BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031M12

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    145   8e-37   
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    144   1e-36   
gb|AGK82806.1|  alcohol oxidase                                         143   3e-36   Solanum lycopersicum
gb|AGK82832.1|  alcohol oxidase                                         143   4e-36   Solanum habrochaites
gb|AGK82825.1|  alcohol oxidase                                         143   5e-36   Solanum pennellii
gb|AGK82821.1|  alcohol oxidase                                         142   8e-36   Solanum pimpinellifolium [currant tomato]
ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        139   9e-35   Nicotiana tomentosiformis
ref|XP_010644266.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    128   3e-33   Vitis vinifera
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        135   3e-33   Nicotiana sylvestris
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    129   4e-31   Solanum lycopersicum
emb|CBI29206.3|  unnamed protein product                                127   1e-30   Vitis vinifera
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        127   1e-30   Prunus mume [ume]
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             127   2e-30   
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        126   4e-30   Vitis vinifera
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   118   3e-27   
emb|CDP07225.1|  unnamed protein product                                117   6e-27   Coffea canephora [robusta coffee]
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             116   1e-26   Citrus clementina [clementine]
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     116   2e-26   Eucalyptus grandis [rose gum]
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        116   2e-26   Eucalyptus grandis [rose gum]
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     115   2e-26   Eucalyptus grandis [rose gum]
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    115   3e-26   Eucalyptus grandis [rose gum]
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         115   4e-26   Jatropha curcas
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    112   3e-25   Cucumis melo [Oriental melon]
gb|KGN53995.1|  hypothetical protein Csa_4G246410                       107   3e-25   Cucumis sativus [cucumbers]
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             112   4e-25   Phaseolus vulgaris [French bean]
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  112   5e-25   Medicago truncatula
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    111   7e-25   Citrus sinensis [apfelsine]
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                109   4e-24   Erythranthe guttata [common monkey flower]
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                108   6e-24   Erythranthe guttata [common monkey flower]
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  108   1e-23   
gb|EPS61567.1|  hypothetical protein M569_13229                         107   1e-23   Genlisea aurea
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            107   2e-23   Medicago truncatula
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    107   2e-23   Glycine max [soybeans]
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    105   8e-23   Glycine max [soybeans]
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        105   9e-23   Glycine soja [wild soybean]
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    105   1e-22   Glycine max [soybeans]
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             105   1e-22   Phaseolus vulgaris [French bean]
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    105   1e-22   Phoenix dactylifera
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    104   2e-22   Arabis alpina [alpine rockcress]
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    104   3e-22   Cicer arietinum [garbanzo]
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    103   3e-22   
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    102   7e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    102   2e-21   Glycine max [soybeans]
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    101   2e-21   Solanum tuberosum [potatoes]
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        101   3e-21   Populus euphratica
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    100   4e-21   Sesamum indicum [beniseed]
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  99.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728           98.2    3e-20   
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg           97.4    6e-20   
ref|XP_006385149.1|  alcohol oxidase-related family protein           97.1    8e-20   
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg           97.1    9e-20   Capsella rubella
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      96.3    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  95.9    2e-19   Nelumbo nucifera [Indian lotus]
emb|CDX99381.1|  BnaC01g11710D                                        90.9    2e-19   
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  95.5    3e-19   Sesamum indicum [beniseed]
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370        95.1    4e-19   Amborella trichopoda
emb|CDY66155.1|  BnaA01g34940D                                        89.7    7e-19   Brassica napus [oilseed rape]
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  94.4    8e-19   Tarenaya hassleriana [spider flower]
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  94.0    8e-19   Tarenaya hassleriana [spider flower]
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  94.0    1e-18   Phoenix dactylifera
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  93.2    2e-18   
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  93.2    2e-18   Cicer arietinum [garbanzo]
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                    92.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...  92.0    5e-18   
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      91.3    7e-18   Brassica rapa
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  90.9    1e-17   
emb|CDY01593.1|  BnaC07g35830D                                        90.5    1e-17   
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      90.1    2e-17   Elaeis guineensis
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  89.7    3e-17   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX98615.1|  BnaA03g44000D                                        89.4    3e-17   
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  89.0    4e-17   Brassica rapa
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...  83.2    5e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621            81.6    2e-14   
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531            81.3    2e-14   
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A      79.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17814.1|  unknown                                               75.9    1e-12   Picea sitchensis
ref|XP_002519938.1|  electron carrier, putative                       75.1    2e-12   Ricinus communis
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1       75.5    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001763007.1|  predicted protein                                74.7    3e-12   
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg           74.3    4e-12   Citrus clementina [clementine]
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  72.4    2e-11   Citrus sinensis [apfelsine]
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  71.6    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg           70.5    7e-11   Citrus clementina [clementine]
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  70.1    9e-11   
ref|XP_003607655.1|  Annotation was added to scaffolds in Novembe...  65.5    3e-10   
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1       67.4    9e-10   Vitis vinifera
emb|CAN71289.1|  hypothetical protein VITISV_019349                   66.6    1e-09   Vitis vinifera
gb|KDP40361.1|  hypothetical protein JCGZ_02359                       66.6    1e-09   Jatropha curcas
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg              66.6    1e-09   Erythranthe guttata [common monkey flower]
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                65.9    2e-09   Citrus sinensis [apfelsine]
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein          65.5    4e-09   Medicago truncatula
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...  65.1    4e-09   Lotus japonicus
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                       64.7    5e-09   Medicago truncatula
gb|ACF22878.1|  alcohol oxidase                                       65.1    5e-09   Glycine max [soybeans]
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein          65.1    5e-09   Medicago truncatula
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                       64.7    5e-09   Glycine soja [wild soybean]
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  64.7    5e-09   Glycine max [soybeans]
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...  64.3    9e-09   Nelumbo nucifera [Indian lotus]
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1       63.9    1e-08   Sesamum indicum [beniseed]
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601            63.9    1e-08   
gb|AGC65582.1|  fatty alcohol oxidase                                 63.5    1e-08   Simmondsia chinensis [goatnut]
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684            63.2    2e-08   
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  63.2    2e-08   Cucumis sativus [cucumbers]
gb|EPS64229.1|  hypothetical protein M569_10552                       62.8    2e-08   Genlisea aurea
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2       62.8    3e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2       62.8    3e-08   Nicotiana tomentosiformis
emb|CBI23676.3|  unnamed protein product                              62.0    3e-08   Vitis vinifera
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  62.4    3e-08   Cicer arietinum [garbanzo]
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  62.0    4e-08   Eucalyptus grandis [rose gum]
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1       61.6    6e-08   Eucalyptus grandis [rose gum]
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                   61.6    6e-08   Eucalyptus grandis [rose gum]
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  61.6    6e-08   Elaeis guineensis
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...  61.6    6e-08   Zea mays [maize]
ref|XP_002314488.2|  alcohol oxidase-related family protein           61.2    7e-08   
gb|EMS67203.1|  Long-chain-alcohol oxidase FAO2                       59.3    2e-07   Triticum urartu
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg              59.7    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  59.7    2e-07   Setaria italica
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  59.7    3e-07   Setaria italica
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  59.7    3e-07   
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g           59.3    3e-07   Phaseolus vulgaris [French bean]
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  58.9    4e-07   Cucumis sativus [cucumbers]
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1       58.9    5e-07   Nicotiana sylvestris
ref|XP_008356208.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  56.2    5e-07   
ref|XP_004157399.1|  PREDICTED: LOW QUALITY PROTEIN: puromycin-se...  58.5    5e-07   
emb|CDP11641.1|  unnamed protein product                              58.5    6e-07   Coffea canephora [robusta coffee]
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1       58.2    7e-07   Populus euphratica
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg           58.2    7e-07   Prunus persica
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...  58.2    8e-07   
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  57.8    1e-06   Solanum tuberosum [potatoes]
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  57.4    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  57.4    1e-06   Setaria italica
gb|EMT04635.1|  hypothetical protein F775_13385                       55.1    1e-06   
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg           57.0    1e-06   Citrus clementina [clementine]
emb|CDX94858.1|  BnaC03g43300D                                        57.0    2e-06   
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                 56.6    2e-06   Citrus sinensis [apfelsine]
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  56.2    3e-06   
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                       56.2    3e-06   Medicago truncatula
gb|KJB38384.1|  hypothetical protein B456_006G252500                  56.2    3e-06   Gossypium raimondii
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  55.8    4e-06   
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein          55.8    4e-06   Glycine soja [wild soybean]
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  55.8    4e-06   Glycine max [soybeans]
emb|CDP03771.1|  unnamed protein product                              55.5    6e-06   Coffea canephora [robusta coffee]
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  55.5    6e-06   Prunus mume [ume]
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  55.5    6e-06   Brassica rapa
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  55.1    6e-06   Solanum tuberosum [potatoes]
dbj|BAJ86655.1|  predicted protein                                    55.1    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002529832.1|  electron carrier, putative                       55.1    7e-06   Ricinus communis
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1       55.1    7e-06   Solanum lycopersicum
ref|XP_006386919.1|  hypothetical protein POPTR_0002s26130g           54.7    7e-06   
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  55.1    8e-06   Phoenix dactylifera
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  54.7    8e-06   Populus euphratica
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1       54.7    1e-05   Cucumis melo [Oriental melon]
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  54.3    1e-05   Cicer arietinum [garbanzo]
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  53.9    2e-05   Nicotiana tomentosiformis
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1       53.9    2e-05   Zea mays [maize]
emb|CDX92884.1|  BnaC07g41420D                                        53.5    2e-05   
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                       53.5    2e-05   Triticum urartu
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  53.5    2e-05   Phoenix dactylifera
gb|KDO72346.1|  hypothetical protein CISIN_1g0039901mg                49.7    2e-05   Citrus sinensis [apfelsine]
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855           53.5    2e-05   
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                       53.5    2e-05   Gossypium arboreum [tree cotton]
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like  53.1    3e-05   Glycine max [soybeans]
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  53.1    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  53.1    3e-05   Elaeis guineensis
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                  53.1    3e-05   Morus notabilis
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  53.1    3e-05   Eucalyptus grandis [rose gum]
emb|CDX92985.1|  BnaA03g37070D                                        52.8    4e-05   
tpg|DAA49650.1|  TPA: hypothetical protein ZEAMMB73_468308            49.7    4e-05   
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                       52.8    4e-05   Gossypium arboreum [tree cotton]
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...  52.8    4e-05   
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...  52.4    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1       52.4    5e-05   Camelina sativa [gold-of-pleasure]
emb|CDX85097.1|  BnaC07g08090D                                        52.4    5e-05   
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2       52.4    6e-05   Nicotiana sylvestris
gb|EAY78906.1|  hypothetical protein OsI_34009                        50.8    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_002311685.2|  alcohol oxidase-related family protein           52.0    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  52.0    8e-05   Fragaria vesca subsp. vesca
gb|KJB10008.1|  hypothetical protein B456_001G179800                  52.0    8e-05   Gossypium raimondii
gb|KJB10006.1|  hypothetical protein B456_001G179800                  52.0    8e-05   Gossypium raimondii
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1       52.0    8e-05   Pyrus x bretschneideri [bai li]
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  52.0    8e-05   Brachypodium distachyon [annual false brome]
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg           51.6    9e-05   Capsella rubella
ref|XP_011459707.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  51.6    9e-05   Fragaria vesca subsp. vesca
ref|NP_001142399.1|  uncharacterized protein LOC100274574             51.6    1e-04   Zea mays [maize]
emb|CDX77517.1|  BnaA07g06550D                                        51.2    1e-04   
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...  51.6    1e-04   Cucumis melo [Oriental melon]
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like  51.6    1e-04   Camelina sativa [gold-of-pleasure]
gb|KJB72414.1|  hypothetical protein B456_011G177100                  51.2    1e-04   Gossypium raimondii
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3       51.2    1e-04   Brassica rapa
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750        51.2    1e-04   
ref|XP_007050220.1|  Alcohol oxidase                                  50.8    2e-04   
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  50.8    2e-04   Setaria italica
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1       50.8    2e-04   Prunus mume [ume]
gb|EMT02982.1|  Putative GMC-type oxidoreductase                      50.4    2e-04   
dbj|BAK02336.1|  predicted protein                                    50.4    3e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM63097.1|  unknown                                               50.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                    50.1    3e-04   Arabidopsis thaliana [mouse-ear cress]
gb|AAK64154.1|  unknown protein                                       49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                       49.7    4e-04   Gossypium arboreum [tree cotton]
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                     49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ACN27562.1|  unknown                                               49.7    4e-04   Zea mays [maize]
ref|NP_001064840.2|  Os10g0474900                                     47.8    5e-04   
gb|KHN11790.1|  hypothetical protein glysoja_006243                   46.6    5e-04   Glycine soja [wild soybean]
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906           49.3    5e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg           49.3    6e-04   
ref|NP_001148058.1|  oxidoreductase                                   48.9    7e-04   
emb|CDY51703.1|  BnaA03g58930D                                        48.9    7e-04   Brassica napus [oilseed rape]
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like  48.9    7e-04   Brachypodium distachyon [annual false brome]



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   SNGKAERGNDGVYSGG-CPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTS  260
            + G  E+  D    G    LS + M ++++I DTFLP++D    H    DDS+  F  TS
Sbjct  5    NGGNMEKVKDDAKKGHFGSLSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTS  64

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
            AS+ GTPQ +AWM+SER+QHPK+ L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  
Sbjct  65   ASMNGTPQHLAWMVSERIQHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSR  124

Query  441  ISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            +SP+KR EIV+SWSC   K++K  ++ +K
Sbjct  125  VSPNKREEIVQSWSCSNFKLIKLLFVALK  153



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M ++++I DTFLP++D    H    DDSV  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  513  YLGMK  527
            ++ +K
Sbjct  121  FVALK  125



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  513  YLGMK  527
            ++ +K
Sbjct  121  FVALK  125



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC   K++K  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  513  YLGMK  527
            ++ +K
Sbjct  121  FVALK  125



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M ++++I DTFLP++D    H    DDS+  F  TSAS+ GTPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLN  60

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F  +SP+KR EIV+SWSC  +K +K  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNLKFIKLL  120

Query  513  YLGMK  527
            ++ +K
Sbjct  121  FVALK  125



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQ-HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M ++T+I DTFLP++D    H    DDS+  F  TSAS+  TPQ +AWM+SER+QHPK+ 
Sbjct  1    MDSLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLN  60

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L +LALWLLSTRIGT +LCGKASLSSQFPYLQ+F ++SP+KR EIV+SWSC   K++K  
Sbjct  61   LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREEIVQSWSCSNFKLIKLL  120

Query  513  YLGMK  527
            ++ +K
Sbjct  121  FVALK  125



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQ--HAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  314
            LS   M ++T+I DT LP++D     H    DD    F QTSAS+ GTPQ +AWMIS RL
Sbjct  29   LSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHIAWMISNRL  88

Query  315  QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI  494
            QHPK+ L ++ALWLLSTRIGTL+LCGKASLSSQFPYLQSF  ISP+KR EIV SWS    
Sbjct  89   QHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREEIVLSWSTSCF  148

Query  495  KILKTFYLGMK  527
            K+L+  +  +K
Sbjct  149  KLLRILFSAIK  159



>ref|XP_010644266.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]
 ref|XP_010644267.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]
Length=209

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = +3

Query  66   DDGDSLFSNGKAERGNDGVYSGG-----CPLSPAVMATVTSISDTFLPAVDVPQHAAVDD  230
            +   +L   G  E   + +  GG       LS   M ++ +ISDTFLP+V+ P +AA   
Sbjct  5    EQEHTLIELGVVEARQELLNGGGRQLYLNKLSSREMESLVAISDTFLPSVEAPHNAA--H  62

Query  231  DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  410
              V  F++TSAS+AGTP  V  +ISERL+HPK+ ++R+ LWLLST  GT ++CG AS+SS
Sbjct  63   AYVDKFYRTSASMAGTPHIVGGLISERLEHPKLWMIRVVLWLLSTWFGTFIICGLASMSS  122

Query  411  QFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
             FPY QSFP++SPHKR EIV SWS  Y  +++  +  +K
Sbjct  123  HFPYFQSFPQVSPHKRHEIVLSWSLSYFSLIRMLFRSLK  161



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  311
            LS   M ++T++ DT LP++D     Q+ A+DD     F QTSAS+ GTPQ +AWMIS R
Sbjct  29   LSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTN-FLQTSASMTGTPQHIAWMISNR  87

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  491
            L HPK+ L +LALWLLSTRIGTL+LCGKASLSSQFPYLQSF  ISP++R EIV SWS   
Sbjct  88   LHHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREEIVLSWSTSC  147

Query  492  IKILKTFYLGMK  527
             K+L+  +  +K
Sbjct  148  FKLLRILFSAIK  159



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 93/136 (68%), Gaps = 7/136 (5%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVD-------VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWM  299
            LS   + ++T++ DTF+P++          Q    DDDS   F QTSAS+ GTPQ +AWM
Sbjct  26   LSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNIDDDDSYAKFLQTSASMNGTPQHIAWM  85

Query  300  ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
            I+ RLQHPK+ L RLALWLLSTRIGT +LCGKASLS+QFPYLQ+F  ISP KR E V+SW
Sbjct  86   INNRLQHPKMNLCRLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREESVKSW  145

Query  480  SCCYIKILKTFYLGMK  527
            +    K+L+  +   K
Sbjct  146  ATSCFKLLRILFFAAK  161



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35   LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK+ L R+ LWLLST  GT ++CG AS+SS FPY QSFP++SPHKR EIV SWS  Y  +
Sbjct  93   PKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSL  152

Query  501  LKTFYLGMK  527
            ++  +  +K
Sbjct  153  IRMLFRSLK  161



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++T++ DTFLP++DV    A  + S+  F++TSAS+AGTPQRV  +ISERL+HPK+ L
Sbjct  1    MESLTALCDTFLPSIDVSD--ATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWL  58

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            +RLALW LST IG+ +LCG+ASLSSQFPY QSFP++S  KR EI+ SWS  Y  +L+  +
Sbjct  59   MRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYLLRMLF  118

Query  516  LGMK  527
              MK
Sbjct  119  KTMK  122



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++T++ DTFLP++DV       + S+  F++TSAS+AGTPQRV  +ISER++H
Sbjct  52   LSSREMESLTALCDTFLPSIDVSD--TTTNASLVAFYRTSASMAGTPQRVGGLISERMKH  109

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK+ L+RLALW LST IG+ +LCG+ASLSSQFPY QSFP++S  KR EI+ SWS  Y  +
Sbjct  110  PKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYL  169

Query  501  LKTFYLGMK  527
            L+  +  MK
Sbjct  170  LRMLFKSMK  178



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++ +ISDTFLP+V+ P +AA     V  F++TSAS+AGTP  V  +ISERL+H
Sbjct  35   LSSREMESLIAISDTFLPSVEAPHNAA--HAYVDKFYRTSASMAGTPHIVGGLISERLEH  92

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK+ L R+ LWLLST  GT ++CG AS+SS FPY QSFP++SPHKR EIV SWS  Y  +
Sbjct  93   PKLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSL  152

Query  501  LKTFYLGMK  527
            ++  +  +K
Sbjct  153  IRMLFRSLK  161



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +3

Query  63   SDDGDSLFSNGKAERGNDGVYS-GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSV  239
            S   D      K+   N+ V++     LS   M T+ ++SD FLP+VDV    A  D+S+
Sbjct  51   SSTADQAMKEEKSRNDNNNVFNIYESSLSRRQMDTLIAVSDAFLPSVDVSDLTA--DESL  108

Query  240  KLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFP  419
              F+ TSAS+A TPQR+  MISERL+HPK  LL++ALW LST  GT ++CG AS+S+ FP
Sbjct  109  LKFYATSASMAATPQRLGGMISERLKHPKKWLLKVALWALSTWFGTFVMCGIASVSTTFP  168

Query  420  YLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            Y  SFP +S  +R EI+ SWS  Y  +L+  Y  +K
Sbjct  169  YFHSFPNLSHQRRQEILNSWSQSYFFLLRLLYWSLK  204



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++ ++ DT+LP++D        D+S   F+QTSAS+AGTPQR+  +ISERLQH
Sbjct  47   LSSRQMESLKALCDTYLPSID--GFHTKHDESTARFYQTSASVAGTPQRLGGLISERLQH  104

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK+ + RLALW LST IGT  +CG ASLS  FPYLQ F ++SP KR +IV SWS   I  
Sbjct  105  PKLFMARLALWFLSTSIGTFAMCGIASLSGNFPYLQKFSQVSPEKREQIVLSWSRSIIFP  164

Query  501  LKTFYLGMK  527
            L+  +  +K
Sbjct  165  LRLLFTALK  173



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M +++++ DTFLPAVDV Q AA+D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  27   LSSQEMESLSALCDTFLPAVDVKQAAAIDTD-IADFFRASASAAGTPERLGGLMSERLKH  85

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++  +KR  ++ SWS  Y   
Sbjct  86   PKKWLVRLCLWLLSTCIGSLILCGRYCFSSKFPYMHSFTQLPQNKREAVLVSWSLSYFYH  145

Query  501  LKTFYLGMK  527
            L+  Y  MK
Sbjct  146  LRMLYKAMK  154



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 8/132 (6%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  296
            LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49   LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            +ISER++HPK+ LLRL LW LST IGT +LCG+   SS FPY+Q FPEI   +R EIVR 
Sbjct  109  LISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVRR  168

Query  477  WSCCYIKILKTF  512
            WS     +L+ F
Sbjct  169  WSRSVFPLLRIF  180



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 88/132 (67%), Gaps = 8/132 (6%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DSVKLFFQTSASIAGTPQRVAW  296
            LSP  M T+T++ DTFLP++  P H +  D        + V  F++TSAS+AGTP+++  
Sbjct  49   LSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLGG  108

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            +ISER++HPK+ LLRL LW LST IGT +LCG+   SS FPY+Q FPEI   +R EIVR 
Sbjct  109  LISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVRR  168

Query  477  WSCCYIKILKTF  512
            WS     +L+ F
Sbjct  169  WSRSVFPLLRIF  180



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 4/133 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQH----AAVDDDSVKLFFQTSASIAGTPQRVAWMISE  308
            LSP  M T+TS+ DTFLP++  P H        D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43   LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  488
            R++HPK+ LL L LWLLST IGT +LCG+   SS FPY+Q F EI   +R EI R W   
Sbjct  103  RMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFRS  162

Query  489  YIKILKTFYLGMK  527
               +L+ F   +K
Sbjct  163  VFPVLRMFARTIK  175



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 86/133 (65%), Gaps = 4/133 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQH----AAVDDDSVKLFFQTSASIAGTPQRVAWMISE  308
            LSP  M T+TS+ DTFLP++  P H        D+ V  F+QTSAS+AGTP+++  ++SE
Sbjct  43   LSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVSE  102

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCC  488
            R++HPK+ LL L LWLLST IGT +LCG+   SS FPY+Q F EI   +R EI R W   
Sbjct  103  RMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFRS  162

Query  489  YIKILKTFYLGMK  527
               +L+ F   +K
Sbjct  163  VFPVLRMFARTIK  175



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M +++++ DTFLP+ DV   +A  DDS+  FF +SAS+AGTPQR+  +IS+RL+H
Sbjct  31   LSFPEMESLSALCDTFLPSNDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRLKH  90

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  L+R+ LW+LSTR+GT +LCG  S+S+ FP+   F +I  HKR +I+ SWS  +  +
Sbjct  91   PKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFFSL  150

Query  501  LKTFYLGMK  527
            L+  +  +K
Sbjct  151  LRMLFKTVK  159



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +3

Query  69   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  248
            DG S+  +  A   ND  YS    LS A M ++ ++ DTFLP+V  P  AA  D S  +F
Sbjct  50   DGASVEISQHANSNND-YYSSAGHLSAAEMESLAALCDTFLPSV-APATAA--DRSTAVF  105

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
            F+TSAS  GTP+RV  MI ER++HPK  L+R++LW+LST  GT +LCG  SLS+ FPY +
Sbjct  106  FETSASAVGTPERVGEMIMERVRHPKKWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFK  165

Query  429  SFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
             F ++S  KR +I  SWS  Y  +L+ F+  +K
Sbjct  166  RFSKVSQKKREQIALSWSLSYFFLLRMFFRTIK  198



>gb|KGN53995.1| hypothetical protein Csa_4G246410 [Cucumis sativus]
Length=224

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = +3

Query  69   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  248
            DG S+  +  A   ND  YS    LS + M ++ ++ DTFLP+V  P  AA  D S   F
Sbjct  52   DGASVEISQHANSNND-YYSSAGHLSASEMESLAALCDTFLPSV-APSTAA--DRSTAFF  107

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
            F+TSAS  GTP RV  MI ER++HPK  L+R+ LWLLST  GT +LCG  SLS+ FPY +
Sbjct  108  FETSASAIGTPDRVGEMIKERVKHPKKWLVRVTLWLLSTWYGTYILCGNKSLSNHFPYFE  167

Query  429  SFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
             F ++   KR +I  SWS  Y  +L+  +  +K
Sbjct  168  RFSKVPQKKREQIALSWSLSYFFLLRMLFRTIK  200



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPL----SPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  248
            L ++G A+ G++       PL    SP  M ++ ++ DT +P++D     + DD+SV  F
Sbjct  39   LHAHGDADVGDEERDKHQKPLTNSLSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANF  98

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
            ++TSAS+AGTPQ +  +ISE+++HP   LL L LWLLST  GTL+LCG AS+SS+FP+  
Sbjct  99   YKTSASMAGTPQHLGKLISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFH  158

Query  429  SFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            S+PE+S  KR  +++SWS  Y++ L+ F+  +K
Sbjct  159  SYPEMSLLKRQRVMQSWSLSYLRPLRMFFRTIK  191



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LSP  M ++ ++ DT LP++     AA  D+ +  F++TSAS+AGTP+ VA ++SE+L+H
Sbjct  60   LSPTQMKSLVALCDTMLPSIKDNNVAASSDEFLNNFYRTSASMAGTPELVANLVSEKLKH  119

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P   LL+L LWLLST  GTL+LCG AS+S++FP+  S+P++SP KR +++ SWS  Y++ 
Sbjct  120  PSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHSYPKLSPEKRQKVMLSWSVSYLRP  179

Query  501  LKTFYLGMK  527
            L+  +  +K
Sbjct  180  LRMLFRTIK  188



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M +++++ DTFLPAVDV   A++D D +  FF+ SAS AGTP+R+  ++SERL+H
Sbjct  34   LSSQEMESLSALCDTFLPAVDVKTAASIDKD-IADFFRASASAAGTPERLGGLMSERLKH  92

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++   KR  ++ SWS  Y   
Sbjct  93   PKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSWSLSYFYH  152

Query  501  LKTFYLGMK  527
            L+  Y  MK
Sbjct  153  LRMLYKAMK  161



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M  +T++ DTFLP++ +  H          F+QTSAS+  TP  +A ++ E+++HPK+ L
Sbjct  1    MEELTAVCDTFLPSIHLSDHHRHHQ-----FYQTSASMTQTPHHLAELLGEKIKHPKIYL  55

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
             RLAL+ LSTR+GT +LCG+ SLS +FPYLQ F  + PHKR +I+ SWS     +L+  Y
Sbjct  56   SRLALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQILLSWSESCFSLLRILY  115

Query  516  LGMK  527
             G+K
Sbjct  116  AGLK  119



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M  +T++ DTFLPA+DV  H      SV  F+QTSAS++ TP  VA  I+E+++HPK++L
Sbjct  18   MEALTALCDTFLPAIDVSDHDPHLPQSVANFYQTSASMSETPPLVAEFIAEKVKHPKILL  77

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
             ++A+ +LST IGT +LCG+ SLS  FPYLQ F  +   KR EI+ SWS     +L+  +
Sbjct  78   AKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKREEILLSWSNSCFSLLRILF  137

Query  516  LGMK  527
              +K
Sbjct  138  SALK  141



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75   LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P  ++L+L LW LST +GT++LCG   LS++FP++ +FP++  HKR +I++SWS  + + 
Sbjct  135  PMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIMQSWSLSFFRH  194

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  195  LRMFFRTIK  203



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 88/138 (64%), Gaps = 2/138 (1%)
 Frame = +3

Query  117  GVYSGG-CPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  293
            G  SGG CP S   M ++ ++ DTFLP ++ P   A DD  +  FF+TSAS A TP +VA
Sbjct  4    GAESGGKCPYSRRQMESLAALCDTFLPEME-PPSGADDDKDISRFFRTSASTANTPHQVA  62

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             ++  +++H ++ L  LALW+LST IGT +LCG+ SLS +FPYLQ F  +S   R EI+ 
Sbjct  63   ILMGHKIRHRRLFLAPLALWVLSTAIGTWVLCGRKSLSRRFPYLQKFSRVSTENRKEIMH  122

Query  474  SWSCCYIKILKTFYLGMK  527
            SW+  +  +L+  +  +K
Sbjct  123  SWANSHFFVLRLLFNALK  140



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++T++ DT LP+++     + DD+S   F++ SAS+AGTP+R+  +ISERL H
Sbjct  75   LSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERLGGIISERLIH  134

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P  ++L+L LW LST +GT++LCG   LS++FP++ +FP++  HKR +I++SWS  + + 
Sbjct  135  PMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIMQSWSLSFFRH  194

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  195  LRMFFRTIK  203



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  260
            L SNG+ E+    + +    LSP  M ++T++ DT LP+V         D+SV  F+Q S
Sbjct  38   LLSNGEREKKLQPLTN---SLSPRQMKSLTALCDTILPSV-ADHFVDSSDESVTKFYQIS  93

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
            AS+ GTP+R   MISERL+HP   LL+  LWLLST  GTL+ CG   LS+QFP++ ++P 
Sbjct  94   ASMTGTPERFGGMISERLKHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPH  153

Query  441  ISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            +S  KR +I+RSWS  Y++  +  +  +K
Sbjct  154  LSLQKRQKIMRSWSLSYLRHFRMLFRTIK  182



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHA-AVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  317
            LSP  M ++ ++ DT LP+++        DD+SV  F++TSAS+AGTP+ +  +ISE+L+
Sbjct  78   LSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPEHLGILISEKLK  137

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  497
            HP   LL L LWLLST  GT +LCG  SLS++FP+  S+PE+S  KR ++++SWS  Y++
Sbjct  138  HPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQKVMQSWSLSYLR  197

Query  498  ILKTFYLGMK  527
             L+ F+  +K
Sbjct  198  PLRMFFRTIK  207



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  260
            L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44   LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
            AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG    S+QFP++ ++P+
Sbjct  99   ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPD  158

Query  441  ISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            +   KR +I+RSWS  Y++  +  +  +K
Sbjct  159  LPLQKRQQIMRSWSLSYLRHFRMLFRTIK  187



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  260
            L SNG+ E+    + +    LSP  M ++ ++ DT LP+VD        D+SV  F+Q S
Sbjct  44   LLSNGEREKKLQPLTN---TLSPRQMKSLYALCDTILPSVD--HFVDTSDESVTKFYQIS  98

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
            AS+ GTP+R   MISE+L+HP   LL+  LWLLST  GTL+ CG    S+QFP++ ++P+
Sbjct  99   ASMTGTPERFGCMISEKLKHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPD  158

Query  441  ISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            +   KR +I+RSWS  Y++  +  +  +K
Sbjct  159  LPLQKRQQIMRSWSLSYLRHFRMLFRTIK  187



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M +++++ DT LP++D   H++  D+SV  F++ SAS+AGTPQ    MI E+L+H
Sbjct  60   LSSRQMKSLSALCDTILPSLDHFPHSS--DESVNRFYRISASMAGTPQLFGGMICEKLKH  117

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P   LL+L LW LST  GTL+LCG   +S++FP++ S+P++S  KR +I+RSWS  YI+ 
Sbjct  118  PMTGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRSWSLSYIRH  177

Query  501  LKTFYLGMK  527
            L+  +  +K
Sbjct  178  LRQLFRTIK  186



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 91/138 (66%), Gaps = 8/138 (6%)
 Frame = +3

Query  129  GGCPLSPAV-----MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  293
            GG P  P +     M ++T+  D FLP+VDV   +   D+ +  F+ TSAS+AGTP+R+ 
Sbjct  33   GGRPTHPNLLSKREMDSLTAACDAFLPSVDV---SDTGDEGLIAFYGTSASMAGTPERIG  89

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             ++S  +QHP + LLRLALWLLST  GT +LCG+ASLS+QFPYLQ FP++   K+ EI+ 
Sbjct  90   GLLSGGMQHPAIGLLRLALWLLSTWYGTFILCGRASLSNQFPYLQKFPQVRREKQEEILL  149

Query  474  SWSCCYIKILKTFYLGMK  527
            SWS   +  LK  Y  +K
Sbjct  150  SWSRSSLCPLKMLYKCLK  167



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D  +   V+DD V  ++  SAS  GTP RVA ++SERL H
Sbjct  20   LTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSERLDH  79

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ LW LST IG+L+LCG+ S S +FPY + F ++   +R EI+ +WS  YI +
Sbjct  80   PKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREEILLNWSSSYIVL  139

Query  501  LKTFYLGMK  527
            ++  +  +K
Sbjct  140  IRMLFRSLK  148



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LSP  M ++ ++ DT +P+++         +SV  F++TSAS+AGTPQR+  +I E+L+H
Sbjct  69   LSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLGILI-EKLKH  127

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P   LL + LWLLST  GTL+LCGKASLS+ FP+ +SFP++S   R  +++ WS  Y   
Sbjct  128  PSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKCWSQSYFHH  187

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  188  LRMFFRTIK  196



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
            + GTPQ +AWMI+ RLQHPK+ L +LALWLLSTRIGT +LCGKASLS+QFPYLQ+F  IS
Sbjct  1    MNGTPQHIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNIS  60

Query  447  PHKRAEIVRSWSCCYIKILKTFYLGMK  527
            P KR E V+SW+    K+L+  +   K
Sbjct  61   PKKREESVKSWATSCFKLLRILFFAAK  87



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++SERL H
Sbjct  42   LTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSERLDH  101

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS  Y  +
Sbjct  102  PKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASYFSL  161

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  162  LRMFFKSIK  170



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D      VDDDSV  +F  SAS  GTP RVA ++SERL H
Sbjct  42   LTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSERLDH  101

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS  Y  +
Sbjct  102  PKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASYFSL  161

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  162  LRMFFRCIK  170



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQH---AAVDDDSVKLFFQTSASIAGTPQRVAWMISER  311
            LSP  M ++ ++ DT LP+++   +    + DD+SV  F++TSAS+AGTP+ +  +ISE+
Sbjct  75   LSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTPEHLGILISEK  134

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  491
            L+HP   LL L+LWLLST  GT +LCG  SLS++FP+  S+PE+S  K+ ++++SWS  Y
Sbjct  135  LRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQKVMQSWSLSY  194

Query  492  IKILKTFYLGMK  527
            ++ L+  +  +K
Sbjct  195  LRPLRMLFRTIK  206



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  285  RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  464
            ++AWMIS RLQHP++ L +LALWLLSTRIGT +LCGKASLS+QFPYLQ+F  ISP KR E
Sbjct  12   QMAWMISNRLQHPRLNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQNFSNISPKKREE  71

Query  465  IVRSWSCCYIKILKTFYLGMK  527
            IV+SW+    K+L+  Y  MK
Sbjct  72   IVKSWATSCFKLLRILYFAMK  92



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 86/134 (64%), Gaps = 5/134 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMIS  305
            LS   M ++T++ DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  
Sbjct  41   LSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSSASMAGTPQRVGELFC  100

Query  306  ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC  485
            ER+QHPK  L+RL L+LLST IGT +LCG  S+S  FPY Q F +IS  KR +IV SW+ 
Sbjct  101  ERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQISQSKREQIVFSWAT  160

Query  486  CYIKILKTFYLGMK  527
             +  +L+  +  +K
Sbjct  161  SFFYLLRMLFKSIK  174



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAA---VDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPK  326
            M  ++++ DTFLPA+DV  +     +     + F+QTSAS+AG P  V   +  +++HPK
Sbjct  13   MEALSALCDTFLPAIDVDNYDVGPQLHSSLHRQFYQTSASMAGIPHHVGEFLGGKVEHPK  72

Query  327  VIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILK  506
            + L RLA+ LLSTRIG+L+LCG+ SLS +FPY Q+F ++S  +R EI+ SWS     +L+
Sbjct  73   MCLARLAIMLLSTRIGSLILCGRKSLSPKFPYFQTFSKVSCERREEILLSWSTSSFLLLR  132

Query  507  TFYLGMK  527
              +  +K
Sbjct  133  ILFTALK  139



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS     ++ ++ D FLP++ VP HA     S++ ++  SAS+ GTP+ V   +SER+QH
Sbjct  47   LSSREKDSLAAVCDAFLPSIHVP-HAP--HQSLRTYYANSASMIGTPEVVGGYLSERIQH  103

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P++  LRLALWLLST  GT +LCG  SLS +FP+ +SFPE+    R +I+RSWS   I +
Sbjct  104  PRLWQLRLALWLLSTWFGTFILCGTNSLSCRFPFFRSFPEVEAAGREDIIRSWSMSCIFL  163

Query  501  LKTFYLGMK  527
            L+  Y G K
Sbjct  164  LRVLYKGFK  172



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP R A ++SERL HPK  +
Sbjct  1    MESLVAICDTFISSIDGSGVGHVDD-CVAGYFSASASQTGTPDRAARLMSERLHHPKKWI  59

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            LR  LWLLST IGTL+LCG+ S + QFPY + F  +   +R EI+ +WS  Y  +L+ F+
Sbjct  60   LRAGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREEILLNWSSSYFSLLRMFF  119

Query  516  LGMK  527
              +K
Sbjct  120  RSIK  123



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ +I DT +P++D  +   VDD  V  ++  SAS  G P RVA +ISERL HPK  +
Sbjct  1    MESLVAICDTLIPSIDGSEVGHVDD-GVAGYYSASASQTGAPDRVARLISERLDHPKKWI  59

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            LR A+W LST IG+L+LCG+ S +S+FPY Q F  +   +R EI+ +W+  Y  +L+  +
Sbjct  60   LRAAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREEILLNWASSYFLLLRMLF  119

Query  516  LGMK  527
              +K
Sbjct  120  RSIK  123



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 5/129 (4%)
 Frame = +3

Query  156  MATVTSISDTFLPAV-DVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMISERLQH  320
            M ++T+I DT  P+V +    AA  DD    S+  F+Q+SAS+AGTPQRV  +  +R+QH
Sbjct  1    MESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQH  60

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  L+RL L+LLST IGT +LCG  S+S  FPY   F +IS  KR +IV SW+  +  +
Sbjct  61   PKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQIVFSWATSFFYL  120

Query  501  LKTFYLGMK  527
            L+  +  +K
Sbjct  121  LRMLFKSIK  129



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M T+ +  DT +P++D        DDSV  +F  SAS  GTP RVA ++SERL H
Sbjct  28   LTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGTPDRVARLMSERLDH  87

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ALWLLST IG+L+LCG+ S + +FPY + F  +   +R  I+ +WS  Y  +
Sbjct  88   PKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQREAILLNWSESYFSL  147

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  148  LRMFFRCIK  156



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D      VDD SV  +F  SAS  GTP RVA +ISERL H
Sbjct  40   LTQREMESLVAICDTLIPSIDGSGVGHVDD-SVAEYFSASASQTGTPDRVAKLISERLDH  98

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ALW LST IG+ +LCG+ S + +FPY + F  +   +R +++ +WS  Y  +
Sbjct  99   PKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSASYFSL  158

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  159  LRMFFKCIK  167



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 3/131 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  314
            LSP  M  +T+ SDT LP+V  D+     ++D   K F++TSAS+AGTP+ V   +S ++
Sbjct  60   LSPRQMEVLTAFSDTLLPSVFPDINCSGQLEDSLFK-FYRTSASMAGTPELVGGFLSGKI  118

Query  315  QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYI  494
            +HP + +L LALWLLST  GT +LCG  SLS+QFPY Q F ++S  KR +I+ SWS    
Sbjct  119  EHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQKKREKILLSWSSSSF  178

Query  495  KILKTFYLGMK  527
             I +  +  +K
Sbjct  179  NIYRMLFKTLK  189



>emb|CDX99381.1| BnaC01g11710D [Brassica napus]
Length=170

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 80/124 (65%), Gaps = 1/124 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ +I DT +P+ D  +   +DD  V  ++  SAS+ GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTLIPSFDASEVGHLDD-GVAGYYSASASLTGTPDRVARLMSERLCHPKKWI  59

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            LR+ LW LST IG+L++CG+ S + ++PY + F  +   +R EI+ +W+  Y  +L+ F+
Sbjct  60   LRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREEILLNWASSYFILLRMFF  119

Query  516  LGMK  527
              +K
Sbjct  120  RSIK  123



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 78/120 (65%), Gaps = 2/120 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M  ++++ DT LP+VDV     +     + F+QTSAS+  TP  VA ++  +++HPK+ L
Sbjct  18   MEALSALCDTLLPSVDV--DGQLHPSFHRQFYQTSASMTATPHHVAELLGGKIEHPKIYL  75

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
             RLA+ LLSTRIGT +LCG+ SL  +FPY Q+F E+   +R +I+RSWS     +L+  +
Sbjct  76   GRLAVGLLSTRIGTFVLCGRKSLCPKFPYFQTFSEVPYEEREQILRSWSTSNFLLLRILF  135



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 94/167 (56%), Gaps = 34/167 (20%)
 Frame = +3

Query  129  GGCP-----LSPAVMATVTSISDTFLPAVDV------PQHAAVD----------------  227
            GG P     LSP  M ++T++ DT +P++DV      P++A  D                
Sbjct  48   GGLPPSPNHLSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSDFHG  107

Query  228  -------DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLML  386
                   DD+++ FF TSAS++GTP  VA ++S +++H    +LRL LWLLST  GT ++
Sbjct  108  QQQQNAGDDAIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFII  167

Query  387  CGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
            CG  SLSS FPY QSFP+I   KR EI+ SWS   I +L+  +  +K
Sbjct  168  CGTLSLSSHFPYFQSFPQIIQPKREEIMLSWSTSSIYLLRALFQCIK  214



>emb|CDY66155.1| BnaA01g34940D [Brassica napus]
Length=170

 Score = 89.7 bits (221),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 79/124 (64%), Gaps = 1/124 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTLIPSLDASEVGHLDD-GVAGYYSASASHTGTPDRVARLMSERLHHPKKWI  59

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            LR+ LW LST IG+L++CG+ S + ++PY + F  +   +R EI+  W+  Y  +L+ F+
Sbjct  60   LRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREEILLIWASSYFILLRMFF  119

Query  516  LGMK  527
              +K
Sbjct  120  RSIK  123



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33   LTAREMESLWAICDTLIPSINGSEVCHVDDH-VAGFFAASASQMGTPDRVARKISGTLDH  91

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  LLR ALWLLST IG+L+LCG+ S S +FPY + F  +   +R EI+ SW+  +  +
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  501  LKTFYLGMK  527
            L+ F+  MK
Sbjct  152  LRMFFKAMK  160



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P+++  +   VDD  V  FF  SAS  GTP RVA  IS  L H
Sbjct  33   LTAREMESLWAICDTLIPSINGSEVCHVDDH-VAGFFAASASQMGTPDRVARKISGTLDH  91

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  LLR ALWLLST IG+L+LCG+ S S +FPY + F  +   +R EI+ SW+  +  +
Sbjct  92   PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  501  LKTFYLGMK  527
            L+ F+  MK
Sbjct  152  LRMFFKAMK  160



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = +3

Query  132  GCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  311
            G  L+   M ++T+ISDTFLP++D+P      ++S++ F+  SAS+ GTP+ V   +S R
Sbjct  48   GNGLTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLASASMIGTPEIVGGYVSRR  104

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCY  491
            L+H  + LLRL+LWLLST  GT + CG   +S +FP+   F +I P +R EI+ SWS   
Sbjct  105  LRHALLGLLRLSLWLLSTWYGTFIFCGTRCVSCRFPFFHKFSDIDPTRREEILSSWSSSP  164

Query  492  IKILKTFYLGMK  527
            I + +  +  MK
Sbjct  165  IYLYRKLFRAMK  176



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 83/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  332
            M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64   MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            LL+  LWLLST +GT++LCG    S++FP++ +FP +  HKR  I++SWS  + + L+ F
Sbjct  123  LLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSFFRHLRMF  182

Query  513  YLGMK  527
            +  +K
Sbjct  183  FKTIK  187



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 83/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ-HPKVI  332
            M +++ ++DT LP+++    A  DD+S   F+  SAS+AGTP+ V  +ISERL  HP   
Sbjct  64   MKSLSVLADTILPSIN-DFVAIKDDESAATFYHISASMAGTPELVGGVISERLNYHPMTW  122

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            LL+  LWLLST +GT++LCG    S++FP++ +FP +  HKR  I++SWS  + + L+ F
Sbjct  123  LLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSFFRHLRMF  182

Query  513  YLGMK  527
            +  +K
Sbjct  183  FKTIK  187



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ +I DTF+ ++D      VDD  V  +F  SAS  GTP RVA ++SERL HPK  +
Sbjct  1    MESLVAICDTFISSIDDSGVGHVDD-CVAGYFSASASQTGTPDRVARLMSERLHHPKKWI  59

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTFY  515
            LR  LWLLST IG+L+LCG  S + +FPY + F  +   +R EI+ +WS  Y  +L+  +
Sbjct  60   LRAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLF  119

Query  516  LGMK  527
              +K
Sbjct  120  RTIK  123



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 84/129 (65%), Gaps = 3/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            +S   M ++T+I D FLP++ V    A    +   F+Q+SAS+A TP+RV  ++SER++H
Sbjct  387  ISSREMESLTAICDAFLPSLHVSAADADAVAT---FYQSSASMAATPERVGGLLSERMEH  443

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  ++RLALWLLST +GT +LCG  SLS+ FP+  +F ++S  KR EI+ SWS  +   
Sbjct  444  PKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREEILLSWSLSFFYH  503

Query  501  LKTFYLGMK  527
            L+  +   K
Sbjct  504  LRMLFKSTK  512



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 88/151 (58%), Gaps = 3/151 (2%)
 Frame = +3

Query  75   DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  254
            D  F   + E     VY+    ++   M ++ +I DT +P+ D  +   +DD  V  ++ 
Sbjct  19   DVEFGGLRQEDETKTVYAN--SMTAREMESLVAICDTLIPSRDASEVGHLDD-GVAGYYS  75

Query  255  TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  434
             SAS  GTP RVA ++SERL HPK  +LR+ LW LST IG+L++CG+ S + ++PY + F
Sbjct  76   ASASHTGTPDRVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRF  135

Query  435  PEISPHKRAEIVRSWSCCYIKILKTFYLGMK  527
              +   +R EI+ +W+  Y  +L+ F+  +K
Sbjct  136  CWLPETQREEILLNWASSYFILLRMFFRSIK  166



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  317
            LS   M ++ ++ DT LP+++   H+A D DDS+  F+  SAS   TPQ VA +I+E+L 
Sbjct  21   LSSREMHSLCTLCDTLLPSIN---HSATDEDDSLSNFYWASASTTATPQLVAGIITEKLP  77

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  497
             PK  +LRL LWLLST  GT +L GK+SLS++FPY Q F ++S  KR EI+ SWS     
Sbjct  78   LPKAGILRLTLWLLSTWFGTFILTGKSSLSTKFPYFQKFSQVSQKKREEILLSWSTSSFS  137

Query  498  ILK  506
            +L+
Sbjct  138  LLR  140



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ LW LST IG+L+LCG+ S    FPY Q F  +   +R E + +W+  Y  +
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQRFCRLPKKQREETLLNWASSYFLL  157

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  158  LRMFFRSIK  166



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++T+ISDTFLP++D+P      ++S++ F+ TSAS+ GTP+ V   +S RL+H
Sbjct  51   LTAREMDSLTAISDTFLPSIDLP---GARNESIRAFYLTSASMIGTPEIVGGYMSGRLRH  107

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
              + LLRL+LWLLST  GT + CG   +S +FP+   F +I P +R +I+ SWS   I +
Sbjct  108  ASLWLLRLSLWLLSTWYGTFIFCGTRCMSCRFPFFHKFSDIDPKRREQILSSWSSSPIYL  167

Query  501  LKTFYLGMK  527
             +  +  +K
Sbjct  168  YRQLFRALK  176



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++T++ DT LPAVD P++ A  D+S+  F++TSAS+AGTP+ +  MIS RL+H
Sbjct  50   LSAREMDSLTALCDTILPAVDPPENTA--DESLVRFYKTSASMAGTPEHLGRMISHRLRH  107

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
              V L+R  L++LSTR+GT +  G  SLS  FP+   F E+S  KR  I+ S S     +
Sbjct  108  -HVFLIRFLLFMLSTRLGTFVFGGIHSLSICFPFFLKFSELSLEKRQHILLSLSTSCFIL  166

Query  501  LKTFYLGMK  527
             +  ++G+K
Sbjct  167  FRMAFVGIK  175



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSLDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            PK  +LR+ LW LST IG+L+LCG+ S    FP+ Q F  +   +R E + +W+  Y  +
Sbjct  98   PKKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  158  LRMFFRSIK  166



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L+   M ++ +I DT +P++D  +   +DD  V  ++  SAS  GTP RVA ++S+RL H
Sbjct  39   LTAREMESLVAICDTLIPSIDGAEVGHLDD-GVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
            P+  +LR+ LW LST IG+L+LCG+ S    FP+ Q F  +   +R E + +W+  Y  +
Sbjct  98   PRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  501  LKTFYLGMK  527
            L+ F+  +K
Sbjct  158  LRMFFRSIK  166



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 84/133 (63%), Gaps = 7/133 (5%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M ++T++ DT LPAVD P+  +  D+SV  F++TSAS+ GTP+ V  MIS+RL+ 
Sbjct  45   LSSWEMESLTALCDTLLPAVDPPE--STTDESVVRFYRTSASMNGTPEHVGRMISQRLRQ  102

Query  321  PKVIllrlalwllSTRIGTLMLCGKA----SLSSQFPYLQSFPEISPHKRAEIVRSWSCC  488
              V+L R+ L LL+TR+GT +L        +LS ++P+L    E+S  KR ++V SW   
Sbjct  103  -HVLLGRIILVLLATRLGTFVLGLLGGGLPNLSPRYPFLLKCSEMSLEKRQQLVLSWRTS  161

Query  489  YIKILKTFYLGMK  527
            +  +++  + GMK
Sbjct  162  WFYLVRMIFFGMK  174



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 1/125 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16   LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
             +   +   L LLS+RIGTL+LCG+ + S++FP+L  F  +    R   +RSWS   I  
Sbjct  75   AQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQ  134

Query  501  LKTFY  515
              + Y
Sbjct  135  FHSLY  139



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 71/125 (57%), Gaps = 1/125 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            L P  +  V +I DTFLPA+ + +    ++++ + FF TSAS AG P +VA  I E L  
Sbjct  16   LDPPQLEAVAAICDTFLPALPL-RALECEEEAQRAFFATSASDAGIPAQVAGWIFECLDS  74

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
             +   +   L LLS+RIGTL+LCG+ + S++FP+L  F  +    R   +RSWS   I  
Sbjct  75   AQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNRERTLRSWSGGSIAQ  134

Query  501  LKTFY  515
              + Y
Sbjct  135  FHSLY  139



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  162  TVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllr  341
            ++ ++ DT LP VDV   ++V D+ +  F+ TSAS+ GT + +  ++S  L+HP   LL 
Sbjct  29   SLAAVCDTLLPQVDV---SSVGDEGLVEFYGTSASMVGTSEHIGGLLSGGLKHPAAGLLY  85

Query  342  lalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            LALWLLST  GT  +CG  SLS QFPY   F ++   KR +I+ SWS
Sbjct  86   LALWLLSTWYGTFAMCGTRSLSKQFPYFHRFAKVERTKREQILLSWS  132



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS + + ++ +I D F+P++  P    + D  V+ F++ S S  G P++VA +I+ R++ 
Sbjct  25   LSASQIKSLAAICDAFIPSI--PPTNDLQDPEVESFYRLSGSQNGIPEQVAELIARRVKP  82

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
               ++ R  LWLLSTR+GT +LCG ASL  +FPYLQ F ++    R +I+  WS
Sbjct  83   IAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQQVSREQILLDWS  136



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            +ISERL+HPK  L+RLALW+LST IGT +LCG AS+S+ FPY QSF +++ HKR +I+ S
Sbjct  11   LISERLKHPKKWLIRLALWMLSTWIGTFILCGVASISTHFPYFQSFSQLTLHKREKILHS  70

Query  477  WSCCYIKILKTFYLGMK  527
            WS  ++  L+  +  MK
Sbjct  71   WSLSFLYPLRMLFKAMK  87



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 3/117 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP---QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISER  311
            LS + M ++ SI +TF P +D P    H    ++S+K FFQ+SAS    P  VA ++ +R
Sbjct  24   LSSSEMESLISICETFFPPLDPPSKLDHHDQINNSIKYFFQSSASQKPIPNEVAEVMKDR  83

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
                 VIL+R+ LWL+STR+GTL+LCG      ++PY+  F  +   +R  I+++WS
Sbjct  84   GLVEAVILVRVVLWLISTRLGTLLLCGFLCFGKEWPYITKFSHLPIERRERILKNWS  140



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 1/125 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             + A + T+ SI D F P++  P     +   +  F+  SAS  G P+ +A ++   L+ 
Sbjct  32   FTKAQLRTLISICDAFSPSLSPPAECE-EKQEIASFYTCSASDMGVPEDIAGLLHVLLKP  90

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI  500
              ++ +R+ LWLLSTRIGTL+L G+ASL++QFP+ QSF  +S  K+ +I+R WS   +  
Sbjct  91   QLLMAIRVFLWLLSTRIGTLILGGRASLTTQFPFFQSFAYLSTDKQEDILRGWSLSTLGA  150

Query  501  LKTFY  515
             +  Y
Sbjct  151  FRAVY  155



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 85/152 (56%), Gaps = 18/152 (12%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  266
            KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKHNHG-------LSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFYKASGA  67

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68   QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  447  PHKRAEIVRSWSCCYI--------KILKTFYL  518
              KR ++++ W   +I         ILKTF L
Sbjct  128  LEKREKVLQKWFKNWIFTPVRIAFFILKTFCL  159



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 77/131 (59%), Gaps = 10/131 (8%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  266
            KAE+ N G       LS A + ++ S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKHNHG-------LSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFYKASGA  67

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68   QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  447  PHKRAEIVRSW  479
              KR ++++ W
Sbjct  128  LEKREKVLQKW  138



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 14/145 (10%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAA--------VD  227
            G  L   G+  R   G Y  G  LS A M T++++  TF+P V  P  AA          
Sbjct  6    GHPLLRGGR--RAEKGGYRHG--LSAAQMRTLSAMCGTFVPTV--PIEAACLGGGKDEAP  59

Query  228  DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLS  407
            D++V+ FF  S S +  P  VA ++  R Q   V L++L LW+L+TR+GTL+LCG  SLS
Sbjct  60   DEAVEAFFLASGSDSPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCGSLSLS  119

Query  408  SQFPYLQSFPEISPHKRAEIVRSWS  482
             +FP++  F ++   KR  I+  W+
Sbjct  120  WRFPFINKFSDMPVEKREHILMKWN  144



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 10/131 (8%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  266
            KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68   QAPVPDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  447  PHKRAEIVRSW  479
              KR ++++ W
Sbjct  128  LEKREKVLQKW  138



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 10/131 (8%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD---DSVKLFFQTSAS  266
            KAE+ N G       LS A +  + S+ + FLP +        +D    +++ F++ S +
Sbjct  15   KAEKYNHG-------LSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGA  67

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             A  P +VA ++ +RL    VIL+R+ L +LST++GTLMLCG   LS ++PY+ +F  +S
Sbjct  68   QAPVPDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMS  127

Query  447  PHKRAEIVRSW  479
              KR ++++ W
Sbjct  128  LEKREKVLQKW  138



>ref|XP_003607655.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1, partial [Medicago truncatula]
Length=189

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (60%), Gaps = 3/114 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  311
             S A M ++TSI +   P++ +      DD+S   V+ FF  SAS    P  VA M  +R
Sbjct  22   FSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDEVAEMFEKR  81

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
                 VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV+
Sbjct  82   AVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQ  135



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 72/135 (53%), Gaps = 6/135 (4%)
 Frame = +3

Query  75   DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  254
            D L   G+ E    G Y+ G   S A M ++ SI +  LP + +         +V+ F+Q
Sbjct  6    DPLLRGGRRE----GKYTHG--FSSAEMQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQ  59

Query  255  TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  434
             S S    P   A +  +R     VIL+R+ L +LSTR+GTL+LCG  S S ++P++ +F
Sbjct  60   ASGSQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNF  119

Query  435  PEISPHKRAEIVRSW  479
              IS  KR +I++ W
Sbjct  120  SSISLEKREKILQRW  134



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 71/135 (53%), Gaps = 6/135 (4%)
 Frame = +3

Query  75   DSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQ  254
            D L   G+ E    G Y+ G   S A M ++ SI +  LP + +          V+ F+Q
Sbjct  6    DPLLRGGRRE----GKYTHG--FSSAEMQSLASICEVLLPPLPLNSIEGQPSKGVQSFYQ  59

Query  255  TSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSF  434
             S S    P   A +  +R     VIL+R+ L +LSTR+GTL+LCG  S S ++P++ +F
Sbjct  60   ASGSQHPIPDEGAELFVKRALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNF  119

Query  435  PEISPHKRAEIVRSW  479
              IS  KR +I++ W
Sbjct  120  SSISLEKREKILQRW  134



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVD-DDSVKLFFQTSASIAGTPQRVAWMISERLQ  317
             S A M  ++SI +T LP + +P     +    V+ FF+ S      P ++A ++ +R  
Sbjct  22   FSSAEMKALSSICETVLPPISIPGKGGHEISKPVQAFFKASGFENPVPDQIAELLVKRAI  81

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               +IL+RL L  LSTR+GTL+LCG      ++PYL +F  IS  KR +I++ W
Sbjct  82   IEGLILVRLVLLALSTRLGTLLLCGSLCFGEKWPYLNTFSSISLDKREKIMQKW  135



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 70/122 (57%), Gaps = 5/122 (4%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVD--DDSVKLFFQTSASIAGTPQRVA  293
            YS G   S + + T+TSI +  LP   +   H  ++  +D V+ F++ SAS    P  VA
Sbjct  20   YSHG--FSSSQIQTLTSICEVLLPPTPLNNPHENINPQNDVVQAFYKASASQYPVPDEVA  77

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             ++ +R      IL+   + +LSTR+GTL++CG + +S ++P+L+ F EI    R ++V+
Sbjct  78   ELVMKRAFFEAKILVIAIVRILSTRVGTLLICGSSGVSKKWPFLKKFSEIPLENREKVVQ  137

Query  474  SW  479
             W
Sbjct  138  KW  139



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            ++SERL+HPK  L+RL LWLLST IG+L+LCG+   SS+FPY+ SF ++   KR  ++ S
Sbjct  4    LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  63

Query  477  WSCCYIKILKTFYLGMK  527
            WS  Y   L+  Y  MK
Sbjct  64   WSLSYFYHLRMLYKAMK  80



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 14/138 (10%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  311
             S A M ++TSI +   P++ +      DD+S   V+ FF  SAS    P  VA M  +R
Sbjct  22   FSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDEVAEMFEKR  81

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR------  473
                 VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV+      
Sbjct  82   AVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQRGLKHK  141

Query  474  -----SWSCCYIKILKTF  512
                   +  YIKIL  F
Sbjct  142  FLTPFRLAFVYIKILCLF  159



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMIS  305
             S + M ++ SI +  LP     A+ + +H  V  + V+ F+ TSAS    P  VA ++S
Sbjct  22   FSSSEMESLASICEVILPPLPMDALKIKKHDDVSIEDVEFFWNTSASHYPIPHEVAEILS  81

Query  306  ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
            +R     VIL+R+ LWLL+TR+GT +LCG    S ++P++ +F  +S  KR  +++ W
Sbjct  82   KRSLIEAVILIRVVLWLLATRLGTFLLCGLLCFSEKWPFINNFSSMSLKKRERVMQWW  139



>gb|KEH15695.1| long-chain-alcohol oxidase FAO1, partial [Medicago truncatula]
Length=653

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  311
             S A M ++TSI +  LP++ +      DD+S   V+ FF  SAS+   P  VA M+ + 
Sbjct  22   FSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDEVAEMLVKS  81

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
                 VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV+
Sbjct  82   GVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQ  135



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 1/114 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  5    LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  63

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+
Sbjct  64   EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWT  117



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS---VKLFFQTSASIAGTPQRVAWMISER  311
             S A M ++TSI +  LP++ +      DD+S   V+ FF  SAS+   P  VA M+ + 
Sbjct  31   FSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDEVAEMLVKS  90

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
                 VIL+R+ LWLL+TR+GTL++CG   LS ++P++ +F  +S  KR +IV+
Sbjct  91   GVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKIVQ  144



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 1/114 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  26   LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  84

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+
Sbjct  85   EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWT  138



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 1/114 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
            LS   M  + +I D  +P++ + +  +  D ++  F+ TSAS    P   A ++ +R   
Sbjct  26   LSTTQMHVMAAICDALIPSLPLNKDTS-QDQALSDFYNTSASQLPFPDEAAELLYKRTVP  84

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V L+   LW+LS R+GTL+LCG+ SL  ++P+++ F EIS  KR +I R+W+
Sbjct  85   EAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWT  138



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 7/127 (6%)
 Frame = +3

Query  117  GVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTP  281
            G YS G  LS   M  VT+I +  +P     ++ V    +    S++ F+  S S    P
Sbjct  24   GSYSHGFSLSE--MQVVTAICEALIPPIPLGSLHVNGKESPPSKSIQSFYLASGSQKPIP  81

Query  282  QRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRA  461
              VA +I  +     V+++RL LW+LSTR+GTL++CG  S  S++P+L  F E+S  KR 
Sbjct  82   DEVAELIVTKALWHGVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEKRE  141

Query  462  EIVRSWS  482
            E+++ WS
Sbjct  142  EVLKKWS  148



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (55%), Gaps = 7/124 (6%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAV---DVPQHAAVD--DDSVKLFFQTSASIAGTPQR  287
            YS G   S + +  +TSI +  LP +   +  +++  +  D S + F   S S    P  
Sbjct  18   YSHG--FSTSELEILTSICEVLLPPIPLMNSQENSTKNEVDQSYEAFCNASGSQYPVPDE  75

Query  288  VAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEI  467
            VA +I +R      IL+R  L +LSTR+GTL++CG  S   ++PYL+ F EIS  KR ++
Sbjct  76   VAELIKKRGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLKKFSEISLEKREKV  135

Query  468  VRSW  479
            V+ W
Sbjct  136  VQKW  139



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 3/121 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKL-FFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M  + +I DT +P++  P  A+  D+S K  FF+ SAS +G    VA MI       +  
Sbjct  1    MKVLNAICDTLVPSL--PVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYF  58

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L+ +A  +LSTR+GTL+L G + ++++FP++Q FP +   KR +I+ +WS      L+  
Sbjct  59   LIYIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLTWSRSIFHKLQML  118

Query  513  Y  515
            +
Sbjct  119  F  119



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (61%), Gaps = 4/102 (4%)
 Frame = +3

Query  189  LPAVDVP----QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwl  356
            LP+ DV     Q +A    +++ FF    S    P+ VA ++  R     V+ +R+AL L
Sbjct  13   LPSDDVHVEGIQPSAARKIAIRAFFSAPGSRPPIPEAVAELMKRRALPEAVVAVRVALRL  72

Query  357  lSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            LSTRIGTL+LCG  SL+ ++P+L  F +I  HKR +I++SWS
Sbjct  73   LSTRIGTLLLCGFRSLTWKWPFLLKFSQIQLHKREKILQSWS  114



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 3/121 (2%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKL-FFQTSASIAGTPQRVAWMISERLQHPKVI  332
            M  + +I DT +P++  P  A+  D+S K  FF+ SAS +G    VA MI       +  
Sbjct  1    MKVLDAICDTLVPSL--PVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYF  58

Query  333  llrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKTF  512
            L+ +A  +LSTR+GTL+L G + ++++FP++Q FP +   KR +I+ +WS      L+  
Sbjct  59   LIYIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLNWSRSIFHKLQML  118

Query  513  Y  515
            +
Sbjct  119  F  119



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S + M  + +  +  +P V + + + +D  S+  F+Q+SA  A  P  VA ++ ER   
Sbjct  23   FSSSQMEAMAAFCEALIPPVPLFKESPLDQ-SLLSFYQSSAFQAPIPDEVADLLVERANP  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIK  497
              V L++L L LLS RIGTL+LCG      ++P+   F EIS  KR  I+++WS  + K
Sbjct  82   KAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKRERILKNWSMAHHK  140



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = +3

Query  150  AVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKV  329
             V+ T++++ D FLP++D      +D  +   F++TSAS++ TP+ V  M++ + +HPK+
Sbjct  7    GVLETLSAVCDAFLPSIDDGGGIDIDPSAAD-FYRTSASMSETPRGVMEMLA-KARHPKI  64

Query  330  IllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKILKT  509
             L   ALW LSTRIG+++LCG+  +      ++ F E+   +R EI+  WS  ++  L+ 
Sbjct  65   SLAVPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRHFLPHLRI  123

Query  510  FYLGMK  527
            FY  +K
Sbjct  124  FYHSLK  129



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 82/158 (52%), Gaps = 14/158 (9%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDD--------DS  236
            L   G      D  +  G   S + + T+T++ +T +P++    H +V          +S
Sbjct  6    LLRGGNKRSDKDNSFKHG--FSSSQIQTLTAMCETIIPSL---PHTSVTQQILSLHPQNS  60

Query  237  VKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQF  416
            +  FF  SAS    P  VA +I +R+    VIL+R+ L LLSTR+GTL+ CG   L  ++
Sbjct  61   ILSFFGNSASQPPIPDEVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEWKW  120

Query  417  PYLQSFPEISPHKRAEIVRSWSC-CYIKILKTFYLGMK  527
            P++  F E+S  KR ++++ WS   Y   L+  +L +K
Sbjct  121  PFIHKFSEMSLEKREKLLQRWSTESYWTSLRVVFLLIK  158



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDV-PQHAA-VDDDSVKLFFQTSASIAGTPQRVAW  296
            YS G   S + + T+ S  +T +P +   PQH +  ++ ++  FF +SAS    P  VA 
Sbjct  19   YSHG--FSSSQIQTIASFCETLIPPLPYNPQHLSPCNNKALDSFFSSSASQPPFPNEVAE  76

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            ++ +R     ++++R+ ++LLSTR+G+L+LCG+  L  ++P++ +F E+S  +R  +++ 
Sbjct  77   LLVKRSNPEAMLIIRIVVFLLSTRLGSLVLCGRVCLDKRWPFVHNFSELSLKQRESLLQR  136

Query  477  WS  482
            WS
Sbjct  137  WS  138



>emb|CBI23676.3| unnamed protein product [Vitis vinifera]
Length=576

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 0/108 (0%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIl  335
            M ++ SI +  LP + +         +V+ F+Q S S    P   A +  +R     VIL
Sbjct  1    MQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQASGSQHPIPDEGAELFVKRALIEAVIL  60

Query  336  lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
            +R+ L +LSTR+GTL+LCG  S S ++P++ +F  IS  KR +I++ W
Sbjct  61   VRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRW  108



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 65/117 (56%), Gaps = 4/117 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP----QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISE  308
             S A M  + S+ +  LP ++      +     + ++ LF++ S S    P +VA M+ E
Sbjct  24   FSSANMEALASMCEALLPPIESEYLDKKGMKPTNKAIHLFWKLSGSHLSVPHQVAEMLVE  83

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
            R     + L+R+ L +LSTR+GTL+LCG   L+ ++P++ +F  IS   R ++++ W
Sbjct  84   RALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWPFINNFSNISLENREKVIQKW  140



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 68/120 (57%), Gaps = 3/120 (3%)
 Frame = +3

Query  132  GCPLSPAVMATVTSISDTFLPAVD---VPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            G   SPA +  + +I +T +P+V    +      DD ++  F+  S S    P  VA ++
Sbjct  19   GHGFSPAQIQALAAICETLIPSVSLDSINPKIPHDDPALHGFYSASGSQPSVPDEVAEIL  78

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            ++R Q   V+++ + L +LS R+GTL+LC  + L+S +P++ +F E+   +R  ++ +WS
Sbjct  79   TKRAQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFSEMPVERRERVLMNWS  138



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  225  DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  404
            +D++V+ F+++S S A  PQ VA ++  R     VI++R+ L +LSTR+GTL+LCG   +
Sbjct  66   EDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCV  125

Query  405  SSQFPYLQSFPEISPHKRAEIVRSW  479
              ++PY+ +F  +   +R +++R W
Sbjct  126  GGRWPYVNTFSSMGSDQREKVLRGW  150



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +3

Query  225  DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASL  404
            +D++V+ F+++S S A  PQ VA ++  R     VI++R+ L +LSTR+GTL+LCG   +
Sbjct  66   EDEAVRFFYESSGSQAPVPQEVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCV  125

Query  405  SSQFPYLQSFPEISPHKRAEIVRSW  479
              ++PY+ +F  +   +R +++R W
Sbjct  126  GGRWPYVNTFSSMGSDQREKVLRGW  150



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 79/132 (60%), Gaps = 8/132 (6%)
 Frame = +3

Query  105  RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTSAS  266
            R  +G Y  G   SP+ + ++ ++ + F+P++ + + H +   +     +++ F+  S S
Sbjct  18   RREEGGYRHG--FSPSQIQSLAAMCEAFIPSLSMEELHVSSGKEDPPTKNLQAFYLASGS  75

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             +  P  VA ++ +R     V+L++L LWLL+T++GTL+LCG  SL  +FP++  F ++S
Sbjct  76   ESPVPDEVAELMVKRGLREAVLLVKLVLWLLATKLGTLVLCGSLSLCGEFPFINKFSDMS  135

Query  447  PHKRAEIVRSWS  482
              KR E+++ W+
Sbjct  136  VEKREEVLKRWN  147



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRVAWMISE  308
            + PA M  + ++    +P++     A   D      ++ F+  SA+ +  P  VA ++  
Sbjct  52   MRPAQMEALRAMCGALIPSLPADADAGRGDPPGGKDLERFYLASAADSTIPDEVAELMVT  111

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            R     V L  + LW LSTR GTL+LCG+ SL + FPY++ F +++P +R   +R W+
Sbjct  112  RCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWN  169



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 75/132 (57%), Gaps = 6/132 (5%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD-VPQHAAVDDD---SVKLFFQTSA  263
            +  R  +  Y+ G  LS A M +++S+ +T LP++  +P+     +    +V+ F++ SA
Sbjct  10   RGGRNRESKYNHG--LSSAEMESLSSLCETILPSLSPIPKFDGKQNQPTKAVQAFYRASA  67

Query  264  SIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  443
            S    P  +A ++++R     V ++RL LWLLSTR+GT +LCG      ++PY ++F  I
Sbjct  68   SQTPMPDEMAELLTKRGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPYFKNFSSI  127

Query  444  SPHKRAEIVRSW  479
               KR  +++ W
Sbjct  128  PLDKRERVLQKW  139



>gb|EMS67203.1| Long-chain-alcohol oxidase FAO2 [Triticum urartu]
Length=388

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 10/139 (7%)
 Frame = +3

Query  96   KAERGNDG---VYSGGCPLSPAV-------MATVTSISDTFLPAVDVPQHAAVDDDSVKL  245
            K +RG  G   +  GG    P         M ++T++    +P++    H    D +V+ 
Sbjct  5    KKQRGRQGHPLLRGGGARTEPYTHGFSATQMMSLTAVCGALVPSLPPDAHHLAADKAVRD  64

Query  246  FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  425
            FF  SA+    P  VA ++S       + L+R  LWLL TR+GTL LCG   LS   P++
Sbjct  65   FFLASAANPPVPDEVAQLMSAMCLREALTLVRTVLWLLGTRLGTLALCGARCLSWSSPFV  124

Query  426  QSFPEISPHKRAEIVRSWS  482
            Q F E+   +R + +R WS
Sbjct  125  QRFAEMPVDRREDALRRWS  143



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (58%), Gaps = 3/114 (3%)
 Frame = +3

Query  189  LPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTR  368
            LP   V Q +  DD+++  ++ +SAS    P   A +I +R     V+++ L L  LSTR
Sbjct  44   LPTNGVNQIS--DDNALYSYYTSSASQTPFPNETAELIVKRGIPKAVLVVSLVLKFLSTR  101

Query  369  IGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSCCYIKI-LKTFYLGMK  527
            IGTL+LCG   L  ++P++  F E+S +KR  I++ WS   + + L+T +  +K
Sbjct  102  IGTLLLCGSNCLDWKWPFIHKFSELSINKRESILQKWSRGTLVLPLRTVFFMLK  155



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 14/157 (9%)
 Frame = +3

Query  30   SVQIMNKKKMISDDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP  209
            S Q   K    +  G  L    K ER   G       L P  M  + ++    +P++ V 
Sbjct  2    STQQQEKASAAAGRGSPLLRRCKRERYTHG-------LRPPQMEALRAMCGALIPSLPVE  54

Query  210  ------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRI  371
                  +H   + D V+ F++ SA+    P  VA M +       ++L+R+ LW+LST++
Sbjct  55   GPFHGDKHGGGNKDDVERFYRASAADGAIPDEVAEMATG-CAREAMLLVRVILWMLSTKV  113

Query  372  GTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            GT +LCG   +SS+FPY+  F ++   +R E+++ WS
Sbjct  114  GTFVLCGWLCVSSRFPYVFKFADMPLERREEVLKWWS  150



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRVAWMISE  308
            + PA M  + ++    +P++         D      ++ F++ SA+ +  P  VA ++  
Sbjct  35   MHPAQMEALRAMCGALIPSLPADGAHGRGDPPGGKDLERFYRASAADSTIPDEVAELMVT  94

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            R     V L  + LW+LSTR+GTL+LCG+  L+  FPY++ F +++P +R   ++ W+
Sbjct  95   RCIREAVALAWVVLWVLSTRVGTLLLCGRLCLAGGFPYVRKFADMTPERREAALQRWN  152



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +3

Query  246  FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  425
            F+Q+SA  A  P  VA ++ ER     V L++L L LLS RIGTL+LCG      ++P+ 
Sbjct  57   FYQSSAFQAPIPDEVADLLVERANPKAVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFF  116

Query  426  QSFPEISPHKRAEIVRSWSCCYIK  497
              F EIS  KR +I+++WS  + K
Sbjct  117  LKFSEISLEKREQILKNWSMAHHK  140



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 75/137 (55%), Gaps = 16/137 (12%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL---FF  251
            L   G+ E+G    YS G  LS + M  + SI +T  P++  P +   ++ S  L   + 
Sbjct  10   LLRGGRREKG----YSHG--LSTSQMHVMASICNTLFPSL--PLNPLTNETSQPLSPCYN  61

Query  252  QTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQS  431
             TSAS        A ++ +R+    + L+   LW+LS R+GTL++CG+  L  ++P++  
Sbjct  62   NTSAS-----HEAAELLHKRVVPEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIHK  116

Query  432  FPEISPHKRAEIVRSWS  482
            F EIS  KR EI+R+WS
Sbjct  117  FSEISLEKREEILRNWS  133



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A M T+TSI DT LP +           + K F+Q S + +  P+ VA    +R   
Sbjct  23   FSTAEMDTLTSICDTLLPPLPF-NSPTTTTPAEKAFYQVSGAQSPIPEEVAETARKRGLI  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
              V+L+R+ LW+L+TR+GTL+LCG      ++P++  F E+   KR E +R W
Sbjct  82   EIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRW  134



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 6/121 (5%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--VKLFFQTSASIAGTPQRVAW  296
            YS G   S + M T+TSI +T LP +  PQ+   + +S  ++   + SAS    P   A 
Sbjct  18   YSHG--FSSSEMETLTSICETILPPL--PQNEIPEKNSHNIQYLHKASASQYPIPDECAE  73

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            ++ +R     +IL+R  L +LSTRIGTL+LCG      ++PY+  F +I   KR  +++ 
Sbjct  74   VVMKRGFLEAIILVRGLLRILSTRIGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQK  133

Query  477  W  479
            W
Sbjct  134  W  134



>ref|XP_008356208.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=174

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGT------PQRVAWMI  302
             S A M ++ +I +  +P + + +   + DD   L + +S+    +      P  VA MI
Sbjct  25   FSSAQMQSLAAICEALIPPLSLEE---IPDDHQALHYSSSSYHTASGSQPPIPDEVAEMI  81

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
             +R Q   V  +RL L +LS R+GT +LCGK     ++P++  F E+S  KR +++  WS
Sbjct  82   VKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSELSLDKREQVLNKWS  141



>ref|XP_004157399.1| PREDICTED: LOW QUALITY PROTEIN: puromycin-sensitive aminopeptidase-like 
[Cucumis sativus]
Length=934

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 62/113 (55%), Gaps = 1/113 (1%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A M T+TSI DT LP +           + K F+Q S + +  P+ VA    +R   
Sbjct  23   FSTAEMDTLTSICDTLLPPLPF-NSPTTTTPAEKAFYQVSGAQSPIPEEVAETARKRGLI  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
              V+L+R+ LW+L+TR+GTL+LCG      ++P++  F E+   KR E +R W
Sbjct  82   EIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRW  134



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 71/132 (54%), Gaps = 8/132 (6%)
 Frame = +3

Query  102  ERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV------DVPQHAAVDDDSVKLFFQTSA  263
            E G +  YS G   S + +  +T + + F+P +      D+        ++++ F+++S 
Sbjct  12   EGGRETKYSHG--FSSSELEALTGMCEAFIPPLPLNNSPDIVGKDGKTKEAIQSFYKSSG  69

Query  264  SIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  443
            +    P +VA ++ +R     V+L+R+ L +LSTR+GTL+LCG      ++PY+  F +I
Sbjct  70   AQYPNPDKVAELVVKRGFMEAVMLVRILLIILSTRLGTLLLCGALCFGKKWPYINKFSDI  129

Query  444  SPHKRAEIVRSW  479
                R ++++ W
Sbjct  130  PVDNREKVIQKW  141



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 73/132 (55%), Gaps = 6/132 (5%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD-VPQHAAVDDD---SVKLFFQTSA  263
            +  R  +  Y+ G  LS A M  ++S+ +T  P++  +P+     +    +++ F++ SA
Sbjct  10   RGGRNRESKYNHG--LSSAEMEALSSLCETIFPSLSPIPKFDGKQNQPTKAMQAFYRASA  67

Query  264  SIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  443
            S    P  +A ++++R     V L+RL LWLLSTR+GT +LCG      ++PY ++F  I
Sbjct  68   SQTPMPDEMAELLTKRGLLEAVFLVRLVLWLLSTRLGTFLLCGSLCFEEKWPYFKNFSSI  127

Query  444  SPHKRAEIVRSW  479
               KR  +++ W
Sbjct  128  PLDKRERVLQKW  139



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 9/123 (7%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP---------QHAAVDDDSVKLFFQTSASIAGTPQRVA  293
             SPA + ++ +I +  +P + +          +  + DD ++   ++ S S    P  VA
Sbjct  25   FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQALHSIYRASGSQPPIPDEVA  84

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             ++ +R     +  ++L L +LS R+GTL+LCG   LS ++P++ SF E+S  KR E+++
Sbjct  85   ELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWKWPFIHSFSEMSLEKREEVLK  144

Query  474  SWS  482
             WS
Sbjct  145  KWS  147



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 15/134 (11%)
 Frame = +3

Query  117  GVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDSVKLFFQTSASIAGTP  281
            G YS G  LS   M  VT+I +  +P     ++ V    +    S++ F+  S S    P
Sbjct  24   GSYSHGFSLSE--MQVVTAICEALIPPIPLGSLHVNGKESPPSKSIQSFYLASGSQKPIP  81

Query  282  QRVA-------WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
              V         ++++ L H  V+++RL LW+LSTR+GTL++CG  S  S++P+L  F E
Sbjct  82   DEVTVVELVAELIVTKALWHG-VLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSE  140

Query  441  ISPHKRAEIVRSWS  482
            +S  KR E+++ WS
Sbjct  141  LSLEKREEVLKKWS  154



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 67/114 (59%), Gaps = 6/114 (5%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S   + T++S  +T +P  +   +  +DD+S   FF +S +    P  VA ++ +R + 
Sbjct  24   FSSTQIQTISSFCETLVPPCN---NKGIDDNS---FFASSGARPPYPNEVAELLVKRSKP  77

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              + ++R+ ++LLSTR+G+L+LCG+  L  ++P++ +F E+    R  +++ WS
Sbjct  78   EALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVHNFSELDLKDREALLQRWS  131



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 78/151 (52%), Gaps = 11/151 (7%)
 Frame = +3

Query  93   GKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-----DDSVKLFFQT  257
            G  ++GN   YS G   S   M  +++I + F+P++      A       + SV+ F+  
Sbjct  11   GGRKKGN---YSHG--FSYYQMEALSAICEAFIPSIPFDPLRATGGEGSPNKSVQSFYLV  65

Query  258  SASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFP  437
            S S    P  VA ++  R     V +++  LW+LSTR+GT +LCG  +    +P+L  F 
Sbjct  66   SGSQKPIPDEVAELLVSRSLWHAVFMVKFLLWMLSTRLGTSLLCGVLTFGCGWPFLYKFS  125

Query  438  EISPHKRAEIVRSWSCC-YIKILKTFYLGMK  527
            E+   KR +I++ WS   Y + L+ F++ +K
Sbjct  126  ELPLEKREQILQKWSGARYHRHLRMFFMLLK  156



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 43/145 (30%), Positives = 71/145 (49%), Gaps = 16/145 (11%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ--------HAAVD  227
            G  L    K ER   G       L P  M  + ++    +P++ V +        H    
Sbjct  17   GHPLLGGCKRERYTHG-------LRPPQMEALRAMCGALIPSLPVVEGHHGGDADHGRGS  69

Query  228  DDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLS  407
             D V+ F+  SA+    P  VA +++ R     V+L+ + LW+LSTR+GTL LCG+  +S
Sbjct  70   KDVVERFYLASAADGTIPDEVAELVT-RCVWEAVVLVNVVLWILSTRVGTLALCGRLCMS  128

Query  408  SQFPYLQSFPEISPHKRAEIVRSWS  482
             +FPY++ F ++   +R E +  W+
Sbjct  129  GKFPYVRKFADMPVERREEALGRWN  153



>gb|EMT04635.1| hypothetical protein F775_13385 [Aegilops tauschii]
Length=176

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 67/127 (53%), Gaps = 11/127 (9%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-------DDSVKLFFQTSASIAGTP  281
            Y+ G  L PA M  + ++    +P++  P   A+D       D  ++ F+  S + +  P
Sbjct  25   YTHG--LYPAQMEALRAMCGALIPSL--PPEEALDGRRDTPRDKDLERFYLASGADSTIP  80

Query  282  QRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRA  461
              VA +   R      +L+ + LWLL TR+GTL LCG+  +S +FPY++ F ++   +R 
Sbjct  81   DEVAELAFTRCVWEAGVLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFADMPVGRRE  140

Query  462  EIVRSWS  482
            E +R W+
Sbjct  141  EALRRWT  147



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  PAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRI  371
            P     QH+   + ++  F++ SAS    P  VA ++ +R Q   V L RL L LLS R+
Sbjct  44   PETITKQHS--HNQAIVSFYKASASQHPIPHEVAELMVKRGQPQAVFLARLILTLLSFRL  101

Query  372  GTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            GTL+LCG       +P++ +F EIS  KR +I+++WS
Sbjct  102  GTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKNWS  138



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 69/127 (54%), Gaps = 10/127 (8%)
 Frame = +3

Query  129  GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRV  290
            G   ++ A M ++ S  +  LP V  P+  +  DD      +++ FF TS S     +  
Sbjct  12   GHLGITTAEMESLGSFCEAVLPPVSPPEEYSAGDDHCRNKEALRSFFSTSGSRTPVVRES  71

Query  291  AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  470
              +I++R      ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++
Sbjct  72   IELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVL  131

Query  471  ----RSW  479
                R+W
Sbjct  132  QKQFRNW  138



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  192  PAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRI  371
            P     QH+   + ++  F++ SAS    P  VA ++ +R Q   V L RL L LLS R+
Sbjct  44   PETITKQHS--HNQAIVSFYKASASQHPIPHEVAELMVKRGQPQAVFLARLILTLLSFRL  101

Query  372  GTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            GTL+LCG       +P++ +F EIS  KR +I++ WS
Sbjct  102  GTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKKWS  138



>ref|XP_010038987.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
Length=441

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 70/133 (53%), Gaps = 16/133 (12%)
 Frame = +3

Query  132  GCPLSPAVMATVTSISDTFLPAVDVPQ---HAAVDDDSVKLFFQTSASIAGTP-------  281
            G   SPA +  + +I +T +P+V +         DD ++  F+  S S    P       
Sbjct  19   GHGFSPAQIQALAAICETLIPSVSLDSINPKIPHDDPALHSFYSASGSQPSVPDEVFVSD  78

Query  282  ------QRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEI  443
                  ++VA ++++R Q   V+++ + L +LS R+GTLMLC  + L+S +P++ +F E+
Sbjct  79   SFHDNGEQVAEILTKRAQRQVVVMVSIVLKMLSFRLGTLMLCWGSCLASTWPFILNFSEM  138

Query  444  SPHKRAEIVRSWS  482
               +R  ++ +WS
Sbjct  139  PVERRERVLMNWS  151



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 8/141 (6%)
 Frame = +3

Query  66   DDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL  245
            +D   L   G   RG +  YS G   S   M  + SI DT  P++ + +  +  D+++  
Sbjct  2    EDSHPLLRGG---RGKEKGYSHGFLTSQ--MHVLASICDTLFPSIPLNKEVS-QDENLSS  55

Query  246  FFQTSASIAGTPQRVAWMISE-RLQHPKVI-llrlalwllSTRIGTLMLCGKASLSSQFP  419
            F+ TS S    P   A ++   +   P+ I L+R  LW+LS ++GTL LCG   L  ++P
Sbjct  56   FYSTSGSQFPFPDEAAELVLLFKKSAPEAIPLVRWILWILSFKLGTLFLCGTLCLHWKWP  115

Query  420  YLQSFPEISPHKRAEIVRSWS  482
            ++  F EIS  KR EI++ WS
Sbjct  116  FVLKFSEISLEKREEILKKWS  136



>gb|KJB38384.1| hypothetical protein B456_006G252500 [Gossypium raimondii]
Length=748

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-------D  230
            G      GK E      Y  G   S A + T+ +I++   P++  P     +        
Sbjct  6    GKGFMKGGKIEEIEGKKYDHG--FSSAEVNTLAAIAEALFPSLP-PSSCCFERRENQTIS  62

Query  231  DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  410
             +V+ F +TSAS + TP   A M+ +RL    V+++R+ L LLST++GTL+LCG      
Sbjct  63   KAVRSFMETSASQSPTPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGK  122

Query  411  QFPYLQSFPEISPHKRAEIVRSW  479
            ++PY+  F  +   KR +++++W
Sbjct  123  EWPYINGFTSMPLAKREQVLQAW  145



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 65/120 (54%), Gaps = 9/120 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSA--SIAGT----PQRVAWMI  302
             S A M ++ +I +  +P + + +   + DD   L + +S+  + +G+    P  VA MI
Sbjct  25   FSSAQMQSLAAICEALIPPLSLEE---IPDDHQALHYSSSSYHTASGSQPPIPDEVAEMI  81

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
             +R Q   V  +RL L +LS R+GT +LCGK     ++P++  F E S  KR +++  WS
Sbjct  82   VKRAQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEXSLDKREQVLNKWS  141



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 75/137 (55%), Gaps = 12/137 (9%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDS----VKLF  248
            +  RG D  Y  G   S A M ++TSI +  LP     A+ + +    DDDS    ++ F
Sbjct  10   RGGRG-DNKYKHG--FSAAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSF  66

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
               SAS    P  VA MI++R     VIL+R+ LWLL+TR+GTL+LCG   L   +PY+ 
Sbjct  67   LDISASRYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYIN  126

Query  429  SFPEISPHKRAEIVRSW  479
             F  IS  KR +I++ W
Sbjct  127  KFSNISLEKREKIMQKW  143



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 75/137 (55%), Gaps = 12/137 (9%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDDDS----VKLF  248
            +  RG D  Y  G   S A M ++TSI +  LP     A+ + +    DDDS    ++ F
Sbjct  10   RGGRG-DNKYKHG--FSTAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSF  66

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
               SAS    P  VA MI++R     VIL+R+ LWLL+TR+GTL+LCG   L   +PY+ 
Sbjct  67   LDISASRYPIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYIN  126

Query  429  SFPEISPHKRAEIVRSW  479
             F  IS  KR +I++ W
Sbjct  127  KFSNISLEKREKIMQKW  143



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 73/129 (57%), Gaps = 11/129 (9%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAV---------DDDSVKLFFQTSASIAG  275
            YS G   SP+ +  ++++ + FLP++  P  A           ++ +++ +++ S S + 
Sbjct  24   YSHG--FSPSQIQALSAVCEAFLPSLSPPSDAISHSQGDPQLHNEAALEYYYKASGSQSP  81

Query  276  TPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHK  455
             P  VA ++ +R     + +++L L LLSTR+GTL++CG   L+ ++P++  F E+   K
Sbjct  82   FPDEVAEILVKRGLPEGLSVVKLVLKLLSTRLGTLLVCGLICLNWKWPFVHRFSELPVKK  141

Query  456  RAEIVRSWS  482
            R  I++ WS
Sbjct  142  RETILQKWS  150



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 66/123 (54%), Gaps = 9/123 (7%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP---------QHAAVDDDSVKLFFQTSASIAGTPQRVA  293
             SPA + ++ +I +  +P + +          +  + DD ++   ++ S S    P  VA
Sbjct  25   FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPDDQALHSIYRASGSQPPIPDEVA  84

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             ++ +R     +  ++L L +LS R+GTL+LC    LS ++P++ SF E+S  KR E+++
Sbjct  85   ELMVKRALPEVLEGMKLFLKMLSFRLGTLLLCRHRCLSWKWPFIHSFSEMSLEKREEVLK  144

Query  474  SWS  482
             WS
Sbjct  145  KWS  147



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 69/127 (54%), Gaps = 10/127 (8%)
 Frame = +3

Query  129  GGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRV  290
            G   ++ A M ++ S  +  LP V  P+  +  DD      +++ FF TS S     +  
Sbjct  11   GHLGITTAEMESLASFCEAVLPPVSPPEEYSGGDDHYRNKETLRSFFFTSGSRTPVVRES  70

Query  291  AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  470
              +I++R      ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++
Sbjct  71   IELITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVL  130

Query  471  ----RSW  479
                R+W
Sbjct  131  QKQFRNW  137



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            YS G   S + + T+TSI +T LP + +      ++  ++ F + S S    P  VA ++
Sbjct  18   YSHG--FSSSEIETLTSICETILPPLPL-NSLQENNKKIQNFHKVSGSQYPIPDEVAEIV  74

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
             +R      +L+R  L +LSTRIG+L+LCG       +PY+  F +IS  KR  +++ W
Sbjct  75   MKRAFFEARMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKW  133



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 64/121 (53%), Gaps = 9/121 (7%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVD-------DDSVKLFFQTSASIAGTPQRVAWM  299
            L PA M  + ++ D  +P++  P   A+D       D  ++ F+  S + +  P  VA +
Sbjct  29   LYPAQMEALRAMCDALIPSL--PPEEALDGRRDTPRDKDLERFYLASGADSTIPDEVAEL  86

Query  300  ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               R      +L+ + LWLL TR+GTL LCG+  +S +FPY++ F ++   +R E +  W
Sbjct  87   AFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFADMPVGRREEALGRW  146

Query  480  S  482
            +
Sbjct  147  T  147



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAA---VDDDSVKL-FFQTSASIAGTPQRVAWMISE  308
             S A + T+++  +T +P + V   +     D     L F++ S S    P  VA ++  
Sbjct  25   FSSAQIQTLSAFCETLIPPLPVNNFSNELPFDKQKALLSFYKASGSEQPIPDEVAELMVN  84

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            R     V+++   L +LS R+GTL+LCG   L   +P++  F EIS  KR +IV+ W+
Sbjct  85   RGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIHKFSEISLSKREDIVKRWA  142



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 64/119 (54%), Gaps = 3/119 (3%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            YS G   S + + T+TSI +T LP + +      ++  ++ F + S S    P  VA ++
Sbjct  18   YSHG--FSSSEIQTLTSICETILPPIPL-NSLQKNNKKIQNFHKVSGSQYPIPDEVAEIV  74

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
             +R      +L+R  L +LSTRIG+L+LCG       +PY+  F +IS  KR  +++ W
Sbjct  75   MKRGFFEARMLVRSLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKW  133



>ref|XP_006386919.1| hypothetical protein POPTR_0002s26130g [Populus trichocarpa]
 gb|ERP64716.1| hypothetical protein POPTR_0002s26130g [Populus trichocarpa]
Length=518

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 69/131 (53%), Gaps = 10/131 (8%)
 Frame = +3

Query  108  GNDGVYSG--GCPLSPAVMATVTSISDTFLPAVDVP---QHAAVD-DDSVKLFFQTSASI  269
            GN  V S   G   S   M ++ +  +T +P + VP   +   VD  ++++ F++ S   
Sbjct  14   GNRKVLSNAYGHGFSSGQMQSLDAFCETLIPPLPVPSFSEEIPVDKQEAIRSFYKAS---  70

Query  270  AGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISP  449
             G+   VA ++ +      V+ +RL L  LS R+GTL+LCG   L  ++P +  F EIS 
Sbjct  71   -GSQSPVAELMVKSGVPEAVLFVRLVLKFLSCRLGTLLLCGFICLDWKWPLIHKFSEISA  129

Query  450  HKRAEIVRSWS  482
             +R EI+R WS
Sbjct  130  ERREEILRKWS  140



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +3

Query  99   AERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTS  260
              R   G +S G   SP+ + ++ ++ + F+P++ + + H +   +     S++ F+  S
Sbjct  18   GRRTEKGGHSHG--FSPSQIQSLAAMCEAFIPSLPMEELHVSSGKEDPPTKSLQAFYLAS  75

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
             S +  P  VA ++ +R     ++L++L LWLL+T++GTL+LC   SL  +FP++  F +
Sbjct  76   GSESPIPDEVAELLVKRGMKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSD  135

Query  441  ISPHKRAEIVRSWS  482
            +   KR E+++ W+
Sbjct  136  MPIEKREEVLKRWN  149



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 67/120 (56%), Gaps = 9/120 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV-------DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWM  299
            LS A M ++ S+ +T LP++       D  QH  +   +V+  ++ SAS    P  +A +
Sbjct  23   LSSAEMDSLASLCETILPSLPPPVTTFDGKQH--LPTKAVQALYRASASQTPVPDEIAEL  80

Query  300  ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
            + +R     V L+RL LWLLSTR+GT +LCG      ++  +Q+F  IS  KR ++++ W
Sbjct  81   LRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIQNFSSISLDKREKVLQKW  140



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 63/115 (55%), Gaps = 5/115 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERL  314
             S A M ++TSI DT LP +  + P  +   +   + F+  S + +  P  VA M  +R 
Sbjct  22   FSTAEMESLTSICDTVLPPLPFNSPTTSTAAE---RAFYAVSGAQSPIPDEVAEMARKRG  78

Query  315  QHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
                V+L+R+ LW+L+TR+GTL+LCG      ++P++  F E+    R E +R W
Sbjct  79   LVEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVWKFSEMPLKNREEALRRW  133



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 10/123 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP----------QHAAVDDDSVKLFFQTSASIAGTPQRV  290
             S A M ++TSI +  LP++ V                    V+ F   SAS    P  V
Sbjct  22   FSVAEMESLTSICEVVLPSLPVDAMNQRKDDQHDDDDESRKHVQSFLNLSASQYPIPHEV  81

Query  291  AWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV  470
            A  + +R     V+L+R+ LWLL+TR+GTL+LCG   LS ++P++  F  +S  KR +IV
Sbjct  82   AEALVKRGLIEAVMLIRVVLWLLATRLGTLLLCGFLCLSKEWPFVNKFSSMSLDKREKIV  141

Query  471  RSW  479
            + W
Sbjct  142  QRW  144



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 6/121 (5%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--VKLFFQTSASIAGTPQRVAW  296
            YS G   S + M T+TSI +T LP +  PQ+   +++S  ++   + S S    P   A 
Sbjct  18   YSHG--FSSSEMETLTSICETILPPL--PQNEIPENNSQNIQYLHRASGSQYPIPDECAE  73

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            ++ +R     +ILLR  L +LSTR GTL+LCG      ++PY+  F +I   KR  +++ 
Sbjct  74   VVMKRGFSEAIILLRGLLRILSTRFGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQK  133

Query  477  W  479
            W
Sbjct  134  W  134



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 11/123 (9%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDV------PQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            L P  M  + ++    +P++ V      PQ     DD +  FF+ SA+    P  VA M+
Sbjct  23   LRPPQMEALRAMCGALIPSLPVEGLHVQPQPGRGKDD-LDRFFRASAADGAIPDEVAEMV  81

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLS---SQFPYLQSFPEISPHKRAEIVR  473
            + R     V+L+R+ LW+LSTRIGTL LCG+   S   S FPY   F ++   +R  +++
Sbjct  82   T-RCVWEGVLLMRIVLWVLSTRIGTLALCGRLCFSAGKSSFPYACRFADMPVERRERVLQ  140

Query  474  SWS  482
             WS
Sbjct  141  RWS  143



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 8/144 (6%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAG  275
            ++++  +G YS G  +S   + T++ I  T LP    P     + ++V  F   S S   
Sbjct  14   RSKKRQEGGYSHGFSISQ--IQTLSVICQTLLPP---PPETTAEQNAVDSFKVASGSQPP  68

Query  276  TPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHK  455
                VA MI +  +   V + ++   +L+ R GTL LCG   L+  +P++  F E+   K
Sbjct  69   FTDEVAEMIVKNGRSEAVKVFKIISTVLAYRFGTLFLCGSLCLAKDWPFVLKFSELPLDK  128

Query  456  RAEIVRSW---SCCYIKILKTFYL  518
            R EI+R W   S  ++ +  TF+L
Sbjct  129  REEILRMWSRQSGFFLPLRITFFL  152



>gb|EMS48507.1| Long-chain-alcohol oxidase FAO1 [Triticum urartu]
Length=579

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 64/121 (53%), Gaps = 9/121 (7%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVD-------DDSVKLFFQTSASIAGTPQRVAWM  299
            L PA M  + ++    +P++  P   A+D       D  ++ F+  S + +  P  VA +
Sbjct  29   LYPAQMEALRAMCGALIPSL--PPEEALDGRRDTPRDKDLERFYLASGADSTIPDEVAEL  86

Query  300  ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               R      +L+ + LWLL TR+GTL LCG+  +S +FPY++ F ++   +R E +R W
Sbjct  87   AFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFADMPVGRREEALRRW  146

Query  480  S  482
            +
Sbjct  147  T  147



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 74/126 (59%), Gaps = 8/126 (6%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTSASIAGTPQ  284
            YS G   SP+ + ++ ++ +  +P++ + + H +   +     S++ F+  S S +  P 
Sbjct  26   YSHG--FSPSQIQSLAAMCEALIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSESPVPD  83

Query  285  RVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAE  464
             VA ++ +R     V+L++L LWLL+T++GTL+LCG  SL   FP++  F ++   KR E
Sbjct  84   EVAELLVKRGLREAVLLVKLVLWLLATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREE  143

Query  465  IVRSWS  482
            +++ W+
Sbjct  144  VLKRWN  149



>gb|KDO72346.1| hypothetical protein CISIN_1g0039901mg, partial [Citrus sinensis]
Length=74

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQR  287
            LS   M +++++ DTFLPAVDV   A++D D +  FF+ SAS AGTP+R
Sbjct  27   LSSQEMESLSALCDTFLPAVDVKTAASIDKD-IADFFRASASAAGTPER  74



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 68/123 (55%), Gaps = 10/123 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDS------VKLFFQTSASIAGTPQRVAWMI  302
            ++ A M ++ S  +  LP V  P+  + + D+      ++ F+ TS S     ++   +I
Sbjct  15   ITEAEMESLASFCEAVLPPVLPPEEVSSEGDNHRNKEALRSFYSTSGSQTPVLRQSIELI  74

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  470
            ++R      +  RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++    
Sbjct  75   TKRGTIEAYLATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQF  134

Query  471  RSW  479
            R+W
Sbjct  135  RNW  137



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 72/143 (50%), Gaps = 10/143 (7%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD-------D  230
            G      GK E      Y  G   S A + T+ +I++   P++  P     +        
Sbjct  6    GKGFMKGGKIEEIEGKKYDHG--FSSAEVNTLAAIAEALFPSLP-PSSCCFERRENQTIS  62

Query  231  DSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSS  410
             +V+ F +TSAS +  P   A M+ +RL    V+++R+ L LLST++GTL+LCG      
Sbjct  63   KAVRSFMETSASQSPFPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGK  122

Query  411  QFPYLQSFPEISPHKRAEIVRSW  479
            ++PY+  F  +   KR +++++W
Sbjct  123  EWPYINGFTSMPLAKREQVLQAW  145



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 83/159 (52%), Gaps = 23/159 (14%)
 Frame = +3

Query  96   KAERGNDGVYSGGCPLSPAVMATVTSISDTFLP-----AVDVPQHAAVDD----DSVKLF  248
            +  RG D  Y  G   S A M ++ SI +  LP     A+ + +   +DD     S+K F
Sbjct  11   RGGRG-DSKYKHG--FSAAEMESLASICEVVLPPLPMDALKIRKEDQIDDYDSSKSLKSF  67

Query  249  FQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQ  428
            +  SAS    P  VA M+++R     VIL+R+ LWLL+TR+GTL+LCG   L  ++PY+ 
Sbjct  68   WDISASRYPIPHEVAEMLTKRSLIEAVILIRVVLWLLATRLGTLLLCGFLCLGEKWPYVN  127

Query  429  SFPEISPHKRAEIVRSW-----------SCCYIKILKTF  512
            +F  IS  KR  +++ W           +  YIK+L  F
Sbjct  128  NFSNISLEKREMVMQKWLKHRFLTPIRLAFAYIKVLCLF  166



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 63/119 (53%), Gaps = 5/119 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV---DVPQ-HAAVDDDSVKLFFQT-SASIAGTPQRVAWMIS  305
             S A M ++ +I ++ +P +   ++P  H A+   S    + T S S    P  VA MI 
Sbjct  25   FSSAQMQSLAAICESLIPPLPLEEIPDDHQALHSSSSSSSYHTASGSQPPIPDEVAEMIV  84

Query  306  ERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            +R     V  +RL L +LS R+GT +LCGK     ++P++  F E+S  KR +++  WS
Sbjct  85   KRALPEGVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEMSLDKREQVLNKWS  143



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 74/134 (55%), Gaps = 8/134 (6%)
 Frame = +3

Query  99   AERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVDDD-----SVKLFFQTS  260
              R   G YS G   SP+ + ++ ++ + F+P++ + + H     +     S++ F++ S
Sbjct  17   GRRREKGDYSHG--FSPSQIQSLAAMCEAFVPSLPMEEFHVTSGKEDPPTKSLQAFYRAS  74

Query  261  ASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPE  440
             S    P  VA ++ +R     ++L++L LWLL+T++GTL+LC   SL  +FP++  F +
Sbjct  75   GSEFPMPDEVAELMVKRGLKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSD  134

Query  441  ISPHKRAEIVRSWS  482
            +   KR E  + W+
Sbjct  135  MPIEKREEAFKRWN  148



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 4/120 (3%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            YS G   S A + ++ S+ +  +P + +P    +   S++ F++ S S +  P   A M+
Sbjct  21   YSHG--YSSAQIQSLASMCEALIPPL-IPNKNPLHK-SLQTFYEASGSQSPIPDETAEMV  76

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
             ++   P   L+   L +LS R+GTL+LCG      ++P+L  F E+S  KR  +++ WS
Sbjct  77   VKKALPPAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLHKFSEMSLEKREAVLKKWS  136



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 73/140 (52%), Gaps = 8/140 (6%)
 Frame = +3

Query  69   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV--DVPQHAAVDDDSVK  242
            DG  L S    E G    +S G   S   + ++ ++ +T LP +  D     +  +++V 
Sbjct  4    DGHPLLSRVGREAG----FSHG--FSADQIQSLAAMCETLLPPLSPDSIDEDSPRNEAVY  57

Query  243  LFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPY  422
             FF+ S S    P  +A  +++R Q   ++++ L L +LS R+GTL+LCG   L  ++P+
Sbjct  58   SFFRASGSQHPIPDEIAERLAKRGQRSALLVVSLVLKILSYRLGTLLLCGFLCLDWRWPF  117

Query  423  LQSFPEISPHKRAEIVRSWS  482
            ++ F E+   +R  ++  WS
Sbjct  118  IRKFHEMPLERREIVLNRWS  137



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 10/118 (8%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMISERLQ  317
            M ++ S  +  LP V  P+     DD      +++ FF TS S     +    +I++R  
Sbjct  1    MESLASFCEAVLPPVSPPEEYCGGDDHYRNKETLRSFFFTSGSRTPVVRESIELITKRGT  60

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----RSW  479
                ++ RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  ++    R+W
Sbjct  61   VETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNW  118



>tpg|DAA49650.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=98

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  360  STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            STR GTL+LCG+ SL + FPY++ F +++P +R   +R W+
Sbjct  16   STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWN  56



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = +3

Query  150  AVMATVTSISDTFLPAVDVPQHAAVDD----DSVKLFFQTSASIAGTPQRVAWMISERLQ  317
            A + T+ S+++ F P++         D     +V+ F + SAS    P  VA ++ +R  
Sbjct  27   AEIQTLASVAEVFFPSLPPDSWFQGKDTQPSKAVQSFLKASASQPPFPDEVAELLGKRAF  86

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               VI++R+ L LL TR+G+L+LCG+  L  ++P +  F  +   KR +++++W
Sbjct  87   IESVIVVRIVLMLLWTRVGSLLLCGRQCLGKEWPIINDFGSMGLEKREKVMQNW  140



>ref|XP_004982885.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=729

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 72/151 (48%), Gaps = 14/151 (9%)
 Frame = +3

Query  30   SVQIMNKKKMISDDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP  209
            S Q   K    +  G  L    K ER   G       L P  M  + ++    +P++ V 
Sbjct  2    STQQQEKASAAAGRGSPLLRRCKRERYTHG-------LRPPQMEALRAMCGALIPSLPVE  54

Query  210  ------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRI  371
                  +H   + D V+ F++ SA+    P  VA M +       ++L+R+ LW+LST++
Sbjct  55   GPFHGDKHGGGNKDDVERFYRASAADGAIPDEVAEMATG-CAREAMLLVRVILWMLSTKV  113

Query  372  GTLMLCGKASLSSQFPYLQSFPEISPHKRAE  464
            GT +LCG   +SS+FPY+  F ++   +R E
Sbjct  114  GTFVLCGWLCVSSRFPYVFKFADMPLERREE  144



>ref|XP_010501308.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO1-like 
[Camelina sativa]
Length=744

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 69/121 (57%), Gaps = 7/121 (6%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAV-----DVPQHAAV-DDDSVKLFFQTSASIAGTPQRVAWMI  302
             SP+ +  +++I +  LP V     D+     V  +D++  FF++S+     P  VA ++
Sbjct  23   FSPSDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSSGPHVRPDEVAELL  82

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLS-SQFPYLQSFPEISPHKRAEIVRSW  479
            + +     VI++R+ L +L+ R+GTL+LCG   L  + +P+L  F EIS  KR ++++ W
Sbjct  83   ATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDKANWPFLLKFSEISLEKREKVLQRW  142

Query  480  S  482
            +
Sbjct  143  N  143



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 79/150 (53%), Gaps = 15/150 (10%)
 Frame = +3

Query  57   MISDDGDSLFS-NGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV-----DVPQHA  218
            M+   G+ L   N K E  + G        SP+ +  +++I +  LP V     D+    
Sbjct  1    MVGRRGNPLLRWNTKHENVSHG-------FSPSDLQALSAICEAILPPVPLQSLDLEMKL  53

Query  219  AV-DDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGK  395
             V  +D++  FF++S+     P  VA +++ +     VI++R+ L +L+ R+GTL+LCG 
Sbjct  54   KVLRNDALLSFFKSSSGPHVRPDEVAELLATKAIPVTVIVVRIVLRILTFRLGTLLLCGL  113

Query  396  ASLS-SQFPYLQSFPEISPHKRAEIVRSWS  482
              L  + +P+L  F EIS  KR ++++ W+
Sbjct  114  VCLDQANWPFLLKFSEISLEKREKVLQRWN  143



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMI  302
            ++ A M ++ S  +  LP V  P+    +DD      +++ F+ T  S     ++   +I
Sbjct  15   ITAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVARQTIDLI  74

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  470
             +R      +  RL L+LL+TR+GTL++CG   L S +P+++ F E+S  KR  ++    
Sbjct  75   IKRGTMEAYLAARLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELSLEKRERVLQKQF  134

Query  471  RSW  479
            R+W
Sbjct  135  RNW  137



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 67/120 (56%), Gaps = 11/120 (9%)
 Frame = +3

Query  123  YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMI  302
            YS G   S + + T+ S  +T +P    P +   D      FF +S S    P  VA ++
Sbjct  15   YSHG--FSSSQIQTIASFCETLIP----PPYDHQDS-----FFSSSGSQPPFPNEVAELL  63

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
             +R +   + ++R+ +++LSTR+G+L+LCG+  L  + P++ +F E+S  +R  +++ WS
Sbjct  64   VKRSKPEAMFIIRIVVFMLSTRLGSLVLCGRVCLDKRRPFVHNFSELSLKQREPLLQRWS  123



>gb|EAY78906.1| hypothetical protein OsI_34009 [Oryza sativa Indica Group]
Length=201

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 62/117 (53%), Gaps = 3/117 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAV---DDDSVKLFFQTSASIAGTPQRVAWMISER  311
            L  A M  + ++    +PA+   +        D  V+ F+  +A+ +  P  VA +   R
Sbjct  31   LGAAQMRALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELTMTR  90

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
                  +L+R+ LW+L+TR+GTL LCG+  +S +FPY++ F ++   +R   ++ W+
Sbjct  91   CIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMPVERREAALKRWN  147



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 14/140 (10%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV-------DVPQHAAVDDDSV  239
            L S G   R  +  Y+ G  LS A M ++ S+ +T LP++       D  QH      +V
Sbjct  8    LLSGG---RTRESKYNHG--LSSAEMDSLASLCETILPSLPPPVTTLDGKQHQPTK--AV  60

Query  240  KLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFP  419
            +  ++ S S    P  +A ++ +R     V L+RL LWLLSTR+GT +LCG      ++ 
Sbjct  61   QALYRASGSQTPMPDEIAELLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWL  120

Query  420  YLQSFPEISPHKRAEIVRSW  479
             +++F  IS  KR ++++ W
Sbjct  121  CIKNFSSISLDKREKVLQKW  140



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=743

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +3

Query  117  GVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAW  296
            G +S G   S A + ++ ++ +  +P + +       D ++  F++ S S    P  VA 
Sbjct  18   GKFSHG--FSAAQIQSLAAMCEALIPPLSLDD---TSDQALHSFYKASGSEPPIPDEVAD  72

Query  297  MISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRS  476
            +I +R     V +L   L +LS R+G L++CG   L   +P++ +F E+S  KR E ++ 
Sbjct  73   LIRKRGAPEAVGVLSFFLKVLSYRLGNLLVCGYPCLDKNWPFIHNFAEMSLEKREEALQR  132

Query  477  WS  482
            WS
Sbjct  133  WS  134



>gb|KJB10008.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=749

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A + ++ +I +  +P +  P  +A    S+  F++ S +    P  VA M+ +R+  
Sbjct  28   FSSAQIQSLAAICEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMVKRVVE  85

Query  321  PKVIl-lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            P+V+  +++ L ++S R+G L+LCG      ++P++  F E+   +R +I+  WS
Sbjct  86   PRVLSFVKVVLTVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140



>gb|KJB10006.1| hypothetical protein B456_001G179800 [Gossypium raimondii]
Length=742

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A + ++ +I +  +P +  P  +A    S+  F++ S +    P  VA M+ +R+  
Sbjct  28   FSSAQIQSLAAICEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMVKRVVE  85

Query  321  PKVIl-lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            P+V+  +++ L ++S R+G L+LCG      ++P++  F E+   +R +I+  WS
Sbjct  86   PRVLSFVKVVLTVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 76/134 (57%), Gaps = 3/134 (2%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAV-DVPQHAAVDDDSVKLFFQT  257
            L + G+   G+D  YS G   S A M ++ SI +  LP + ++       + +V+ F++T
Sbjct  8    LLNGGRGYTGDDRKYSHG--FSSAEMQSLASICEALLPPLYEIKGEQPTINKAVQSFYKT  65

Query  258  SASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFP  437
            SA+    P  VA ++ +R     V+L+R+ LW+L T++GTL+LCG       +P++ +F 
Sbjct  66   SAAQTPIPDEVAQLMVKRALIEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPFVHNFS  125

Query  438  EISPHKRAEIVRSW  479
             +S  KR ++++ W
Sbjct  126  SLSLEKREKVLQKW  139



>ref|XP_003575383.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=766

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 66/130 (51%), Gaps = 9/130 (7%)
 Frame = +3

Query  105  RGNDGV----YSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIA  272
            RG  GV    Y+ G   S   M  +T+     +P++  P  A     +V+ FF  SA+  
Sbjct  17   RGGGGVSRSSYTHG--FSATQMLALTAACGALVPSLP-PDDAG--SKAVREFFLASAADP  71

Query  273  GTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPH  452
              P  VA ++S       + L+R  LWLL TR+GTL LCG   LS Q P+++ F E+   
Sbjct  72   PVPDEVAQLMSAMCLREALALIRTLLWLLGTRLGTLALCGSRCLSWQAPFVRRFAEMPVE  131

Query  453  KRAEIVRSWS  482
            +R + +R WS
Sbjct  132  RREDALRRWS  141



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 65/137 (47%), Gaps = 10/137 (7%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFF  251
            G  L  + K E    G Y+ G   SP+ + ++ +I  T LP  D          S   F 
Sbjct  14   GHPLLRSKKREEEQVGYYNHG--FSPSQIHSLAAICQTLLPPSD--------QQSFDSFN  63

Query  252  QTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQS  431
              S++       VA MI +  +   V +LR+ L +LS R GTL+LCG   L   +P++  
Sbjct  64   VASSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLK  123

Query  432  FPEISPHKRAEIVRSWS  482
            F E+   +R EI+R WS
Sbjct  124  FSELPLDRREEILRKWS  140



>ref|XP_011459707.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Fragaria vesca 
subsp. vesca]
Length=546

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 60/114 (53%), Gaps = 3/114 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A + ++ ++ +  +P + +       D ++  F++ S S    P  VA +I +R   
Sbjct  24   FSAAQIQSLAAMCEALIPPLSLDD---TSDQALHSFYKASGSEPPIPDEVADLIKKRGVP  80

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V LL   L +LS R+GTL++CG   L  + P++ +F E+S  KR E ++ WS
Sbjct  81   EAVGLLSFFLKVLSYRLGTLLVCGYPCLDRKGPFIHNFAEMSLEKREEALQRWS  134



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  360  STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            STR GTL+LCG+ SL + FPY++ F +++P +R   +R W+
Sbjct  21   STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWN  61



>emb|CDX77517.1| BnaA07g06550D [Brassica napus]
Length=540

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 67/132 (51%), Gaps = 10/132 (8%)
 Frame = +3

Query  114  DGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAG  275
            D    G   ++ A M ++ S  +  LP V  P+    +DD      +++ F+ T  S   
Sbjct  6    DARNFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTP  65

Query  276  TPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHK  455
              ++   +I +R      +  RL L+LL+TR+GTL++CG   L S +P+++ F E++  K
Sbjct  66   VARQTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEK  125

Query  456  RAEIV----RSW  479
            R  ++    R+W
Sbjct  126  RERVLQKQFRNW  137



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +3

Query  69   DGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLF  248
            DG S+  +  A   ND  YS    LS A M ++ ++ DTFLP+V  P  AA  D S  +F
Sbjct  50   DGASVEISQHANSNND-YYSSAGHLSAAEMESLAALCDTFLPSV-APATAA--DRSTAVF  105

Query  249  FQTSASIAGTPQRV  290
            F+TSAS  GTP+RV
Sbjct  106  FETSASAVGTPERV  119



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (53%), Gaps = 18/142 (13%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQH---AAVDD----DSVKLFFQTSASIAGTPQRVAWM  299
            ++ A M T+ S  +   P V  PQ     A D+    ++++ F+ TSAS      +   +
Sbjct  15   ITAAEMETLASFCEAVFPPVAPPQEELSGAGDNNHRKEALRSFYSTSASQTPILCQSMEL  74

Query  300  ISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV---  470
            +++R      ++ RL L+LL++R+GTL++CG   L +++P+++ F E+S  KR  ++   
Sbjct  75   LTKRATMEACLVTRLILFLLASRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVIQKQ  134

Query  471  -RSW-------SCCYIKILKTF  512
             R+W          YIK++  F
Sbjct  135  FRNWILTPIRAGFVYIKVIFLF  156



>gb|KJB72414.1| hypothetical protein B456_011G177100 [Gossypium raimondii]
Length=746

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = +3

Query  150  AVMATVTSISDTFLPAV----DVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  317
            A + T+ S+++ F P++               +V+ F + SAS    P  VA ++ +R  
Sbjct  27   AEIQTLASVAEVFFPSLPPDSGFQGKETQPSKAVQSFLKASASQPAFPDEVAELLGKRAF  86

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               VI++R+ L LL TR+G+L+LCG+  L  ++P++  F  +   KR +++++W
Sbjct  87   IESVIVVRIVLVLLWTRVGSLLLCGRQCLGKEWPFINDFGSMGVEKREKVMQNW  140



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 65/123 (53%), Gaps = 10/123 (8%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDD------SVKLFFQTSASIAGTPQRVAWMI  302
            ++ A M ++ S  +  LP V  P+    +DD      +++ F+ T  S     ++   +I
Sbjct  15   VTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVARQTIDLI  74

Query  303  SERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIV----  470
             +R      +  RL L+LL+TR+GTL++CG   L S +P+++ F E++  KR  ++    
Sbjct  75   IKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRERVLQKQF  134

Query  471  RSW  479
            R+W
Sbjct  135  RNW  137



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 81/161 (50%), Gaps = 26/161 (16%)
 Frame = +3

Query  60   ISDDGDS---LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQ-HAAVD  227
            + DD ++   L   G+ E+     +S G   + A + ++T+I +  +P++ +   H +  
Sbjct  1    MEDDQNTAHPLLRGGRKEKS----FSHG--FTKAQIQSLTAICEALIPSMPITALHVSSQ  54

Query  228  DD-----SVKLFFQTSASIAGTPQR-----------VAWMISERLQHPKVIllrlalwll  359
             D     S+  F++ S S    P +           VA ++ +R     V L+   LW L
Sbjct  55   RDPPPSPSLVSFYKASGSDYQVPDQALFRSRNSETFVAELMVKRGLPDAVTLVSWVLWAL  114

Query  360  STRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            STR+GTL+LCG   LS  FP+++SF E+   KR +++ +WS
Sbjct  115  STRLGTLLLCGSTCLSLNFPFIRSFSEMPVEKREKVLMAWS  155



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (52%), Gaps = 6/118 (5%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDD----SVKLFFQTSASIAGTPQRVAWMISE  308
             S A + ++ +I +TF+P +  P  A  DD     ++  F + S +    P  VA  + +
Sbjct  24   FSSAQIQSLAAICETFVPPL--PLDAKFDDKQNSAALDAFHKASGAEPPFPDEVADFLMK  81

Query  309  RLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            R Q   V   +L L L+S R+GTL+LCG      ++P++  F EI   +R +I+  WS
Sbjct  82   RGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIHKFSEIPVERREKILIKWS  139



>ref|XP_004953134.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Setaria italica]
Length=773

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 45/152 (30%), Positives = 69/152 (45%), Gaps = 20/152 (13%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP--------------  209
            G  L   G A R     Y+ G   S + MA +T++    +P++  P              
Sbjct  8    GHPLLRGGGARRER---YTHG--FSSSQMAALTALCGALVPSLPPPVSRNGHHPEEDGGP  62

Query  210  -QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLML  386
                   +  V+ F   SA+    P  VA ++S R     + L+R  LWLL TR+G L L
Sbjct  63   GGGERGGNKVVEEFLLASAADPPVPDEVAELMSRRCLPEALALVRAVLWLLGTRLGALAL  122

Query  387  CGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            CG   LS +FP+++ F E+ P +R   ++ WS
Sbjct  123  CGARCLSWRFPFVRRFAELPPEEREGAMQRWS  154



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 72/139 (52%), Gaps = 12/139 (9%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVP------QHAAVDDDSVK  242
            L S G+      G YS G   S A M ++ S+ +  LPA+ +       +     + +V+
Sbjct  8    LLSGGR----RSGKYSHG--FSSAEMQSLASVCEALLPALPLNDFCFEGKEEQRTNKAVQ  61

Query  243  LFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPY  422
             F + S +    P  VA ++ +R     V+L+R+ LW+LSTR+GTL+LCG      ++P+
Sbjct  62   SFHKASGAQTPIPDEVAELLVKRAFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPF  121

Query  423  LQSFPEISPHKRAEIVRSW  479
            + +F  +   KR  +++ W
Sbjct  122  ILNFSSLPLAKRERLLQKW  140



>gb|EMT02982.1| Putative GMC-type oxidoreductase [Aegilops tauschii]
Length=598

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 8/132 (6%)
 Frame = +3

Query  105  RGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVD------DDSVKLFFQTSAS  266
            R  DG Y+ G  L PA M  + ++   F+P++   +  A           ++ F+  SA+
Sbjct  23   RRRDGKYTHG--LHPAQMEALRAMCGAFIPSLPAEESDAGGRADPPGGKDLERFYLASAA  80

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEIS  446
             +  P  VA ++  R      +L  + LW+LSTR+GTL+LCG+ SL      L+ F ++ 
Sbjct  81   DSNIPDEVAELMVTRCIREAALLAWVVLWVLSTRVGTLLLCGRLSLCGAAGELRRFADMP  140

Query  447  PHKRAEIVRSWS  482
              ++   ++ W+
Sbjct  141  AERQEAALQRWN  152



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 4/133 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVP-QHAAVDDD--SVKLFFQTSASIAGTPQRVAWMISER  311
             S   M  +T++    +P++     H A+ D+  +V+ F   SA+    P  VA ++S  
Sbjct  30   FSATQMMALTAVCGALVPSLPPDGHHLAMADNGKAVREFLLASAADPPVPDEVAQLMSAM  89

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWSC-C  488
                 + L+R  LWLL TR+GTL LCG   LS   P++  F E+   +R + +R WS   
Sbjct  90   CLREALALVRTVLWLLGTRLGTLALCGARCLSWSSPFVHRFAEMPVDRREDALRRWSRET  149

Query  489  YIKILKTFYLGMK  527
             I  L+ F+L +K
Sbjct  150  MIPPLRLFFLLVK  162



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27   FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS
Sbjct  82   EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWS  135



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27   FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS
Sbjct  82   EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWS  135



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             SP+ + ++  I  TFLP     +  AV+      F   S++       VA MI +  + 
Sbjct  27   FSPSQIQSLAVICQTFLPPETTSEQQAVNS-----FHVASSTQPPFTDEVAEMIVKNGRS  81

Query  321  PKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              V +LR+ L +LS R GTL+LCG   L   +P++  F ++   KR  I+R+WS
Sbjct  82   EAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDKREAILRNWS  135



>gb|KHG08529.1| Long-chain-alcohol oxidase FAO2 [Gossypium arboreum]
Length=684

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 62/115 (54%), Gaps = 3/115 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQH  320
             S A + ++ +  +  +P +  P  +A    S+  F++ S +    P  VA M+ +R+  
Sbjct  28   FSSAQIRSLAATCEALIPPL--PLDSAHQASSLDAFYKASGAEPPLPDEVAEMMVKRVVE  85

Query  321  PKVIl-lrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
            P+V+  +++ L ++S R+G L+LCG      ++P++  F E+   +R +I+  WS
Sbjct  86   PRVLSFVKVVLAVISFRLGALLLCGWDCCDWKWPFIHKFSELPVERREKILMKWS  140



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 67/122 (55%), Gaps = 8/122 (7%)
 Frame = +3

Query  132  GCP-LSPAVMATVTSISDTFLPAVDVPQHAAV-------DDDSVKLFFQTSASIAGTPQR  287
            G P ++ A M ++ S  +  LP+V  P            + ++++ F+ TS S     ++
Sbjct  11   GLPDITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYSTSGSKTPVLRQ  70

Query  288  VAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEI  467
               ++++R      I  RL L+LL+TR+GTL++CG   L S++P+++ F E+S  KR  +
Sbjct  71   SIELVTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERV  130

Query  468  VR  473
            ++
Sbjct  131  LQ  132



>gb|ACN27562.1| unknown [Zea mays]
 gb|AFW63032.1| oxidoreductase [Zea mays]
Length=768

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 18/165 (11%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD------------VPQH  215
            G  L   G A+R     Y+ G   S + MA +T++    +P++              P+ 
Sbjct  9    GHPLLRGGSAKRER---YTHG--FSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEE  63

Query  216  AAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGK  395
                   V+ F   SA+    P  VA ++S +     + L+R  LWLL TR+G+L LCG 
Sbjct  64   DGGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGA  123

Query  396  ASLSSQFPYLQSFPEISPHKRAEIVRSWS-CCYIKILKTFYLGMK  527
              LS +FP+++ F E+    R   +R WS    +  L+ F+L  K
Sbjct  124  RCLSWRFPFVRRFDELPLEHREAALRRWSRLTLLPPLRMFFLITK  168



>ref|NP_001064840.2| Os10g0474900 [Oryza sativa Japonica Group]
 dbj|BAF26754.2| Os10g0474900 [Oryza sativa Japonica Group]
Length=164

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 3/109 (3%)
 Frame = +3

Query  141  LSPAVMATVTSISDTFLPAVDVPQHAAV---DDDSVKLFFQTSASIAGTPQRVAWMISER  311
            L  A M  + ++    +PA+   +        D  V+ F+  +A+ +  P  VA +   R
Sbjct  31   LGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELTMTR  90

Query  312  LQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKR  458
                  +L+R+ LW+L+TR+GTL LCG+  +S +FPY++ F ++   +R
Sbjct  91   CIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMPVERR  139



>gb|KHN11790.1| hypothetical protein glysoja_006243 [Glycine soja]
Length=103

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  81   LFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTS  260
            L SNG+ E+    + +    LSP  M ++T++ DT LP+V         D+SV  F+Q S
Sbjct  38   LLSNGEREKKLQPLTNS---LSPRQMKSLTALCDTILPSV-ANHFVDSSDESVTKFYQIS  93

Query  261  ASIAGTPQRV  290
            AS+ GTP+RV
Sbjct  94   ASMTGTPERV  103



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 68/139 (49%), Gaps = 11/139 (8%)
 Frame = +3

Query  66   DDGDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKL  245
            + G  L  + K E G    Y+ G   SP+ + ++  I  T LP     +  A++      
Sbjct  8    NRGHPLLRSMKREDG----YNHG--FSPSQIQSLAVICQTLLPPETTAEQQALNS-----  56

Query  246  FFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYL  425
            F   S++     + VA MI +  +   V +L++ L +LS R GTL+LCG   L   +P++
Sbjct  57   FNVASSTQPPFTEEVAEMIVKNGRSEAVKVLKIILIILSFRFGTLLLCGSLCLDKSWPFV  116

Query  426  QSFPEISPHKRAEIVRSWS  482
              F ++   KR EI+R WS
Sbjct  117  LKFSQLPLDKREEILRKWS  135



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  156  MATVTSISDTFLPAVDVP------QHAAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQ  317
            M ++ S+ +  LPA+ +       +     D +V+ F Q S +    P  VA ++ +R  
Sbjct  1    MQSLASVCEALLPALPLNDFCFEGKEEQPTDKAVQSFHQASGAQTPIPDEVAELLVKRAF  60

Query  318  HPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVRSW  479
               V+L+R+ LW+LSTR+GTL+LCG      ++P++ +F  +   KR  +++ W
Sbjct  61   IEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKW  114



>ref|NP_001148058.1| oxidoreductase [Zea mays]
 gb|ACG29606.1| oxidoreductase [Zea mays]
Length=768

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 44/149 (30%), Positives = 69/149 (46%), Gaps = 17/149 (11%)
 Frame = +3

Query  72   GDSLFSNGKAERGNDGVYSGGCPLSPAVMATVTSISDTFLPAVD------------VPQH  215
            G  L   G A+R     Y+ G   S + MA +T++    +P++              P+ 
Sbjct  9    GHPLLRGGSAKRER---YTHG--FSASQMAALTALCGALVPSLPPADRRNGHHHNPQPEE  63

Query  216  AAVDDDSVKLFFQTSASIAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGK  395
                   V+ F   SA+    P  VA ++S +     + L+R  LWLL TR+G+L LCG 
Sbjct  64   DGGSSKVVEEFLLASAADPPVPGEVAELMSRKCLPEALALVRAVLWLLGTRLGSLALCGA  123

Query  396  ASLSSQFPYLQSFPEISPHKRAEIVRSWS  482
              LS +FP+++ F E+    R   +R WS
Sbjct  124  RCLSWRFPFVRRFDELPLEHREAALRRWS  152



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 71/138 (51%), Gaps = 6/138 (4%)
 Frame = +3

Query  114  DGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDSVKLFFQTSASIAGTPQRVA  293
            +G YS G  +S   + T++ I  T LP    P+  A + ++V  F   S S       VA
Sbjct  13   EGGYSHGFSISQ--IQTLSFICQTLLPPPPPPESTA-EQEAVDSFNVASGSQPPFTDEVA  69

Query  294  WMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLSSQFPYLQSFPEISPHKRAEIVR  473
             MI +  +   V +LR+ L +LS R GTL LCG   L+  +P++  F ++   KR EI+R
Sbjct  70   EMIVKNGRSEAVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKREEILR  129

Query  474  SW---SCCYIKILKTFYL  518
             W   S  ++ +  TF+L
Sbjct  130  MWSRQSGLFLPLRITFFL  147



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 69/139 (50%), Gaps = 17/139 (12%)
 Frame = +3

Query  111  NDGVYSGGCPLSPAVMATVTSISDTFLPAVDVPQHAAVDDDS--------VKLFFQTSAS  266
             +G Y+ G  + PA M  + +I   F+P++   + A     +        ++ F+  SA+
Sbjct  31   REGKYTHG--MHPAQMEALRAICGAFIPSMPAEEAAGAGGRADPPPGGKDLERFYLASAA  88

Query  267  IAGTPQRVAWMISERLQHPKVIllrlalwllSTRIGTLMLCGKASLS-------SQFPYL  425
             +  P  VA ++  R     V+L  + LW+LSTR+GTL+LCG+ SLS         FP +
Sbjct  89   DSTIPDEVAELMVTRCIREAVLLAWVVLWVLSTRVGTLLLCGRLSLSFSGGARDFSFPCV  148

Query  426  QSFPEISPHKRAEIVRSWS  482
              F ++   +R   ++ W+
Sbjct  149  SRFADMPVARREAALQRWN  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600