWILNEVKVS  94



>emb|CAG05422.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=179

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  LKGA++RGDWY+TK+++LKG DWI+NE+K S
Sbjct  39   KKTTFGPLADEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGVDWILNEIKVS  94



>gb|ETE69752.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ophiophagus hannah]
Length=465

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K S
Sbjct  31   KKTQFGPLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGVDWILNEIKTS  86



>ref|XP_006010402.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Latimeria chalumnae]
Length=475

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 9/75 (12%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            + AA   N P+         KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK++
Sbjct  30   SSAAPQQNAPK---------KTKFGPLKDEDRIFTNLYGRHDWGLKGALSRGDWYKTKEI  80

Query  481  VLKGTDWIVNEVKKS  525
            +LKG DWI+NEVK S
Sbjct  81   LLKGVDWILNEVKIS  95



>gb|AAB24883.1| mitochondrial NADH:ubiquinone oxidoreductase 51 kda subunit [Homo 
sapiens]
Length=130

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEVKTS  83



>gb|EMP26020.1| NADH dehydrogenase [ubiquinone] flavoprotein 1 [Chelonia mydas]
Length=583

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K S
Sbjct  148  KKTQFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGIDWILNEIKTS  203



>ref|XP_004541258.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Maylandia zebra]
 ref|XP_005732102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Pundamilia nyererei]
 ref|XP_005946692.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Haplochromis burtoni]
Length=472

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 5/85 (6%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ   P    +KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQQVKP----KKTIFGPLSDQDRIFTNLYGRHDWRLKGALK  63

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKS  525
            RGDWY+TK+++LKG DWI+NEVK S
Sbjct  64   RGDWYKTKEIILKGQDWILNEVKIS  88



>gb|AEE61949.1| unknown [Dendroctonus ponderosae]
 gb|ENN72318.1| hypothetical protein YQE_11061, partial [Dendroctonus ponderosae]
 gb|ERL85747.1| hypothetical protein D910_03162 [Dendroctonus ponderosae]
Length=473

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L DEDR+FTN+YG HD  LKGA+KRGDWY+TK+++LKG+DWIVNE+K S
Sbjct  40   KTSFGPLADEDRVFTNLYGRHDWRLKGAMKRGDWYKTKEILLKGSDWIVNELKTS  94



>gb|ERE77238.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, partial [Cricetulus 
griseus]
Length=91

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K S
Sbjct  4    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKAS  59



>gb|KIH53381.1| putative NADH oxidoreductase, F subunit [Ancylostoma duodenale]
Length=580

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  364  THFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            T FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+NEV+ S
Sbjct  48   TSFGNLKDSDRIFTNLYGRHDYRLKGALARGDWYKTKEIILKGSEWIINEVRTS  101



>ref|XP_004531680.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Ceratitis capitata]
Length=474

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DR+FTN+YG HD  LKGA+KRGDWY+TK+++LKGTDWI+NE+K S
Sbjct  44   KTKFGNLADQDRVFTNLYGRHDWRLKGALKRGDWYKTKEILLKGTDWIINELKTS  98



>gb|EGT44910.1| CBN-NUO-1 protein [Caenorhabditis brenneri]
Length=479

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  316  TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGT  495
               + Q+       EKT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG+
Sbjct  25   VVTSAQNANAQVKQEKTSFGNLKDSDRIFTNLYGRHDYRLKGALSRGDWYKTKEIILKGS  84

Query  496  DWIVNEVKKS  525
            DWI+ E+K S
Sbjct  85   DWILGELKTS  94



>ref|XP_004541259.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Maylandia zebra]
 ref|XP_005732103.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Pundamilia nyererei]
 ref|XP_005946693.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Haplochromis burtoni]
Length=471

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 6/85 (7%)
 Frame = +1

Query  274  WGLNGRFYSAQAA-STANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIK  450
            WG   R  + +   STA  PQ       P+KT FG L D+DRIFTN+YG HD  LKGA+K
Sbjct  8    WGAVARQVAPRLTYSTAAQPQ-----VKPKKTIFGPLSDQDRIFTNLYGRHDWRLKGALK  62

Query  451  RGDWYRTKDLVLKGTDWIVNEVKKS  525
            RGDWY+TK+++LKG DWI+NEVK S
Sbjct  63   RGDWYKTKEIILKGQDWILNEVKIS  87



>ref|XP_010883102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Esox lucius]
Length=410

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKGTDWI+NEVK S
Sbjct  48   KTQFGPLSDQDRIFTNLYGRHDWSLKGALSRGDWYKTKEILLKGTDWILNEVKVS  102



>ref|XP_011194045.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Bactrocera cucurbitae]
Length=475

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+TK+++LKGTDWI+NE+K S
Sbjct  45   KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWYKTKEILLKGTDWIINELKTS  99



>gb|KHN76766.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Toxocara canis]
Length=743

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = +1

Query  244  TALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLH  423
            TA+  R  Q+ G++     A+  +TA  P+    P   +KT FG L D+DRIFTN+YG H
Sbjct  27   TAIGSRALQRNGIS--VCCARTVATAAPPKKEQKP---QKTTFGPLSDDDRIFTNLYGRH  81

Query  424  DPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            D  LKGA+ RGDWY+TK+++LKG DWI+ EV  S
Sbjct  82   DYRLKGALARGDWYKTKEIILKGQDWILKEVSAS  115



>gb|ETO35987.1| hypothetical protein RFI_01076 [Reticulomyxa filosa]
Length=591

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG LKDEDRIFTN+Y   DPF++GA+KRGDWYRTKD++  G DWI+NE+KKS
Sbjct  47   KTTFGNLKDEDRIFTNIYRDGDPFIEGALKRGDWYRTKDILGMGRDWIINEMKKS  101



>tpg|DAA41609.1| TPA: NADH-ubiquinone oxidoreductase subunit, mRNA [Zea mays]
Length=468

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/42 (88%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = +1

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FTN+YGLHDPFLKGA+KRGDWYRTKDLV+KG DWIVNE+KKS
Sbjct  47   FTNLYGLHDPFLKGAVKRGDWYRTKDLVIKGADWIVNEMKKS  88



>ref|XP_002038046.1| GM17964 [Drosophila sechellia]
 gb|EDW54464.1| GM17964 [Drosophila sechellia]
Length=435

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  36   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTS  87



>gb|ACO12806.1| NADH dehydrogenase flavoprotein 1, mitochondrial precursor [Lepeophtheirus 
salmonis]
Length=463

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK++VLKG DWI+NEVK S
Sbjct  28   KTKFGPLKDSDRIFTNLYGRHDWRLKGAMSRGDWYKTKEIVLKGADWIINEVKVS  82



>ref|XP_011403421.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Amphimedon queenslandica]
Length=466

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT +G LKD+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWIV E+K+S
Sbjct  30   EKTSYGNLKDQDRIFTNLYGRHDWKLKGALSRGDWYKTKEIILKGRDWIVKEIKES  85



>ref|XP_002799509.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Macaca mulatta]
Length=335

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_011204925.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Bactrocera dorsalis]
Length=474

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DRIFTN+YG HD  LKGA+KRGDW+RTK+++LKG+DWI+NE+K S
Sbjct  44   KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWHRTKEIILKGSDWIINELKTS  98



>ref|XP_008282052.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Stegastes partitus]
Length=472

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 10/102 (10%)
 Frame = +1

Query  226  LLSLQRTAL--VQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRI  399
            +LSL R  +  V R        G     +  STA +P         +KT +G L DEDRI
Sbjct  1    MLSLSRAVVSGVARAPAAVSPGGVTALTRFNSTAQSPP--------KKTTYGPLADEDRI  52

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FTN+YG HD  LKGA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  53   FTNLYGRHDWRLKGALKRGDWYKTKEILLKGVDWILNEIKVS  94



>ref|XP_011204917.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Bactrocera dorsalis]
Length=479

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DRIFTN+YG HD  LKGA+KRGDW+RTK+++LKG+DWI+NE+K S
Sbjct  49   KTKFGPLADQDRIFTNLYGRHDWRLKGALKRGDWHRTKEIILKGSDWIINELKTS  103



>ref|XP_008329578.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Cynoglossus semilaevis]
Length=473

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (60%), Gaps = 10/102 (10%)
 Frame = +1

Query  226  LLSLQRTAL--VQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRI  399
            +LSL R  +  V R        G     +  ST  TP         +KT FG L DEDRI
Sbjct  1    MLSLSRAVVSGVTRAPAAISQGGVSALTRFNSTGQTPP--------KKTTFGPLADEDRI  52

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FTN+YG HD  LKGA KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  53   FTNLYGRHDWGLKGAQKRGDWYKTKEILLKGVDWILNEIKTS  94



>ref|XP_010883100.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Esox lucius]
 ref|XP_010883101.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Esox lucius]
Length=486

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKGTDWI+NEVK S
Sbjct  48   KTQFGPLSDQDRIFTNLYGRHDWSLKGALSRGDWYKTKEILLKGTDWILNEVKVS  102



>ref|XP_002078321.1| GD22602 [Drosophila simulans]
 gb|EDX03906.1| GD22602 [Drosophila simulans]
Length=499

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTS  98



>ref|XP_001969499.1| GG10139 [Drosophila erecta]
 gb|EDV58558.1| GG10139 [Drosophila erecta]
Length=474

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGAMKRGDWYKTKEIVLKGADWIVNEIKTS  98



>ref|XP_002089130.1| GE18950 [Drosophila yakuba]
 gb|EDW88842.1| GE18950 [Drosophila yakuba]
Length=474

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTS  98



>ref|NP_608987.1| CG9140, isoform A [Drosophila melanogaster]
 ref|NP_001285657.1| CG9140, isoform B [Drosophila melanogaster]
 gb|AAF52334.1| CG9140, isoform A [Drosophila melanogaster]
 gb|AAK93066.1| GM14163p [Drosophila melanogaster]
 gb|ACL85431.1| CG9140-PA, partial [synthetic construct]
 gb|ACL90279.1| CG9140-PA [synthetic construct]
 gb|AHN54172.1| CG9140, isoform B [Drosophila melanogaster]
Length=474

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWIVNE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGADWIVNEIKTS  98



>emb|CEG66995.1| Putative NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial 
[Rhizopus microsporus]
Length=476

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L DEDRIFTN+Y  HD  LKGA+KRGDWY+TK+LVLKG +WI+NE+K+S
Sbjct  46   KTTFGSLSDEDRIFTNLYSKHDYRLKGALKRGDWYKTKELVLKGPEWIINEMKES  100



>ref|XP_010731123.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Larimichthys crocea]
Length=472

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 9/77 (12%)
 Frame = +1

Query  295  YSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTK  474
            YS  AA     P+         KT FG L D+DRIFTN+YG HD  LKG++KRGDWY+TK
Sbjct  21   YSTAAAQPQVKPK---------KTKFGPLSDQDRIFTNLYGRHDWRLKGSLKRGDWYKTK  71

Query  475  DLVLKGTDWIVNEVKKS  525
            +++LKG+DWI+NEVK S
Sbjct  72   EIILKGSDWILNEVKIS  88



>emb|CDW52647.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Trichuris trichiura]
Length=481

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+ EVK+S
Sbjct  38   QKTTFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGSEWIIQEVKES  93



>ref|XP_003941287.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, 
partial [Saimiri boliviensis boliviensis]
Length=358

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_005243468.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Falco peregrinus]
Length=465

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
             QA +TA T         P+KT FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK++
Sbjct  19   GQAGATAKT--------APKKTQFGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEI  70

Query  481  VLKGTDWIVNEVKKS  525
            +LKG DWI+ E+K S
Sbjct  71   LLKGVDWILGEIKAS  85



>gb|ACE96395.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96396.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96397.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96398.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  40



>gb|ACE96394.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96399.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  40



>gb|ACE96393.1| esterase/lipase/thioesterase, partial [Populus tremula]
 gb|ACE96400.1| esterase/lipase/thioesterase, partial [Populus tremula]
Length=396

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  406  NVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            NVYGLHDPF KGA+KRGDWYRTKDLVLKGTDWIVNEVKKS
Sbjct  1    NVYGLHDPFFKGAMKRGDWYRTKDLVLKGTDWIVNEVKKS  40



>ref|XP_008145081.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Eptesicus fuscus]
Length=455

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK S
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKAS  74



>gb|KFD48778.1| hypothetical protein M513_10333 [Trichuris suis]
 gb|KFD69329.1| hypothetical protein M514_10333 [Trichuris suis]
 gb|KHJ41823.1| NADH oxidoreductase, F subunit [Trichuris suis]
Length=477

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+ EVK+S
Sbjct  34   QKTTFGPLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGSEWIIREVKES  89



>ref|XP_004073740.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Oryzias latipes]
Length=472

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  LKGA++RGDWY+TK+++LKG DWI+NE+K S
Sbjct  39   KKTKFGPLADEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGVDWILNEIKGS  94



>ref|XP_008145080.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Eptesicus fuscus]
Length=464

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKAS  83



>ref|XP_005796523.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X1 [Xiphophorus maculatus]
Length=484

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 10/102 (10%)
 Frame = +1

Query  226  LLSLQRTAL--VQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRI  399
            +LSL R+ +  V R        G     +  STA T         P+KT FG L DEDRI
Sbjct  12   MLSLSRSVVGAVARAPAAISQGGVTTLCRFNSTAQT--------APKKTKFGPLADEDRI  63

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  64   FTNLYGRHDWRLNGALKRGDWYKTKEILLKGVDWILNEIKVS  105



>gb|EHJ68778.1| NADH dehydrogenase flavoprotein 1 ubiquinone [Danaus plexippus]
Length=473

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L D DRIFTN+YG HD  L+GA++RGDWY+TK+++LKGTDWIVNE+K S
Sbjct  36   KTSFGPLADSDRIFTNLYGRHDWRLRGALQRGDWYKTKEIILKGTDWIVNELKTS  90



>ref|XP_002065333.1| GK15392 [Drosophila willistoni]
 gb|EDW76319.1| GK15392 [Drosophila willistoni]
Length=478

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK++VLKG DWI+NE+K S
Sbjct  47   FGPLADEDRIFTNLYGRHDWRLKGALKRGDWYKTKEIVLKGPDWIINEIKTS  98



>ref|XP_003117363.1| CRE-NUO-1 protein [Caenorhabditis remanei]
 gb|EFO86229.1| CRE-NUO-1 protein [Caenorhabditis remanei]
Length=479

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +1

Query  280  LNGRFYSAQAASTA-----NTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGA  444
            L  R    +A+  A      + Q+       EKT FG LKD DRIFTN+YG HD  LKGA
Sbjct  8    LGARLIGQKASKVAVRGVVTSAQNSNAQVKQEKTSFGNLKDSDRIFTNLYGRHDYRLKGA  67

Query  445  IKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            + RGDW++TK+++LKG+DWI+ E+K S
Sbjct  68   MARGDWHKTKEIILKGSDWILGELKTS  94



>ref|XP_002435466.1| NADH:ubiquinone oxidoreductase, NDUFV1/51kDa subunit, putative 
[Ixodes scapularis]
 gb|EEC08296.1| NADH:ubiquinone oxidoreductase, NDUFV1/51kDa subunit, putative 
[Ixodes scapularis]
Length=477

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L DEDRIF N+YG HD  LKGA+ RGDWY+TK++VLKG DWI++E+KKS
Sbjct  42   KTKFGPLSDEDRIFQNLYGRHDWRLKGAMSRGDWYKTKEIVLKGADWIIDEIKKS  96



>ref|XP_003083193.1| PREDICTED P0503D09.102 gene product [Oryza sativa (ISS) [Ostreococcus 
tauri]
 emb|CAL57468.1| NADH ubiquinone oxidoreductase, F subunit, iron sulphur binding 
[Ostreococcus tauri]
Length=491

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            E+TH G L D DRIFTN+YG HDPFLKGA+ RGDWY TK LV  G DWIVNE+K S
Sbjct  59   ERTH-GNLSDADRIFTNLYGRHDPFLKGAMARGDWYETKKLVELGADWIVNEMKAS  113



>ref|XP_005796524.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Xiphophorus maculatus]
Length=473

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 63/102 (62%), Gaps = 10/102 (10%)
 Frame = +1

Query  226  LLSLQRTAL--VQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRI  399
            +LSL R+ +  V R        G     +  STA T         P+KT FG L DEDRI
Sbjct  1    MLSLSRSVVGAVARAPAAISQGGVTTLCRFNSTAQT--------APKKTKFGPLADEDRI  52

Query  400  FTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  53   FTNLYGRHDWRLNGALKRGDWYKTKEILLKGVDWILNEIKVS  94



>ref|XP_005140501.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like, 
partial [Melopsittacus undulatus]
Length=410

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  3    KKTQFGSLKDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILAEIKAS  58



>ref|XP_010790716.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Notothenia coriiceps]
Length=483

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  301  AQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDL  480
            +Q   T+ T  +      P+KT +G L D+DRIFTN+YG HD  LKGA+KRGDWY+TK++
Sbjct  20   SQGGVTSITRYNSTAQTAPKKTTYGPLADQDRIFTNLYGRHDWRLKGALKRGDWYKTKEI  79

Query  481  VLKGTDWIVNEVKKS  525
            +LKG DWI+NEVK S
Sbjct  80   LLKGVDWILNEVKVS  94



>dbj|BAG62399.1| unnamed protein product [Homo sapiens]
Length=335

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKG++ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_007962396.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Chlorocebus sabaeus]
Length=464

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEVKTS  83



>gb|AFK11344.1| NADH dehydrogenase ubiquinone flavoprotein 1 precursor [Callorhinchus 
milii]
Length=465

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT +G L D DRIFTN+YGLHD  LKGA+ RGDWY+TK+++LKG DWI++EVKKS
Sbjct  33   KTKYGPLSDSDRIFTNLYGLHDWGLKGALSRGDWYKTKEILLKGVDWILDEVKKS  87



>ref|NP_001164305.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tribolium castaneum]
 gb|EFA04664.1| hypothetical protein TcasGA2_TC014119 [Tribolium castaneum]
Length=478

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG+DWI+NE+K S
Sbjct  47   FGPLSDEDRIFTNLYGKHDWRLKGALKRGDWYKTKEILLKGSDWIINEIKTS  98



>gb|KFO80505.1| hypothetical protein N303_05672, partial [Cuculus canorus]
Length=60

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  1    FGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILGEIKTS  52



>gb|ADI40704.1| NADH dehydrogenase flavoprotein 1, 51kDa [Cynopterus sphinx]
 gb|ADI40705.1| NADH dehydrogenase flavoprotein 1, 51kDa [Rousettus leschenaultii]
Length=275

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKAS  63



>ref|XP_004366877.1| ubiquinone oxidoreductase [Dictyostelium fasciculatum]
 gb|EGG19894.1| ubiquinone oxidoreductase [Dictyostelium fasciculatum]
Length=473

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +GGLKD+DRIFTN+YG HD +LKGAI RGDWYRTKDL+ KG DWI+ E+  S
Sbjct  43   YGGLKDKDRIFTNLYGEHDVYLKGAIARGDWYRTKDLIGKGKDWIIKEMMAS  94



>gb|AAB03672.1| ndufv1 [Dictyostelium discoideum]
Length=479

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
             R   V + +   GL G+ + A   +T +T Q            +GGLKD+DRIFTN+YG
Sbjct  6    NRVKSVIKLTSTTGLTGKNFQATKVATFSTAQVQQAQENVRS--YGGLKDKDRIFTNLYG  63

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
             HD +LKGAI RGDWY+TK+++ KG DWI+ E+  S
Sbjct  64   EHDVYLKGAIARGDWYKTKNIIDKGKDWILKEMMAS  99



>gb|ACO10172.1| NADH dehydrogenase flavoprotein 1, mitochondrial precursor [Osmerus 
mordax]
Length=472

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L D+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+NE+K S
Sbjct  39   KKTTFGPLSDQDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGVDWIINEIKSS  94



>ref|XP_003419441.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Loxodonta africana]
Length=464

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_002755638.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Callithrix jacchus]
Length=464

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_003378967.1| putative NADH oxidoreductase, F subunit [Trichinella spiralis]
 gb|EFV61427.1| putative NADH oxidoreductase, F subunit [Trichinella spiralis]
Length=709

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWIV E+ KS
Sbjct  275  KTKFGNLKDEDRIFTNLYGRHDWKLKGALSRGDWYKTKEILLKGEDWIVKEITKS  329



>ref|XP_002162472.2| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Hydra vulgaris]
Length=446

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +1

Query  250  LVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDP  429
            +V R S  W      ++     +   P+        +KT FG L D+DRIFTN+YG HD 
Sbjct  5    IVSRSSNAWNFGRVCFTHNRLQSTEAPK--------QKTKFGPLSDDDRIFTNLYGRHDW  56

Query  430  FLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
             LKGA  RGDWY+TK+++LKG DWI+NE+K S
Sbjct  57   KLKGAQARGDWYKTKEIILKGHDWILNEIKTS  88



>ref|XP_008420425.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Poecilia reticulata]
Length=483

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  50   KKTKFGPLADEDRIFTNLYGRHDWRLNGALKRGDWYKTKEILLKGVDWILNEIKVS  105



>ref|XP_009095507.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Serinus canaria]
Length=427

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  22   KKTQFGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILGEIKTS  77



>ref|XP_636489.1| ubiquinone oxidoreductase [Dictyostelium discoideum AX4]
 sp|Q54I90.1|NDUV1_DICDI RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Dictyostelium discoideum]
 gb|EAL62961.1| ubiquinone oxidoreductase [Dictyostelium discoideum AX4]
Length=479

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +1

Query  238  QRTALVQRCSQKWGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYG  417
             R   V + +   GL G+ + A   +T +T Q            +GGLKD+DRIFTN+YG
Sbjct  6    NRVKSVIKLTSTTGLTGKDFQATKVATFSTAQVQQAQENVRS--YGGLKDKDRIFTNLYG  63

Query  418  LHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
             HD +LKGAI RGDWY+TK+++ KG DWI+ E+  S
Sbjct  64   EHDVYLKGAIARGDWYKTKNIIDKGKDWILKEMMAS  99



>ref|XP_008048441.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Tarsius syrichta]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_010773860.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
isoform X2 [Notothenia coriiceps]
Length=476

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  LKG++KRGDW++TK+++LKGTDWI+NEVK S
Sbjct  37   KKTTFGPLSDEDRIFTNLYGRHDWRLKGSMKRGDWHKTKEILLKGTDWILNEVKVS  92



>ref|NP_496376.1| Protein NUO-1 [Caenorhabditis elegans]
 emb|CAA90435.1| NUO-1 [Caenorhabditis elegans]
Length=479

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  316  TANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGT  495
               + Q+       EKT FG LKD DRIFTN+YG HD  LKGA+ RGDW++TK+++LKG+
Sbjct  25   VVTSAQNANAQVKQEKTSFGNLKDSDRIFTNLYGRHDYRLKGAMARGDWHKTKEIILKGS  84

Query  496  DWIVNEVKKS  525
            DWI+ E+K S
Sbjct  85   DWILGELKTS  94



>ref|XP_005577102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Macaca fascicularis]
Length=455

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  74



>ref|XP_010562605.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Haliaeetus leucocephalus]
Length=457

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  22   KKTQFGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILGEIKAS  77



>ref|NP_001266473.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Gorilla 
gorilla]
 sp|Q0MQI5.1|NDUV1_GORGO RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Gorilla gorilla gorilla]
 gb|ABH12158.1| mitochondrial complex I subunit NDUFV1 [Gorilla gorilla]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_005529102.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Pseudopodoces humilis]
Length=457

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  22   KKTQFGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILGEIKTS  77



>ref|XP_005046765.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Ficedula albicollis]
Length=457

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L+DEDRIFTN+YG HD  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  22   KKTQFGSLRDEDRIFTNLYGRHDWRLQGALRRGDWYKTKEILLKGVDWILGEIKTS  77



>ref|NP_598427.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
precursor [Mus musculus]
 sp|Q91YT0.1|NDUV1_MOUSE RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Mus musculus]
 gb|AAH14818.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Mus musculus]
 dbj|BAC35893.1| unnamed protein product [Mus musculus]
 gb|AAH41682.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Mus musculus]
 gb|EDL32990.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, isoform CRA_b 
[Mus musculus]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGPDWILGEMKTS  83



>ref|XP_008420426.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Poecilia reticulata]
Length=472

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  39   KKTKFGPLADEDRIFTNLYGRHDWRLNGALKRGDWYKTKEILLKGVDWILNEIKVS  94



>gb|EHH56026.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Macaca fascicularis]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>dbj|BAE90673.1| unnamed protein product [Macaca fascicularis]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>sp|Q0MQI4.1|NDUV1_PONPY RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Pongo pygmaeus]
 gb|ABH12159.1| mitochondrial complex I subunit NDUFV1 [Pongo pygmaeus]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|NP_001032653.1| uncharacterized protein LOC641566 [Danio rerio]
Length=479

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FGGL DEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG +WI+NE+KKS
Sbjct  42   KTKFGGLSDEDRIFTNLYGRHDWRLKGAEARGDWYKTKEVLLKGHEWILNEMKKS  96



>ref|XP_009183769.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Papio anubis]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_003798357.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Otolemur garnettii]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_007565012.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Poecilia formosa]
Length=472

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L DEDRIFTN+YG HD  L GA+KRGDWY+TK+++LKG DWI+NE+K S
Sbjct  39   KKTKFGPLADEDRIFTNLYGRHDWRLNGALKRGDWYKTKEILLKGVDWILNEIKVS  94



>ref|NP_001274202.1| NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa [Macaca 
fascicularis]
 dbj|BAF93481.1| NADH dehydrogenase flavoprotein 1 [Macaca fascicularis]
 gb|EHH22618.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Macaca mulatta]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>sp|Q8HXQ9.1|NDUV1_MACFA RecName: Full=NADH dehydrogenase [ubiquinone] flavoprotein 1, 
mitochondrial; AltName: Full=Complex I-51kD; Short=CI-51kD; 
AltName: Full=NADH-ubiquinone oxidoreductase 51 kDa subunit; 
Flags: Precursor [Macaca fascicularis]
 dbj|BAC20599.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Macaca fascicularis]
Length=464

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_010364628.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Rhinopithecus roxellana]
Length=464

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_005063380.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Mesocricetus auratus]
Length=263

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTS  83



>ref|XP_003977673.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Takifugu rubripes]
Length=471

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L D+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG+DWI+NEVK S
Sbjct  32   KKTKFGPLSDQDRIFTNLYGRHDWRLKGALTRGDWYKTKEIILKGSDWILNEVKIS  87



>gb|ABY55757.1| NADH dehydrogenase (ubiquinone) flavoprotein 1 [Drosophila silvestris]
Length=222

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  370  FGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            FG L DEDRIFTN+YG HD  LKGA KRGDWY+TK++VLKG +WI+NEVK S
Sbjct  46   FGPLADEDRIFTNLYGRHDWRLKGAQKRGDWYKTKEIVLKGPEWIINEVKTS  97



>gb|EFA77854.1| ubiquinone oxidoreductase [Polysphondylium pallidum PN500]
Length=481

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  307  AASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVL  486
            AA+   TPQ        +   +GGLKD+DRIFTN+YG HD +LKGA KRGDWYRTKD++ 
Sbjct  32   AAAGGPTPQQQVQNASIKT--YGGLKDQDRIFTNLYGEHDVYLKGAEKRGDWYRTKDIIG  89

Query  487  KGTDWIVNEVKKS  525
            KG DWI+ E+  S
Sbjct  90   KGKDWILKEMMAS  102



>gb|ADI40702.1| NADH dehydrogenase flavoprotein 1, 51kDa [Scotophilus kuhlii]
Length=275

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K S
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTS  63



>ref|XP_003774247.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, 
partial [Sarcophilus harrisii]
Length=438

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  3    KKTTFGSLKDEDRIFTNLYGRHDWRLKGALSRGDWYKTKEILLKGPDWILGEIKTS  58



>gb|ADI40703.1| NADH dehydrogenase flavoprotein 1, 51kDa [Miniopterus schreibersii]
Length=275

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ E+K S
Sbjct  8    KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEIKTS  63



>gb|AAQ63696.1| NADH:ubiquinone oxidoreductase 51 kD subunit [Chlamydomonas reinhardtii]
Length=484

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FGGLKDEDRIF N+YG HD  +KGA+ RGDWY TK+++ KG DWI++++KKS
Sbjct  50   KTSFGGLKDEDRIFQNIYGRHDLSIKGAMSRGDWYMTKEIIGKGRDWIIDQMKKS  104



>gb|KFM58892.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, 
partial [Stegodyphus mimosarum]
Length=247

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKD+DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG DWI+ E+K S
Sbjct  36   QKTKFGPLKDQDRIFTNLYGRHDWKLKGALARGDWYKTKEILLKGVDWILKEIKDS  91



>ref|XP_007518737.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Erinaceus europaeus]
Length=455

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI++EVK S
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILSEVKTS  74



>ref|XP_007518736.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Erinaceus europaeus]
Length=464

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI++EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILSEVKTS  83



>ref|XP_007550020.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial-like 
[Poecilia formosa]
Length=466

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG L D+DRIFTN+YG HD  LKGA+KRGDWY+TK+++LKG +WI+NEVK S
Sbjct  27   KKTKFGPLSDQDRIFTNLYGRHDWRLKGALKRGDWYKTKEIILKGPEWILNEVKIS  82



>ref|XP_001702590.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP06369.1| NADH:ubiquinone oxidoreductase 51 kDa subunit [Chlamydomonas 
reinhardtii]
Length=484

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FGGLKDEDRIF N+YG HD  +KGA+ RGDWY TK+++ KG DWI++++KKS
Sbjct  50   KTSFGGLKDEDRIFQNIYGRHDLSIKGAMSRGDWYMTKEIIGKGRDWIIDQMKKS  104



>ref|XP_011379926.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Pteropus vampyrus]
Length=421

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKAS  83



>gb|EYB94292.1| hypothetical protein Y032_0173g404 [Ancylostoma ceylanicum]
Length=477

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  364  THFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            T FG LKD DRIFTN+YG HD  LKGA+ RGDWY+TK+++LKG++WI+NEV+ S
Sbjct  37   TSFGNLKDSDRIFTNLYGRHDYRLKGALARGDWYKTKEIILKGSEWIINEVRTS  90



>emb|CAM91788.1| hypothetical protein [Platynereis dumerilii]
Length=137

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            EKT FGGLKD+DRIFTN+YG HD   KGAI RGDWY+TK++++K  +WI  E+ KS
Sbjct  11   EKTSFGGLKDQDRIFTNLYGRHDRRPKGAISRGDWYKTKEILIKDNEWIQQEIVKS  66



>ref|XP_005850918.1| hypothetical protein CHLNCDRAFT_56910 [Chlorella variabilis]
 gb|EFN58816.1| hypothetical protein CHLNCDRAFT_56910 [Chlorella variabilis]
Length=949

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +1

Query  274  WGLNGRFYSAQAASTANTPQSpppppppEKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKR  453
            W    R      +S    P S        +TH G L+D DRIFTN+YG HDPFL+GA KR
Sbjct  449  WSTLSRLGEEGRSSVPGRP-SYSTGAAEARTH-GNLQDSDRIFTNLYGRHDPFLEGAQKR  506

Query  454  GDWYRTKDLVLKGTDWIVNEVKKS  525
            GDWYRT DL+ KG +WI++EVK S
Sbjct  507  GDWYRTADLIGKGPEWIISEVKAS  530



>emb|CDQ87460.1| unnamed protein product [Oncorhynchus mykiss]
Length=474

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +1

Query  226  LLSLQRTALVQRCSQKWGLNGRFYSAQAASTANTP-QSpppppppEKTHFGGLKDEDRIF  402
            +LSL R ALV  C+      G     Q   T+ T   S     PP+KT FG L D+DRIF
Sbjct  1    MLSLSRLALV--CAAA---RGPVAVCQGRVTSITRFNSTTVEAPPKKTTFGPLADQDRIF  55

Query  403  TNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            TN+YG HD  LKGA  RGDWY+TK+++LKG DWI+NE+K S
Sbjct  56   TNLYGRHDWRLKGAQSRGDWYKTKEILLKGVDWILNEIKVS  96



>ref|XP_005700086.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Capra hircus]
Length=438

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  39   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTS  94



>ref|XP_004759596.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Mustela putorius furo]
 ref|XP_004808426.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X2 [Mustela putorius furo]
Length=455

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  19   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTS  74



>ref|NP_001026754.1| NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
[Gallus gallus]
 emb|CAG32721.1| hypothetical protein RCJMB04_33n14 [Gallus gallus]
Length=459

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG H+  L+GA++RGDWY+TK+++LKG DWI+ E+K S
Sbjct  24   KKTQFGSLKDEDRIFTNLYGRHEWRLQGALRRGDWYKTKEILLKGVDWILGEIKAS  79



>emb|CDS13291.1| Putative NADH-ubiquinone oxidoreductase 51 kDasubunit [Absidia 
idahoensis var. thermophila]
Length=454

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  361  KTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            KT FG L DEDRIFTN+Y  HD  LKGA+KRGDWY+TK+LVLKG DWI++E+K+S
Sbjct  19   KTSFGNLSDEDRIFTNLYLRHDYRLKGALKRGDWYKTKELVLKGHDWILDEMKQS  73



>ref|XP_004759595.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Mustela putorius furo]
 ref|XP_004808425.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Mustela putorius furo]
Length=464

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKTS  83



>ref|XP_011379925.1| PREDICTED: NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial 
isoform X1 [Pteropus vampyrus]
Length=464

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  358  EKTHFGGLKDEDRIFTNVYGLHDPFLKGAIKRGDWYRTKDLVLKGTDWIVNEVKKS  525
            +KT FG LKDEDRIFTN+YG HD  LKGA  RGDWY+TK+++LKG DWI+ EVK S
Sbjct  28   KKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRGDWYKTKEILLKGPDWILGEVKAS  83



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600