BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031K23

Length=487
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010093709.1|  hypothetical protein L484_019050                   229   4e-74   Morus notabilis
ref|XP_010264244.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_011018294.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    228   2e-73   Populus euphratica
ref|XP_010258983.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    226   1e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007039883.1|  NADH dehydrogenase 1 beta subcomplex subunit 8     225   2e-72   
ref|XP_009378949.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    225   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_011070110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    225   2e-72   Sesamum indicum [beniseed]
ref|XP_010055510.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   3e-72   Eucalyptus grandis [rose gum]
ref|XP_009770592.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   4e-72   Nicotiana sylvestris
ref|XP_010662384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    224   4e-72   Vitis vinifera
emb|CDP09936.1|  unnamed protein product                                224   5e-72   Coffea canephora [robusta coffee]
ref|XP_007215154.1|  hypothetical protein PRUPE_ppa013399mg             223   1e-71   Prunus persica
ref|XP_010530067.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    223   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_006355476.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    223   2e-71   Solanum tuberosum [potatoes]
ref|XP_008228960.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    223   2e-71   Prunus mume [ume]
gb|KHG13058.1|  hypothetical protein F383_17357                         223   3e-71   Gossypium arboreum [tree cotton]
ref|XP_008343083.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    222   4e-71   
ref|XP_009602608.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    221   5e-71   Nicotiana tomentosiformis
ref|NP_001235493.1|  uncharacterized protein LOC100499749               221   6e-71   Glycine max [soybeans]
ref|XP_004245753.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    221   6e-71   Solanum lycopersicum
ref|XP_007161348.1|  hypothetical protein PHAVU_001G061600g             222   8e-71   Phaseolus vulgaris [French bean]
ref|XP_006398455.1|  hypothetical protein EUTSA_v10001074mg             221   9e-71   Eutrema salsugineum [saltwater cress]
ref|XP_007155645.1|  hypothetical protein PHAVU_003G219300g             221   1e-70   Phaseolus vulgaris [French bean]
ref|XP_004516831.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    221   1e-70   Cicer arietinum [garbanzo]
ref|XP_002518112.1|  conserved hypothetical protein                     220   3e-70   Ricinus communis
gb|ABK94153.1|  unknown                                                 219   4e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004147198.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    219   4e-70   Cucumis sativus [cucumbers]
emb|CDY17725.1|  BnaA06g35440D                                          219   4e-70   Brassica napus [oilseed rape]
gb|KJB21488.1|  hypothetical protein B456_004G200300                    219   5e-70   Gossypium raimondii
gb|KHG01041.1|  hypothetical protein F383_21717                         219   5e-70   Gossypium arboreum [tree cotton]
emb|CDY41058.1|  BnaA09g18370D                                          219   6e-70   Brassica napus [oilseed rape]
gb|EYU32869.1|  hypothetical protein MIMGU_mgv1a016342mg                219   7e-70   Erythranthe guttata [common monkey flower]
ref|XP_009101408.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    218   9e-70   Brassica rapa
gb|EPS58672.1|  hypothetical protein M569_16139                         218   1e-69   Genlisea aurea
gb|KHN09808.1|  NADH dehydrogenase [ubiquinone] 1 beta subcomplex...    218   2e-69   Glycine soja [wild soybean]
ref|XP_006281322.1|  hypothetical protein CARUB_v10027375mg             218   2e-69   Capsella rubella
emb|CDX77778.1|  BnaC07g20320D                                          218   2e-69   
ref|XP_011466981.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    217   2e-69   Fragaria vesca subsp. vesca
ref|XP_009114266.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    217   3e-69   Brassica rapa
ref|XP_010919522.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    217   3e-69   Elaeis guineensis
gb|KJB51916.1|  hypothetical protein B456_008G237800                    217   4e-69   Gossypium raimondii
emb|CDY28920.1|  BnaA02g25560D                                          216   5e-69   Brassica napus [oilseed rape]
emb|CDY40556.1|  BnaC02g33360D                                          216   7e-69   Brassica napus [oilseed rape]
ref|XP_009128982.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    216   1e-68   Brassica rapa
ref|XP_010441437.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    216   1e-68   Camelina sativa [gold-of-pleasure]
gb|KFK31361.1|  hypothetical protein AALP_AA6G102500                    215   2e-68   Arabis alpina [alpine rockcress]
gb|KJB21491.1|  hypothetical protein B456_004G200300                    214   4e-68   Gossypium raimondii
gb|AGL09490.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          213   2e-67   Hydnora visseri
ref|XP_008796817.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    212   2e-67   Phoenix dactylifera
ref|XP_008786987.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    212   3e-67   Phoenix dactylifera
ref|XP_003608732.1|  hypothetical protein MTR_4g101140                  212   4e-67   Medicago truncatula
ref|XP_010494996.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    211   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009101407.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    207   3e-65   Brassica rapa
ref|XP_010919523.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    206   5e-65   
ref|XP_008381184.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    205   2e-64   
ref|XP_006440353.1|  hypothetical protein CICLE_v10022867mg             204   5e-64   Citrus clementina [clementine]
ref|XP_010518861.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    203   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_010264245.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    199   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_011018295.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   3e-61   Populus euphratica
ref|XP_010258984.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   5e-61   Nelumbo nucifera [Indian lotus]
ref|XP_006355519.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    196   8e-61   
gb|ABD64969.1|  hypothetical protein 25.t00006                          194   3e-60   Brassica oleracea
ref|XP_006830041.1|  hypothetical protein AMTR_s00124p00115680          194   4e-60   Amborella trichopoda
ref|NP_568684.1|  uncharacterized protein                               193   9e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006368197.1|  hypothetical protein POPTR_0001s00430g             192   2e-59   
ref|XP_002863335.1|  hypothetical protein ARALYDRAFT_494216             191   5e-59   Arabidopsis lyrata subsp. lyrata
gb|ABD64995.1|  hypothetical protein 26.t00015                          191   5e-59   Brassica oleracea
ref|XP_009400677.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    190   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD64927.1|  hypothetical protein 24.t00002                          190   2e-58   Brassica oleracea
ref|XP_010695116.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    189   3e-58   
gb|ACJ84169.1|  unknown                                                 188   5e-58   Medicago truncatula
ref|XP_003608733.1|  hypothetical protein MTR_4g101140                  184   2e-56   
ref|NP_001065325.1|  Os10g0551600                                       183   5e-56   
ref|XP_008796813.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    183   8e-56   Phoenix dactylifera
dbj|BAJ85316.1|  predicted protein                                      182   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008796814.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    182   2e-55   
gb|EEC67413.1|  hypothetical protein OsI_34583                          182   2e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_008796812.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    182   3e-55   
ref|NP_001131355.1|  uncharacterized protein LOC100192676               181   3e-55   Zea mays [maize]
emb|CDY25957.1|  BnaC09g20300D                                          192   5e-55   Brassica napus [oilseed rape]
ref|XP_006662581.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    179   1e-54   Oryza brachyantha
gb|KDP39850.1|  hypothetical protein JCGZ_03381                         176   4e-53   Jatropha curcas
ref|XP_006440354.1|  hypothetical protein CICLE_v10022867mg             175   5e-53   
ref|XP_003574306.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    173   6e-52   Brachypodium distachyon [annual false brome]
ref|XP_008659958.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    172   8e-52   
ref|NP_001142497.1|  uncharacterized protein LOC100274725               171   5e-51   Zea mays [maize]
ref|XP_002467527.1|  hypothetical protein SORBIDRAFT_01g029640          170   7e-51   Sorghum bicolor [broomcorn]
ref|XP_004983722.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    170   8e-51   Setaria italica
ref|NP_001144293.1|  uncharacterized protein LOC100277176               166   4e-49   
ref|XP_008659963.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    156   7e-46   
gb|EMT16400.1|  hypothetical protein F775_28617                         153   3e-44   
gb|ABK23873.1|  unknown                                                 153   5e-44   Picea sitchensis
gb|AGL09494.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   9e-44   Thottea sp. JN-2013
gb|AGL09493.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   1e-43   Piper nigrum
gb|AGL09491.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          150   1e-43   Manekia incurva
gb|AGL09486.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          149   4e-43   Asimina triloba [pawpaw]
emb|CBI31907.3|  unnamed protein product                                155   2e-42   Vitis vinifera
gb|AGL09497.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          147   2e-42   Zippelia begoniifolia
gb|AGL09485.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          147   2e-42   Asarum caudatum
gb|AGL09496.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          146   5e-42   Xymalos monospora
gb|AGL09488.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          146   5e-42   Chloranthus fortunei
ref|XP_010934141.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    149   5e-42   
gb|AGL09492.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          145   2e-41   Peperomia prostrata
gb|AFW87915.1|  hypothetical protein ZEAMMB73_145461                    145   6e-41   
gb|KJB21489.1|  hypothetical protein B456_004G200300                    144   8e-41   Gossypium raimondii
ref|XP_001753451.1|  predicted protein                                  143   2e-40   
gb|AGL09487.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          142   2e-40   Calycanthus occidentalis [California-allspice]
gb|KJB51917.1|  hypothetical protein B456_008G237800                    142   4e-40   Gossypium raimondii
gb|AGL09489.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          139   4e-39   Hernandia nymphaeifolia [kayu jambu hutan]
gb|AGL09495.1|  NADH dehydrogenase 1 beta subcomplex subunit 8          134   3e-37   Verhuellia lunaria
gb|KCW71992.1|  hypothetical protein EUGRSUZ_E00445                     134   6e-37   Eucalyptus grandis [rose gum]
gb|KJB21490.1|  hypothetical protein B456_004G200300                    133   2e-36   Gossypium raimondii
gb|ADY38662.1|  hypothetical protein                                    127   1e-34   Wolffia arrhiza
gb|AFP49345.1|  hypothetical protein                                    119   1e-31   Olea europaea
ref|XP_002440834.1|  hypothetical protein SORBIDRAFT_09g008006          107   6e-27   
ref|XP_002504368.1|  predicted protein                                89.4    2e-19   Micromonas commoda
gb|AGU36714.1|  kinesin-related protein                               77.4    1e-15   Helianthus petiolaris
gb|AGU36715.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36716.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36718.1|  kinesin-related protein                               77.4    1e-15   Helianthus annuus
gb|AGU36724.1|  kinesin-related protein                               77.0    1e-15   Helianthus annuus
ref|XP_001420082.1|  predicted protein                                79.0    2e-15   Ostreococcus lucimarinus CCE9901
ref|NP_001236148.1|  uncharacterized protein LOC100306514             75.9    5e-14   
ref|XP_005649552.1|  hypothetical protein COCSUDRAFT_52742            74.7    8e-14   Coccomyxa subellipsoidea C-169
ref|XP_007510211.1|  predicted protein                                73.6    2e-13   Bathycoccus prasinos
ref|XP_010229345.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...  68.2    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_003064828.1|  predicted protein                                69.7    2e-11   Micromonas pusilla CCMP1545
gb|AFK49234.1|  unknown                                               63.9    5e-10   Lotus japonicus
ref|XP_003081497.1|  unnamed protein product                          63.5    6e-10   
emb|CEF99290.1|  unnamed product                                      57.8    4e-08   Ostreococcus tauri
ref|XP_002968302.1|  hypothetical protein SELMODRAFT_409541           55.1    7e-07   
ref|XP_001700273.1|  predicted protein                                47.0    6e-04   Chlamydomonas reinhardtii
ref|XP_008908747.1|  hypothetical protein PPTG_14011                  46.6    6e-04   Phytophthora parasitica INRA-310



>ref|XP_010093709.1| hypothetical protein L484_019050 [Morus notabilis]
 gb|EXB54489.1| hypothetical protein L484_019050 [Morus notabilis]
Length=125

 Score =   229 bits (585),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASKIMGGNGVVCRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010264244.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Nelumbo nucifera]
Length=125

 Score =   228 bits (581),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GV+ RSVASSLR R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNGVIGRSVASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_011018294.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Populus euphratica]
Length=125

 Score =   228 bits (581),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASS+R R+GMGLPVGKHIVPDKP+PVNDELMWDNGT 
Sbjct  1    MAGRLSNVASQIMGGNGVVSRSVASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPFTPKVYPYDNLKVE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFTPKVYPYDNLKVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010258983.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=125

 Score =   226 bits (575),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            M+GRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MSGRLSNVASRIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_007039883.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
 gb|EOY24384.1| NADH dehydrogenase 1 beta subcomplex subunit 8 [Theobroma cacao]
Length=125

 Score =   225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+V+RSVASSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGIVSRSVASSLRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTS  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLGL+A WNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGLLAWWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009378949.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Pyrus x bretschneideri]
Length=125

 Score =   225 bits (573),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRVRAGMGLPVGKHIVPDKPLPVNDELIWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF+PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFSPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_011070110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Sesamum indicum]
Length=125

 Score =   225 bits (573),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+V+RS A+SLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGIVSRSAAASLRQRSGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010055510.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Eucalyptus grandis]
 gb|KCW71991.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=125

 Score =   224 bits (572),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGVVARSAASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009770592.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana sylvestris]
Length=125

 Score =   224 bits (572),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS AAA IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNAAARIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010662384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Vitis vinifera]
Length=125

 Score =   224 bits (572),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSL  R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGSGVVSRSVASSLPLRSGMGLPVGKHIVPNKPLPVNDELIWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIA+TVGKYEALAWMCGGL FFASLGL+AVWNDKASKIPFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIAETVGKYEALAWMCGGLSFFASLGLLAVWNDKASKIPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDP09936.1| unnamed protein product [Coffea canephora]
Length=125

 Score =   224 bits (571),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSHMASRIMGGNGVVARSVGSSLRLRSGMGLPVGKHIVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIA+TVGKYEAL+WMCGGLGFFASLGL+AVWNDKASKIP+TPKVYPY NL+ E
Sbjct  61   FPEPCIDRIAETVGKYEALSWMCGGLGFFASLGLLAVWNDKASKIPYTPKVYPYGNLRAE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_007215154.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
 gb|EMJ16353.1| hypothetical protein PRUPE_ppa013399mg [Prunus persica]
Length=125

 Score =   223 bits (569),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVP++PL VNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRLRAGMGLPVGKHIVPNRPLHVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010530067.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Tarenaya hassleriana]
Length=125

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GV+ARSV SS+R RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVIARSVGSSIRLRAGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DRIADTVGKYEAL W+CGGLGFFA+LGL AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCVDRIADTVGKYEALGWLCGGLGFFATLGLAAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_006355476.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=125

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A  IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008228960.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Prunus mume]
Length=125

 Score =   223 bits (567),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVP+ PL VNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRLRAGMGLPVGKHIVPNSPLHVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KHG13058.1| hypothetical protein F383_17357 [Gossypium arboreum]
Length=125

 Score =   223 bits (567),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPLPVNDELMWDNGT 
Sbjct  1    MAGRLSNVASKIMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLPVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008343083.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
 ref|XP_008353844.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Malus domestica]
Length=125

 Score =   222 bits (565),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSSVASKIMGGNGVVSRSVASSLRVRAGMGLPVGKHIVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC DRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCXDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009602608.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Nicotiana tomentosiformis]
Length=125

 Score =   221 bits (564),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS AA  IMGG GVVARSV SSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNAAVRIMGGNGVVARSVVSSLRTRAGMGLPVGKHIVPDKPLGVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGL FF  LGL+AVWNDKAS IPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLSFFVGLGLLAVWNDKASTIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|NP_001235493.1| uncharacterized protein LOC100499749 [Glycine max]
 gb|ACU13472.1| unknown [Glycine max]
 gb|KHN04354.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   221 bits (564),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGT 
Sbjct  1    MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_004245753.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Solanum lycopersicum]
Length=125

 Score =   221 bits (564),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A  IMGG GVVARS+ASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSLASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_007161348.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
 gb|ESW33342.1| hypothetical protein PHAVU_001G061600g [Phaseolus vulgaris]
Length=156

 Score =   222 bits (566),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGTP
Sbjct  32   MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTP  91

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  FASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  92   FPEPCIDRIADTVGKYEALAWLCGGLSCFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  151

Query  480  LG  485
            LG
Sbjct  152  LG  153



>ref|XP_006398455.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
 gb|ESQ39908.1| hypothetical protein EUTSA_v10001074mg [Eutrema salsugineum]
Length=125

 Score =   221 bits (563),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_007155645.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
 gb|ESW27639.1| hypothetical protein PHAVU_003G219300g [Phaseolus vulgaris]
Length=125

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGTP
Sbjct  1    MAGRLTNTASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_004516831.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cicer arietinum]
Length=125

 Score =   221 bits (562),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL+WDNGTP
Sbjct  1    MAGRLTNAASRILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELLWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKYPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_002518112.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44245.1| conserved hypothetical protein [Ricinus communis]
Length=126

 Score =   220 bits (560),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  123  AGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPF  302
            AGRLS  A+ IMGG GVV+RS+ SSLR R+GMGLPVGKHIVPDKPLPVN+EL+WDNGTPF
Sbjct  3    AGRLSNVASRIMGGNGVVSRSIGSSLRLRSGMGLPVGKHIVPDKPLPVNEELVWDNGTPF  62

Query  303  PEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVEL  482
            PEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ PKVYPYDNL+ EL
Sbjct  63   PEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYVPKVYPYDNLRAEL  122

Query  483  G  485
            G
Sbjct  123  G  123



>gb|ABK94153.1| unknown [Populus trichocarpa]
Length=125

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR  +GMGLPVGKHIVPDKP+ VNDEL WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGVVSRSVASSLRLSSGMGLPVGKHIVPDKPISVNDELTWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF PKVYPYDNLKVE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPFAPKVYPYDNLKVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_004147198.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_004166721.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Cucumis sativus]
 ref|XP_008448866.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Cucumis melo]
 gb|KGN55877.1| hypothetical protein Csa_3G021140 [Cucumis sativus]
Length=127

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAG+L+   + I+GG GVV RS+ASSLR R+GMGLPVGKHIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGKLTNLGSKILGGNGVVGRSIASSLRLRSGMGLPVGKHIVPDKPLPENDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLG +AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGFLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDY17725.1| BnaA06g35440D [Brassica napus]
Length=125

 Score =   219 bits (559),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KJB21488.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=125

 Score =   219 bits (558),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KHG01041.1| hypothetical protein F383_21717 [Gossypium arboreum]
Length=125

 Score =   219 bits (558),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASS R R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSVASSFRLRSGMGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYD+L+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDSLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDY41058.1| BnaA09g18370D [Brassica napus]
Length=125

 Score =   219 bits (557),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|EYU32869.1| hypothetical protein MIMGU_mgv1a016342mg [Erythranthe guttata]
Length=125

 Score =   219 bits (557),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV RSVA+SLR R+GMGLPVGKH+VPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSHVASRIMGGNGVVQRSVATSLRQRSGMGLPVGKHLVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKAS IPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASTIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009101408.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Brassica rapa]
Length=125

 Score =   218 bits (556),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVAR+ ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARTNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|EPS58672.1| hypothetical protein M569_16139, partial [Genlisea aurea]
Length=124

 Score =   218 bits (556),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  123  AGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPF  302
            AGRLS  A+ I+GG   ++RS A+SLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGTPF
Sbjct  1    AGRLSHVASRILGGNCAISRSTAASLRRRAGMGLPVGKHIVPDKPLPVNDELVWDNGTPF  60

Query  303  PEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVEL  482
            PEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS+IP+TPKV+PYDNL+VEL
Sbjct  61   PEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASRIPYTPKVFPYDNLRVEL  120

Query  483  G  485
            G
Sbjct  121  G  121



>gb|KHN09808.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, 
mitochondrial [Glycine soja]
Length=125

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ AA+ I+GG GVV RSVASSLR R+GMGLPVGKH VPDKPLP+N+EL+WDNGT 
Sbjct  1    MAGRLTNAASRILGGNGVVYRSVASSLRLRSGMGLPVGKHYVPDKPLPMNEELLWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL FFASLGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_006281322.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
 gb|EOA14220.1| hypothetical protein CARUB_v10027375mg [Capsella rubella]
Length=125

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFATLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDX77778.1| BnaC07g20320D [Brassica napus]
Length=125

 Score =   218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF P+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFAPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_011466981.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Fragaria vesca subsp. vesca]
Length=125

 Score =   217 bits (553),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS AA+ IMGG GVV RSVASSLR RAGMGLPVGKHIVPD+PLPVNDEL WDNGTP
Sbjct  1    MAGRLSSAASKIMGGNGVVHRSVASSLRLRAGMGLPVGKHIVPDRPLPVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGL  F  LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLTGGLSCFVGLGLLAVWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009114266.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   217 bits (553),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHI PDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIAPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010919522.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Elaeis guineensis]
Length=125

 Score =   217 bits (553),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLRTR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGNGVVGRSLVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            +PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASKIP+TPKVYPYDNL+VE
Sbjct  61   YPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASKIPYTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KJB51916.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=125

 Score =   217 bits (552),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ +MGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSNVASKLMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDY28920.1| BnaA02g25560D [Brassica napus]
Length=125

 Score =   216 bits (551),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGL FFA LG++AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAGLGMLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>emb|CDY40556.1| BnaC02g33360D [Brassica napus]
Length=125

 Score =   216 bits (551),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF+P+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFSPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009128982.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brassica rapa]
Length=125

 Score =   216 bits (549),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGL FF +LG++AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFGALGMLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010441437.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
 ref|XP_010481304.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Camelina sativa]
Length=125

 Score =   216 bits (549),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV+NDKAS +PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVFNDKASTVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KFK31361.1| hypothetical protein AALP_AA6G102500 [Arabis alpina]
Length=125

 Score =   215 bits (547),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV+NDKAS +P+TP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFAALGLLAVFNDKASTVPWTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|KJB21491.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=126

 Score =   214 bits (546),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF-TPKVYPYDNLKV  476
            FPEPCIDRIADTVGKYEALAWMCGGL FFASLG +A WNDKASKIPF  PKVYPYDNL+V
Sbjct  61   FPEPCIDRIADTVGKYEALAWMCGGLSFFASLGFLAWWNDKASKIPFQAPKVYPYDNLRV  120

Query  477  ELG  485
            ELG
Sbjct  121  ELG  123



>gb|AGL09490.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hydnora 
visseri]
Length=125

 Score =   213 bits (541),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL++ A+ I+GG GVV+RSV+ SLR R+GMGLPVG HIVP+ PLPVNDEL+WDNGTP
Sbjct  1    MAGRLAKVASRIVGGDGVVSRSVSLSLRHRSGMGLPVGSHIVPNNPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DRIA T+GKYE LAW+CGGLGFFASLGL+AVWNDKASK+PFTPK+YPYDNL+VE
Sbjct  61   FPEPCVDRIAPTIGKYEGLAWLCGGLGFFASLGLLAVWNDKASKLPFTPKIYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008796817.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X4 [Phoenix dactylifera]
Length=125

 Score =   212 bits (540),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+TPKVYPYDNL+VE
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008786987.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Phoenix dactylifera]
Length=125

 Score =   212 bits (539),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ASSLRTR+GMGLPVGKHIVPDKPLP +DEL+WDNGTP
Sbjct  1    MAGRLSSLGSRIMGGNGVVGRSLASSLRTRSGMGLPVGKHIVPDKPLPTHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            +PEPCIDR+A T+GKYEAL W+CGGL FFA +GL+ VWNDKASKIP+TPKVYPYDNL+VE
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLSFFAVIGLLTVWNDKASKIPYTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_003608732.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90929.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
 gb|AFK36027.1| unknown [Medicago truncatula]
Length=125

 Score =   212 bits (539),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010494996.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Camelina sativa]
Length=125

 Score =   211 bits (538),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR R+GMGLPVGKHIVP+KPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRSGMGLPVGKHIVPNKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA+LGL+AV NDKAS +PFT +VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAALGLLAVVNDKASTVPFTRRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_009101407.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X1 [Brassica rapa]
Length=143

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 112/140 (80%), Gaps = 18/140 (13%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVAR+ ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARTNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF-------------  440
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF             
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFGYLFSPFHGLSLI  120

Query  441  -----TPKVYPYDNLKVELG  485
                 TP+VYPYDNL+VELG
Sbjct  121  VLFLQTPRVYPYDNLRVELG  140



>ref|XP_010919523.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Elaeis guineensis]
Length=122

 Score =   206 bits (525),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLRTR+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGNGVVGRSLVSSLRTRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            +PEPC+DR+A T+GKYEAL W+CGGLGFFA+LGL+AVWNDKASK   TPKVYPYDNL+VE
Sbjct  61   YPEPCVDRLAPTIGKYEALGWLCGGLGFFATLGLLAVWNDKASK---TPKVYPYDNLRVE  117

Query  480  LG  485
            LG
Sbjct  118  LG  119



>ref|XP_008381184.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Malus domestica]
Length=125

 Score =   205 bits (522),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG G+V+RS  SSL  R GMGLPVGKHIVPD+PLPVNDEL WD+GT 
Sbjct  1    MAGRLSSVISRIMGGSGIVSRSATSSLXLRXGMGLPVGKHIVPDRPLPVNDELXWDDGTS  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRI DTVGKYEALAW+CG L  FA LGL+AVWNDKASKIPF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRITDTVGKYEALAWLCGSLSCFAXLGLLAVWNDKASKIPFAPKVYPYDNLQVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_006440353.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 ref|XP_006477235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Citrus sinensis]
 gb|ESR53593.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61490.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=125

 Score =   204 bits (519),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPL VNDEL+WDNGTP
Sbjct  1    MAGRLSNVASQIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_010518861.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Tarenaya hassleriana]
Length=137

 Score =   203 bits (517),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLPVNDELVWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVY  455
            FPEPC+DRIADTVGKYEAL W+CGGLGFF +LGL AVWNDKASKIPFTPKV+
Sbjct  61   FPEPCVDRIADTVGKYEALGWLCGGLGFFVTLGLAAVWNDKASKIPFTPKVF  112



>ref|XP_010264245.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Nelumbo nucifera]
Length=115

 Score =   199 bits (507),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GV+ RSVASSLR R+GMGLPVGKHI+PDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNGVIGRSVASSLRLRSGMGLPVGKHIIPDKPLPVNDELLWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  452
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIPF   +
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPFVVTI  111



>ref|XP_011018295.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial isoform X2 [Populus euphratica]
Length=118

 Score =   196 bits (499),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASS+R R+GMGLPVGKHIVPDKP+PVNDELMWDNGT 
Sbjct  1    MAGRLSNVASQIMGGNGVVSRSVASSIRLRSGMGLPVGKHIVPDKPIPVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>ref|XP_010258984.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=113

 Score =   196 bits (498),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            M+GRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPLPVNDEL+WDNGTP
Sbjct  1    MSGRLSNVASRIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPEKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            FPEPC+DRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKAS IPF
Sbjct  61   FPEPCLDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASXIPF  107



>ref|XP_006355519.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Solanum tuberosum]
Length=142

 Score =   196 bits (499),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 101/117 (86%), Gaps = 1/117 (1%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A  IMGG GVVARSVASSLRTRAGMGLPVGKHIVPDKPL VNDEL WDNGTP
Sbjct  1    MAGRLSNVATRIMGGNGVVARSVASSLRTRAGMGLPVGKHIVPDKPLHVNDELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNL  470
            FPEPCIDRIADTVGKYEALAW+CGGL  F  +GL+AVWNDKASKIPF P   P ++L
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFVGIGLLAVWNDKASKIPFFPTT-PSEHL  116



>gb|ABD64969.1| hypothetical protein 25.t00006 [Brassica oleracea]
Length=134

 Score =   194 bits (494),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG G+VARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGIVARSNASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  452
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF  ++
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVSEI  111



>ref|XP_006830041.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
 gb|ERM97457.1| hypothetical protein AMTR_s00124p00115680 [Amborella trichopoda]
Length=124

 Score =   194 bits (492),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MA +LS AAA I+GG   +     SSLR R+GMGLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAAKLSSAAARILGGN-GLLLRGRSSLRHRSGMGLPVGKHIVPDKPLPVNDELIWDNGTA  59

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            +PEPC+D++A TVG+YEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VE
Sbjct  60   YPEPCLDKLATTVGEYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVE  119

Query  480  LG  485
            LG
Sbjct  120  LG  121



>ref|NP_568684.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FGK0.1|NDUB8_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL58924.1|AF462836_1 AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 dbj|BAB09083.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM19870.1| AT5g47570/MNJ7_16 [Arabidopsis thaliana]
 gb|AAM61542.1| unknown [Arabidopsis thaliana]
 gb|AED95533.1| uncharacterized protein AT5G47570 [Arabidopsis thaliana]
Length=125

 Score =   193 bits (490),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGLGFF  LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_006368197.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
 gb|ERP64766.1| hypothetical protein POPTR_0001s00430g [Populus trichocarpa]
Length=118

 Score =   192 bits (487),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RSVASSLR R+GMGLPVGKHIVPDKP+ VNDEL WDNGT 
Sbjct  1    MAGRLSNVASRIMGGNGVVSRSVASSLRLRSGMGLPVGKHIVPDKPISVNDELTWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKAS IPF
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASTIPF  107



>ref|XP_002863335.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39594.1| hypothetical protein ARALYDRAFT_494216 [Arabidopsis lyrata subsp. 
lyrata]
Length=125

 Score =   191 bits (486),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARSV SSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEALAW+ GGLGFFA LGL+AV NDKASK+PFTP+VYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEALAWLSGGLGFFAGLGLLAVLNDKASKVPFTPRVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|ABD64995.1| hypothetical protein 26.t00015 [Brassica oleracea]
Length=125

 Score =   191 bits (485),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSAASSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  449
            FPEPCIDRIADTVGKYEAL W+CGGL FFA+LG++AV NDKASK+PF  +
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLSFFAALGMLAVLNDKASKVPFVSE  110



>ref|XP_009400677.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Musa acuminata subsp. malaccensis]
Length=125

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GV ARS AS+LR+R+GMG P+GKHIVPDKPLP + +L+WDNGTP
Sbjct  1    MAGRLSGVASRIMGGNGVAARSAASALRSRSGMGFPLGKHIVPDKPLPADHDLLWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVWNDKASKIP+ PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVWNDKASKIPYAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>gb|ABD64927.1| hypothetical protein 24.t00002 [Brassica oleracea]
Length=126

 Score =   190 bits (482),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDK L VNDELMWDNGT 
Sbjct  1    MAGRLSGVASRIMGGNGVVARSGASSLRQRAGMGLPVGKHIVPDKRLSVNDELMWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVY  455
            FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKASK+PF   +Y
Sbjct  61   FPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKASKVPFVSDLY  112



>ref|XP_010695116.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=128

 Score =   189 bits (480),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS+ A+ ++GG GVV+RSV +SLR RAGMGLPVGKHIVPDK L VNDEL WDNGT 
Sbjct  1    MAGRLSKVASSMLGGNGVVSRSVGNSLRQRAGMGLPVGKHIVPDKSLSVNDELTWDNGTS  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNL  470
            FPEPCIDRIADTVGKYEALAW+CGGLGFFA+LGL AVWNDKASK PF   +    + 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFATLGLAAVWNDKASKYPFVSFILQLSDF  117



>gb|ACJ84169.1| unknown [Medicago truncatula]
Length=125

 Score =   188 bits (478),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+  A+ I+GG GVV RSVASSLR R+ M LPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSSMSLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGKYEA AW+CGGL  FA LGL+AVWNDKASK PF PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGKYEASAWLCGGLSCFAGLGLLAVWNDKASKTPFAPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_003608733.1| hypothetical protein MTR_4g101140 [Medicago truncatula]
 gb|AES90930.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 [Medicago 
truncatula]
Length=117

 Score =   184 bits (467),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+  A+ I+GG GVV RSVASSLR R+GMGLPVGKH VP+KPLP+N+EL WDNGTP
Sbjct  1    MAGRLTNVASQILGGNGVVHRSVASSLRLRSGMGLPVGKHYVPNKPLPMNEELTWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  443
            FPEPCIDRIADTVGKYEALAW+CGGL  FA LGL+AVWNDKASK PF 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLSCFAGLGLLAVWNDKASKTPFV  108



>ref|NP_001065325.1| Os10g0551600 [Oryza sativa Japonica Group]
 gb|AAG13469.1|AC026758_6 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54938.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27162.1| Os10g0551600 [Oryza sativa Japonica Group]
 dbj|BAG88471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51371.1| hypothetical protein OsJ_32392 [Oryza sativa Japonica Group]
Length=125

 Score =   183 bits (465),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + ++GG+G  AR+  S+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRVLGGQGAAARAAVSALRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  NDKASKIP+TPKVYP+DNL+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNDKASKIPYTPKVYPFDNLREE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008796813.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X2 [Phoenix dactylifera]
Length=132

 Score =   183 bits (465),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  443
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+ 
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPYV  108



>dbj|BAJ85316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=125

 Score =   182 bits (463),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+   + IMGG G  AR+ AS+LR RAGMGLP G+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRIMGGHGAAARAAASALRNRAGMGLPAGRHIVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+TPKVYPYDNL+VE
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYTPKVYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008796814.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X3 [Phoenix dactylifera]
Length=128

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>gb|EEC67413.1| hypothetical protein OsI_34583 [Oryza sativa Indica Group]
Length=125

 Score =   182 bits (462),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + ++GG+G  AR+  S+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRVLGGQGAAARAAVSALRHRAGMGLPVGRHIVPDKPLPTNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LGL A  N+KASKIP+TPKVYP+DNL+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGLAATLNNKASKIPYTPKVYPFDNLREE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008796812.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like isoform X1 [Phoenix dactylifera]
Length=156

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS   + IMGG GVV RS+ SSLR R+GMGLPVGKHIVPDKPLPV+DEL+WDNGTP
Sbjct  1    MAGRLSSVGSRIMGGHGVVGRSLGSSLRNRSGMGLPVGKHIVPDKPLPVHDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            +PEPCIDR+A T+GKYEAL W+CGGLG FA++GL+AVWNDKASK+P+
Sbjct  61   YPEPCIDRLAPTIGKYEALGWLCGGLGIFATIGLLAVWNDKASKVPY  107



>ref|NP_001131355.1| uncharacterized protein LOC100192676 [Zea mays]
 gb|ACG35760.1| hypothetical protein [Zea mays]
Length=123

 Score =   181 bits (460),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + I+   G  AR+  S+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAXSALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE  118

Query  480  LG  485
            LG
Sbjct  119  LG  120



>emb|CDY25957.1| BnaC09g20300D [Brassica napus]
Length=553

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  66   YLILH*NPQISERSDHRKMAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIV  245
            Y+    N  + +     KMAGRL   A+ IMGG GVVARS A+SLR RAGMGLPVGKHIV
Sbjct  410  YINRQPNGDVGQACRLSKMAGRLFGVASRIMGGNGVVARSGAASLRQRAGMGLPVGKHIV  469

Query  246  PDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKA  425
            PDK L VNDELMWDNGT FPEPCIDRIADTVGKYEAL W+CGGLGFFA+LGL+AV NDKA
Sbjct  470  PDKRLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALGWLCGGLGFFATLGLLAVVNDKA  529

Query  426  SKIPFTPKVY  455
            SK+PF   +Y
Sbjct  530  SKVPFVSDLY  539



>ref|XP_006662581.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Oryza brachyantha]
Length=104

 Score =   179 bits (455),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  183  SVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAW  362
            + AS+LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTPFPEPCIDR+A  +GKYEALAW
Sbjct  1    AAASALRHRAGMGLPVGRHIVPDKPLPTNDELLWDNGTPFPEPCIDRLAPHIGKYEALAW  60

Query  363  MCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            +CGGLGFFA+LGL A  NDKASKIP+TPKVYPYDNL+ ELG
Sbjct  61   LCGGLGFFATLGLAAALNDKASKIPYTPKVYPYDNLREELG  101



>gb|KDP39850.1| hypothetical protein JCGZ_03381 [Jatropha curcas]
Length=117

 Score =   176 bits (445),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG  +V RSV+SSLR R+GMGLPVGKHIVPDKPLPVN+EL+WDNGTP
Sbjct  1    MAGRLSNVASRIMGGNSIVGRSVSSSLRLRSGMGLPVGKHIVPDKPLPVNEELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  443
            FPEPCIDRIADTVGKYEALAW+CGGLGFFASLGL+ VWNDKASKIP+ 
Sbjct  61   FPEPCIDRIADTVGKYEALAWLCGGLGFFASLGLLVVWNDKASKIPYN  108



>ref|XP_006440354.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|ESR53594.1| hypothetical protein CICLE_v10022867mg [Citrus clementina]
 gb|KDO61491.1| hypothetical protein CISIN_1g033216mg [Citrus sinensis]
Length=112

 Score =   175 bits (444),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV RSVASSLR R+GMGLPVGKHIVP+KPL VNDEL+WDNGTP
Sbjct  1    MAGRLSNVASQIMGGNGVVGRSVASSLRLRSGMGLPVGKHIVPNKPLSVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPK  449
            FPEPCIDRIADTVGKYEAL W+ GGLGFFASLG +AVWNDKASKIPF  +
Sbjct  61   FPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKASKIPFVSR  110



>ref|XP_003574306.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial [Brachypodium distachyon]
Length=125

 Score =   173 bits (438),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+   + ++GG G  AR+ AS+LR RAGMGLP G+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRVLGGHGAAARAAASALRHRAGMGLPAGRHIVPDKPLPTNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASKIPFTPK+YPYDNL+VE
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVANDKASKIPFTPKIYPYDNLRVE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_008659958.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Zea mays]
 gb|ACF79732.1| unknown [Zea mays]
Length=123

 Score =   172 bits (437),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPYTPKVYPYDNLRAE  118

Query  480  LG  485
            LG
Sbjct  119  LG  120



>ref|NP_001142497.1| uncharacterized protein LOC100274725 [Zea mays]
 gb|ACG24387.1| hypothetical protein [Zea mays]
 gb|ACG30533.1| hypothetical protein [Zea mays]
 gb|ACG44917.1| hypothetical protein [Zea mays]
 gb|ACG47173.1| hypothetical protein [Zea mays]
 tpg|DAA46215.1| TPA: hypothetical protein ZEAMMB73_636535 [Zea mays]
Length=125

 Score =   171 bits (432),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A   ++GG G  A + A++LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGFRVLGGGGARAAAAAAALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKASKIP+TPKVYPYD+L+ E
Sbjct  61   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGVAAVVNDKASKIPYTPKVYPYDSLRAE  120

Query  480  LG  485
            LG
Sbjct  121  LG  122



>ref|XP_002467527.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
 gb|EER94525.1| hypothetical protein SORBIDRAFT_01g029640 [Sorghum bicolor]
Length=124

 Score =   170 bits (431),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKP+PVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPVPVNDELVWDNGTP  58

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA LG+ A  NDKASKIP+TPKVYPYDNL+ E
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAVLGVAAAVNDKASKIPYTPKVYPYDNLRAE  118

Query  480  LG  485
            LG
Sbjct  119  LG  120



>ref|XP_004983722.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Setaria italica]
Length=123

 Score =   170 bits (431),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + I+   G  AR+ A++LR RAGMGLPVG+HIVPDKPLP NDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAAAALRHRAGMGLPVGRHIVPDKPLPTNDELLWDNGTP  58

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A  NDKASKIP+TPKVYPYDNL+VE
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFATLGVAAAVNDKASKIPYTPKVYPYDNLRVE  118

Query  480  LG  485
            LG
Sbjct  119  LG  120



>ref|NP_001144293.1| uncharacterized protein LOC100277176 [Zea mays]
 gb|ACG39358.1| hypothetical protein [Zea mays]
Length=123

 Score =   166 bits (419),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  216  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  395
            MGLPVG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+L
Sbjct  31   MGLPVGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAAL  90

Query  396  GLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            G+ AV N+KASKIP+TPKVYPYDNL+ ELG
Sbjct  91   GVAAVVNNKASKIPYTPKVYPYDNLRAELG  120



>ref|XP_008659963.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like, partial [Zea mays]
Length=89

 Score =   156 bits (395),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +3

Query  228  VGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  407
            VG+HIVPDKPLPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ A
Sbjct  1    VGRHIVPDKPLPVNDELVWDNGTPFPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAA  60

Query  408  VWNDKASKIPFTPKVYPYDNLKVELG  485
            V NDKAS IP+TPKVYPYDNL+ ELG
Sbjct  61   VVNDKASNIPYTPKVYPYDNLRAELG  86



>gb|EMT16400.1| hypothetical protein F775_28617 [Aegilops tauschii]
Length=115

 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+   + IMGG G  AR+ AS+LR RAGMGLP G+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAMGSRIMGGHGAAARAAASALRNRAGMGLPAGRHIVPDKPLPVNDELVWDNGTP  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFT  443
            FPEPC+DR+A  +GKYEALAW+CGGL FFA+LGL AV NDKASK+P+ 
Sbjct  61   FPEPCVDRLAPHIGKYEALAWLCGGLSFFAALGLAAVVNDKASKMPYA  108



>gb|ABK23873.1| unknown [Picea sitchensis]
 gb|ABR17760.1| unknown [Picea sitchensis]
 gb|ACN39914.1| unknown [Picea sitchensis]
Length=130

 Score =   153 bits (386),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  168  GVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGK  344
            G+VARS + SLR R+GMG+PVG    PDKPL +  EL+WD+G+ +PEP +DRIA   +GK
Sbjct  12   GMVARSASGSLRLRSGMGMPVGTTPPPDKPLHIQHELIWDDGSAYPEPALDRIAAPQIGK  71

Query  345  YEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            YEALAW+CGGL FF  +GL+AVWNDKASKIP+TPK YP+DNL+VELG
Sbjct  72   YEALAWLCGGLSFFGLVGLLAVWNDKASKIPYTPKEYPFDNLRVELG  118



>gb|AGL09494.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Thottea 
sp. JN-2013]
Length=77

 Score =   150 bits (380),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDR+A T+GKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALAWLCGGLSFFASLGLLAVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09493.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Piper 
nigrum]
Length=77

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPVN+EL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGLGFFASLGL+AVW
Sbjct  1    KHIVXDKPLPVNEELVWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLGFFASLGLLAVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09491.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Manekia 
incurva]
Length=77

 Score =   150 bits (379),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPVNDEL+WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGLMAVW
Sbjct  1    KHIVLDKPLPVNDELVWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLMAVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|AGL09486.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asimina 
triloba]
Length=78

 Score =   149 bits (376),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKP+PVNDEL+WDNGTPFPEPCIDR+A T+GKYEAL W+CGGLGFFA+LGL+AVW
Sbjct  1    KHIVXDKPVPVNDELVWDNGTPFPEPCIDRLAPTIGKYEALGWLCGGLGFFATLGLLAVW  60

Query  414  NDKASKIPFTPKVYPYDN  467
            NDKASKIPFTPKVYPYD 
Sbjct  61   NDKASKIPFTPKVYPYDK  78



>emb|CBI31907.3| unnamed protein product [Vitis vinifera]
Length=325

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/75 (93%), Positives = 74/75 (99%), Gaps = 0/75 (0%)
 Frame = +3

Query  216  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  395
            MGLPVGKHIVP+KPLPVNDEL+WDNGTPFPEPCIDRIA+TVGKYEALAWMCGGL FFASL
Sbjct  1    MGLPVGKHIVPNKPLPVNDELIWDNGTPFPEPCIDRIAETVGKYEALAWMCGGLSFFASL  60

Query  396  GLMAVWNDKASKIPF  440
            GL+AVWNDKASKIPF
Sbjct  61   GLLAVWNDKASKIPF  75



>gb|AGL09497.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Zippelia 
begoniifolia]
Length=77

 Score =   147 bits (371),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPV+DEL+WDNGT FPEPCIDRIA TVGKYEALAW+CGGL FFASLGL+AVW
Sbjct  1    KHIVLDKPLPVHDELIWDNGTAFPEPCIDRIAPTVGKYEALAWLCGGLSFFASLGLLAVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKASK+PFTPKVYPYD
Sbjct  61   NDKASKVPFTPKVYPYD  77



>gb|AGL09485.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Asarum 
caudatum]
Length=77

 Score =   147 bits (371),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/76 (89%), Positives = 71/76 (93%), Gaps = 0/76 (0%)
 Frame = +3

Query  237  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  416
            HIV DKPLPVNDEL WDNGT FPEPCIDRIA T+GKYEALAW+CGGL FFASLGL+AVWN
Sbjct  2    HIVLDKPLPVNDELTWDNGTAFPEPCIDRIAPTIGKYEALAWLCGGLSFFASLGLLAVWN  61

Query  417  DKASKIPFTPKVYPYD  464
            DKASKIPFTPKVYPYD
Sbjct  62   DKASKIPFTPKVYPYD  77



>gb|AGL09496.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Xymalos 
monospora]
Length=78

 Score =   146 bits (369),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPVNDEL+WDNGTPFPEPCIDRIA ++GKYEALAW  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCIDRIAPSIGKYEALAWWLGGLGFFASIGLLAVW  60

Query  414  NDKASKIPFTPKVYPYDN  467
            NDKASK+PFTPKVYPYD 
Sbjct  61   NDKASKVPFTPKVYPYDK  78



>gb|AGL09488.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Chloranthus 
fortunei]
Length=78

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  237  HIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWN  416
            HIV DKPLPVNDEL+WDNGTPFPEPCIDRIA  +GKYEAL W+CGGL FFASLGL+AVWN
Sbjct  2    HIVXDKPLPVNDELIWDNGTPFPEPCIDRIAPHIGKYEALGWLCGGLSFFASLGLLAVWN  61

Query  417  DKASKIPFTPKVYPYDN  467
            DKASKIPFTPKVYPYD 
Sbjct  62   DKASKIPFTPKVYPYDK  78



>ref|XP_010934141.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 beta subcomplex subunit 8, mitochondrial [Elaeis guineensis]
Length=160

 Score =   149 bits (375),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 93/113 (82%), Gaps = 2/113 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGM--GLPVGKHIVPDKPLPVNDELMWDNG  293
            M GRLS   + IMGG GVV RS+ASSLR R+GM  GLPVGK IVPDKPLPV+DEL+ DNG
Sbjct  1    MVGRLSSVGSRIMGGNGVVGRSLASSLRNRSGMPRGLPVGKXIVPDKPLPVHDELVXDNG  60

Query  294  TPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKV  452
            TP PEPC DR+A T+GKYEAL W+ GGLGFFA+LGL+AVWNDKASK+P+   V
Sbjct  61   TPCPEPCXDRLAATIGKYEALGWLGGGLGFFATLGLLAVWNDKASKVPYFRNV  113



>gb|AGL09492.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Peperomia 
prostrata]
Length=78

 Score =   145 bits (365),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPV+DEL WDNGTP+PEPCIDRIA  +GKYEALAW+CGGLGFF SLGL++VW
Sbjct  1    KHIVXDKPLPVDDELTWDNGTPYPEPCIDRIAPNIGKYEALAWLCGGLGFFTSLGLLSVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKAS IPFTPKVYPYD
Sbjct  61   NDKASSIPFTPKVYPYD  77



>gb|AFW87915.1| hypothetical protein ZEAMMB73_145461 [Zea mays]
Length=117

 Score =   145 bits (365),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 2/107 (2%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL+ A + I+   G  AR+ AS+LR RAGMGLPVG+HIVPDKPLPVNDEL+WDNGTP
Sbjct  1    MAGRLTAAGSRIL--GGGGARAAASALRHRAGMGLPVGRHIVPDKPLPVNDELVWDNGTP  58

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            FPEPCIDR+A  +GKYEALAW+CGGLGFFA+LG+ AV NDKAS IP+
Sbjct  59   FPEPCIDRLAPHIGKYEALAWLCGGLGFFAALGMAAVVNDKASNIPY  105



>gb|KJB21489.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=93

 Score =   144 bits (362),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 82/122 (67%), Gaps = 32/122 (26%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGK                                 PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGK--------------------------------APKVYPYDNLRVE  88

Query  480  LG  485
            LG
Sbjct  89   LG  90



>ref|XP_001753451.1| predicted protein [Physcomitrella patens]
 gb|EDQ81674.1| predicted protein [Physcomitrella patens]
Length=102

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  186  VASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWM  365
            +AS++R RAG GLPVG   VP  PLP N EL+WD+G+PFPEPC+D +A  VGKYEALAW+
Sbjct  1    MASAMRLRAGAGLPVGSMEVPAHPLPENAELIWDDGSPFPEPCLDNVAPMVGKYEALAWL  60

Query  366  CGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
             GG+G FA +G +A WNDKAS+IP+ P+ YPYD+LKVELG
Sbjct  61   LGGMGLFAGIGGLAAWNDKASRIPWAPREYPYDDLKVELG  100



>gb|AGL09487.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Calycanthus 
occidentalis]
Length=78

 Score =   142 bits (358),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KH V DKP+PVNDEL+WDNGTP+PEPC+DR+A ++GKYEALAW+CGGLGFFA+LGL AVW
Sbjct  1    KHJVXDKPVPVNDELVWDNGTPYPEPCLDRLAPSIGKYEALAWLCGGLGFFAALGLAAVW  60

Query  414  NDKASKIPFTPKVYPYDN  467
            NDKASK+PFTPKVY YD 
Sbjct  61   NDKASKVPFTPKVYXYDK  78



>gb|KJB51917.1| hypothetical protein B456_008G237800 [Gossypium raimondii]
Length=93

 Score =   142 bits (357),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 81/122 (66%), Gaps = 32/122 (26%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ +MGG G+V+RS ASSLR R+GMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSNVASKLMGGNGIVSRSAASSLRLRSGMGLPVGKHIVPDKPLSVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
            FPEPCIDRIADTVGK                                 PKVYPYDNL+VE
Sbjct  61   FPEPCIDRIADTVGK--------------------------------APKVYPYDNLRVE  88

Query  480  LG  485
            LG
Sbjct  89   LG  90



>gb|AGL09489.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Hernandia 
nymphaeifolia]
Length=78

 Score =   139 bits (349),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLPVNDEL+WDNGTPFPEPC+DRIA T+GKYE L W  GGLGFFAS+GL+AVW
Sbjct  1    KHIVXDKPLPVNDELVWDNGTPFPEPCLDRIAPTMGKYETLVWWFGGLGFFASIGLLAVW  60

Query  414  NDKASKIPFTPKVYPYDN  467
            NDKASKIP+TPKV PYD 
Sbjct  61   NDKASKIPYTPKVXPYDK  78



>gb|AGL09495.1| NADH dehydrogenase 1 beta subcomplex subunit 8, partial [Verhuellia 
lunaria]
Length=77

 Score =   134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +3

Query  234  KHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVW  413
            KHIV DKPLP + +L+WDNG+ F EPCIDRIA TVGKYEAL W+CGGL FFA LGL+AVW
Sbjct  1    KHIVLDKPLPADFDLIWDNGSAFQEPCIDRIAPTVGKYEALGWLCGGLSFFAGLGLLAVW  60

Query  414  NDKASKIPFTPKVYPYD  464
            NDKASKIPFTPKVYPYD
Sbjct  61   NDKASKIPFTPKVYPYD  77



>gb|KCW71992.1| hypothetical protein EUGRSUZ_E00445 [Eucalyptus grandis]
Length=91

 Score =   134 bits (336),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVVARS ASSLR RAGMGLPVGKHIVPDKPL VNDEL+WDNGT 
Sbjct  1    MAGRLSHVASRIMGGNGVVARSAASSLRLRAGMGLPVGKHIVPDKPLHVNDELVWDNGTA  60

Query  300  FPEPCIDRIADTVGK  344
            FPEPCIDRIADTVGK
Sbjct  61   FPEPCIDRIADTVGK  75



>gb|KJB21490.1| hypothetical protein B456_004G200300 [Gossypium raimondii]
Length=100

 Score =   133 bits (334),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRLS  A+ IMGG GVV+RS+ASS R R+G+GLPVGKHIVPDKPLPVNDEL+WDNGT 
Sbjct  1    MAGRLSNVASRIMGGTGVVSRSIASSFRLRSGIGLPVGKHIVPDKPLPVNDELIWDNGTA  60

Query  300  FPEPCIDRIADTVGK  344
            FPEPCIDRIADTVGK
Sbjct  61   FPEPCIDRIADTVGK  75



>gb|ADY38662.1| hypothetical protein [Wolffia arrhiza]
Length=91

 Score =   127 bits (320),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 6/96 (6%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL++    I+GG G++ RS +    +R+GMGLPVG+HIVPD+ LP NDEL+WDNGTP
Sbjct  1    MAGRLNR----ILGGSGLIGRSSSLR--SRSGMGLPVGRHIVPDRTLPENDELVWDNGTP  54

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMA  407
            FPEPCIDR+A  +GKYEALAW+CGGLGFFASLGL+A
Sbjct  55   FPEPCIDRLAPHIGKYEALAWLCGGLGFFASLGLLA  90



>gb|AFP49345.1| hypothetical protein, partial [Olea europaea]
Length=64

 Score =   119 bits (298),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +3

Query  312  CIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            CIDRIADTVGKYEALAW+CGGLGFFASLGL+AVWNDKASKIPFTPKVYPYDNL+VELG
Sbjct  4    CIDRIADTVGKYEALAWLCGGLGFFASLGLLAVWNDKASKIPFTPKVYPYDNLRVELG  61



>ref|XP_002440834.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
 gb|EES19264.1| hypothetical protein SORBIDRAFT_09g008006 [Sorghum bicolor]
Length=61

 Score =   107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  258  LPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIP  437
            LPVNDEL+WDNGTPFPEPCIDR+A  +GKYEALAW+C GLGFFA+LG+ A  NDKASKIP
Sbjct  1    LPVNDELLWDNGTPFPEPCIDRLAPHIGKYEALAWLCRGLGFFAALGVAAAVNDKASKIP  60

Query  438  F  440
            +
Sbjct  61   Y  61



>ref|XP_002504368.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65626.1| predicted protein [Micromonas sp. RCC299]
Length=132

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +3

Query  132  LSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEP  311
            L +A +H  G +    R++  +  +RAGMG PV  H VP   LP   EL WD G  +PEP
Sbjct  13   LLRAVSHAPGTQVGGIRNLHVTAASRAGMGTPVPAHEVPTAELPEESELTWDCGDAYPEP  72

Query  312  CIDRIADTVGK-YEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
             +D +   + K  EA A++ GGLG F S+  +A   DK S  PF  K +P+DNLK ELG
Sbjct  73   ALDVVPPHIVKPAEAAAYLFGGLGVFYSIYSLAKVVDKPSTQPFADKQFPFDNLKTELG  131



>gb|AGU36714.1| kinesin-related protein, partial [Helianthus petiolaris]
 gb|AGU36719.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36720.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36722.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36723.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36725.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36726.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36730.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36732.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36733.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36735.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36736.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36737.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36738.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36715.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36717.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36721.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36727.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36728.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36729.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36731.1| kinesin-related protein, partial [Helianthus annuus]
 gb|AGU36734.1| kinesin-related protein, partial [Helianthus annuus]
Length=41

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36716.1| kinesin-related protein, partial [Helianthus annuus]
Length=42

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36718.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>gb|AGU36724.1| kinesin-related protein, partial [Helianthus annuus]
Length=43

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  DRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPF  440
            DRIADTVGKYEAL W+CGGLGFFA+LGLMA  NDKASKIP+
Sbjct  1    DRIADTVGKYEALGWLCGGLGFFATLGLMATLNDKASKIPY  41



>ref|XP_001420082.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98375.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=125

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 9/124 (7%)
 Frame = +3

Query  117  KMAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGT  296
            ++A RL++A        G   R VA+S R RAG+G  +     P + +P   EL WD G 
Sbjct  8    ELATRLARA--------GAKTRGVATSARARAGVGPAIEPTRAPVREIPEEAELTWDAGD  59

Query  297  PFPEPCIDRI-ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLK  473
              PEP +D + A  V K  A  ++     F   +  +A   DK S  PF PK +PY+ L+
Sbjct  60   AHPEPALDDVPARIVTKARAATYLASAFAFLGGVYGLATMVDKPSTTPFAPKTFPYNGLE  119

Query  474  VELG  485
            VELG
Sbjct  120  VELG  123



>ref|NP_001236148.1| uncharacterized protein LOC100306514 [Glycine max]
 gb|ACU14719.1| unknown [Glycine max]
Length=166

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = -2

Query  483  QAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQYDQYRVP  304
            QAPL+ CHM I  V    W+LCHS QP++   +K  I HT++PMLHTF++ +QYD Y V 
Sbjct  38   QAPLADCHMDILWVQTVSWRLCHSTQPTIPATRKNSIPHTARPMLHTFRQCQQYDLYTVR  97

Query  303  GTESHCPT*VHHSPGEVYREQYV  235
              +  CPT V HS   V RE  V
Sbjct  98   EMQCRCPTGVPHSWEGVCREHSV  120



>ref|XP_005649552.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25008.1| hypothetical protein COCSUDRAFT_52742 [Coccomyxa subellipsoidea 
C-169]
Length=144

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = +3

Query  120  MAGRLSQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTP  299
            MAGRL  A    +  R V+A      +R   G  + +G+ I  D+ LP +DEL+WD+G+ 
Sbjct  1    MAGRL--ANMRFLAQR-VMAPKAVLPVRGEGGGPVKMGRAI--DQALPEHDELLWDDGSA  55

Query  300  FPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVE  479
             PE C+D+    V KYEAL ++ GGLGF+  LG +A +NDKASK P+  K YPYDNLK E
Sbjct  56   QPEHCLDQFP-LVPKYEALGFLLGGLGFYFLLGQLARFNDKASKKPYVDKEYPYDNLKAE  114

Query  480  LG  485
            +G
Sbjct  115  MG  116



>ref|XP_007510211.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18556.1| predicted protein [Bathycoccus prasinos]
Length=145

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = +3

Query  180  RSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI-ADTVGKYEAL  356
            RS+A++ +  AGMG P G    P +PL    EL+WD G   PE  +D + A  VGKYEAL
Sbjct  42   RSIATTTKINAGMGSPTGTAPAPTEPLEEEHELIWDAGDKHPETALDNLPAKIVGKYEAL  101

Query  357  AWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
              + G L F   +   A + DKA+  PF  +     +LK ELG
Sbjct  102  GMLVGALCFMGGVYTFAGYYDKAASRPFVERDME-KSLKKELG  143



>ref|XP_010229345.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex 
subunit 8, mitochondrial-like [Brachypodium distachyon]
Length=108

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 52/116 (45%), Gaps = 37/116 (32%)
 Frame = +3

Query  216  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASL  395
            MGLP G  + P++P+ VN+EL+WDNGTPFP           G             FFA+L
Sbjct  1    MGLPAGNEVAPERPIRVNEELVWDNGTPFP-----------GDLRRPPRAPTSARFFAAL  49

Query  396  GLMAVWNDKASKIP--------------------------FTPKVYPYDNLKVELG  485
            GL AV + K   +P                            PKVYPYDNL VELG
Sbjct  50   GLAAVVSAKMPHVPDLGEVRRASEPLSLTILLSSTLAWQCLAPKVYPYDNLTVELG  105



>ref|XP_003064828.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51162.1| predicted protein [Micromonas pusilla CCMP1545]
Length=303

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = +3

Query  258  LPVNDELMWDNGTPFPEPCIDRIADTV-GKYEALAWMCGGLGFFASLGLMAVWNDKASKI  434
            +P   EL WD G   PE  +D++ + V  K  A A +  GLGFF  L   A + DKAS +
Sbjct  217  IPEEAELTWDIGDGNPESALDKVPENVLSKRGAAALLATGLGFFVGLYHFAGYLDKASTV  276

Query  435  PFTPKVYPYDNLKVELG  485
            PF P+ YPY+NLK ELG
Sbjct  277  PFAPRTYPYNNLKEELG  293



>gb|AFK49234.1| unknown [Lotus japonicus]
Length=125

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  483  QAPLSGCHMGIPSV*MGFWKLCHSRQPSVQEKQKIPIHHTSKPMLHTFQRYRQYDQYRVP  304
            ++ L  CHM    V M  W+L HS  P++ E Q   I H ++PMLHTFQ+Y+Q D YRV 
Sbjct  5    KSSLPDCHMDTLWVQMESWRLYHSTLPTIPETQNNSIPHRARPMLHTFQQYQQCDLYRVR  64

Query  303  GTESHCPT*VHHS  265
              + H PT VHHS
Sbjct  65   VMKYHYPTQVHHS  77



>ref|XP_003081497.1| unnamed protein product [Ostreococcus tauri]
Length=123

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 57/118 (48%), Gaps = 6/118 (5%)
 Frame = +3

Query  135  SQAAAHIMGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPC  314
            S  A   + GRGV  R+ ++ +    GMG  +     P + +P   EL WD G    EP 
Sbjct  9    SALARWTIAGRGV--RTTSARM---GGMGPAIEPTEAPTREMPEEAELTWDAGDKHHEPA  63

Query  315  IDRIAD-TVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            +D + +  V K  A  ++ G   F   +   AV  DK SK PF PK +PY+ L  ELG
Sbjct  64   LDDVPEHIVTKNRAATYLVGAFCFLGCVYGTAVMVDKPSKTPFVPKEFPYNGLAKELG  121



>emb|CEF99290.1| unnamed product [Ostreococcus tauri]
Length=93

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = +3

Query  216  MGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRIAD-TVGKYEALAWMCGGLGFFAS  392
            MG  +     P + +P   EL WD G    EP +D + +  V K  A  ++ G   F   
Sbjct  1    MGPAIEPTEAPTREMPEEAELTWDAGDKHHEPALDDVPEHIVTKNRAATYLVGAFCFLGC  60

Query  393  LGLMAVWNDKASKIPFTPKVYPYDNLKVELG  485
            +   AV  DK SK PF PK +PY+ L  ELG
Sbjct  61   VYGTAVMVDKPSKTPFVPKEFPYNGLAKELG  91



>ref|XP_002968302.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
 ref|XP_002976075.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ22980.1| hypothetical protein SELMODRAFT_443026 [Selaginella moellendorffii]
 gb|EFJ30556.1| hypothetical protein SELMODRAFT_409541 [Selaginella moellendorffii]
Length=136

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 57/119 (48%), Gaps = 11/119 (9%)
 Frame = +3

Query  120  MAGR--LSQAAAHIMGG--RGVVARSVASSLRTRAG-MGLPVGKHIVPDKPLPVNDELMW  284
            MAG   L+ AA +      R    R   S++RTR+G  GLP+        P+P   EL W
Sbjct  1    MAGSSGLATAAKYFSSAMRRNAAIRQPLSAMRTRSGGWGLPLPPEEEVSAPVPEEYELWW  60

Query  285  DNGTPFPEPCIDRIADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYPY  461
                      +D     + K+EAL   C GL FFA LG++A +  K SK P+  + +P+
Sbjct  61   GGER------VDEDPTDIDKWEALGMCCAGLSFFAILGVLAHYRAKYSKRPYPLREFPW  113



>ref|XP_001700273.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO98240.1| predicted protein [Chlamydomonas reinhardtii]
Length=149

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 6/106 (6%)
 Frame = +3

Query  156  MGGRGVVARSVASSLRTRAGMGLPVGKHIVPDKPLPVNDELMWDNGTPFPEPCIDRI---  326
            + G    A    ++L  +AG G PV     PDKPLP   EL WDNG    +P  D +   
Sbjct  6    LRGLARSALQAKNALPAKAGAGAPVKLAPRPDKPLPTWYELWWDNGYYPGQPAADFMFGA  65

Query  327  --ADTVGKYEALAWMCGGLGFFASLGLMAVWNDKASKIPFTPKVYP  458
               +    Y    W   GL   A    +A + D+ +++P  P+ YP
Sbjct  66   WPGNMTETYYLRFWSVFGLALAAPFYYVANFTDE-TRMPMVPQQYP  110



>ref|XP_008908747.1| hypothetical protein PPTG_14011 [Phytophthora parasitica INRA-310]
 gb|ETN06245.1| hypothetical protein PPTG_14011 [Phytophthora parasitica INRA-310]
Length=133

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = +3

Query  135  SQAAAHIMGGRGVVARSVASSLRTRAGMGL-----PVGKHIVPDKPLPVNDELMWDNGTP  299
            S+  +H + G G+ A     +L TR G        P  +   P +PL    EL+W++G  
Sbjct  3    SRTLSHALRG-GLSANVRRQALATRGGHAHRPPPPPFARIKTPAQPLHEEAELVWNDGV-  60

Query  300  FPEPCIDRIADTVGKYEAL-AWMCGGLGFFASLGLMAVWN  416
             PE  ID  A  + KY+AL  W+CG  GF   +G++ ++N
Sbjct  61   APETLIDFDAPHIPKYQALRHWLCGLGGFVTLMGVVTLYN  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960