BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031H09

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO46793.1|  hypothetical protein CISIN_1g012238mg                   165   9e-46   Citrus sinensis [apfelsine]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             166   4e-45   Citrus clementina [clementine]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   165   6e-45   Citrus sinensis [apfelsine]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    164   1e-44   Nicotiana sylvestris
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    159   7e-43   Nicotiana tomentosiformis
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        157   6e-42   
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    157   7e-42   Populus euphratica
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    157   8e-42   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        156   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006495466.1|  PREDICTED: aspartate aminotransferase, chlor...    145   6e-41   Citrus sinensis [apfelsine]
gb|AFP86894.1|  aspartate aminotransferase                              152   9e-41   Ilex paraguariensis [Brazilian-tea]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     154   1e-40   Solanum tuberosum [potatoes]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    154   1e-40   Solanum lycopersicum
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    152   4e-40   Populus euphratica
ref|XP_010089944.1|  Aspartate aminotransferase                         151   9e-40   
gb|ABN48559.1|  chloroplast aspartate aminotransferase                  142   1e-39   Brassica juncea [brown mustard]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    148   9e-39   Fragaria vesca subsp. vesca
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             147   2e-38   Prunus persica
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   146   4e-38   Citrus sinensis [apfelsine]
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    147   4e-38   Malus domestica [apple tree]
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    146   6e-38   Vitis vinifera
gb|KJB55010.1|  hypothetical protein B456_009G060500                    144   6e-38   Gossypium raimondii
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    146   7e-38   Eucalyptus grandis [rose gum]
emb|CAN76227.1|  hypothetical protein VITISV_000267                     146   7e-38   Vitis vinifera
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  145   9e-38   Canavalia lineata
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    145   9e-38   Prunus mume [ume]
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    145   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002515455.1|  aspartate aminotransferase, putative               145   1e-37   Ricinus communis
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    145   1e-37   Cicer arietinum [garbanzo]
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    145   2e-37   Nelumbo nucifera [Indian lotus]
gb|KJB55006.1|  hypothetical protein B456_009G060500                    144   3e-37   Gossypium raimondii
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    144   4e-37   Gossypium arboreum [tree cotton]
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    144   4e-37   Lupinus angustifolius
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         144   4e-37   Jatropha curcas
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    143   5e-37   
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    144   5e-37   Elaeis guineensis
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     144   5e-37   Eucalyptus grandis [rose gum]
emb|CAA04697.1|  aspartate aminotransferase 2                           143   6e-37   Canavalia lineata
gb|AAB46611.1|  aspartate aminotransferase                              143   8e-37   Medicago sativa [alfalfa]
ref|XP_007011759.1|  Aspartate aminotransferase                         142   1e-36   
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    142   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    142   2e-36   Cucumis melo [Oriental melon]
prf||2009357A  Asp aminotransferase                                     142   2e-36
gb|KEH39860.1|  aspartate aminotransferase                              142   2e-36   Medicago truncatula
prf||1908424A  Asp aminotransferase                                     142   2e-36
gb|KHG09550.1|  Aspartate aminotransferase, chloroplastic -like p...    140   2e-36   Gossypium arboreum [tree cotton]
emb|CDY13467.1|  BnaA03g51850D                                          142   2e-36   Brassica napus [oilseed rape]
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    142   2e-36   Brassica rapa
emb|CDX72339.1|  BnaC07g43610D                                          142   2e-36   
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    141   3e-36   Cucumis sativus [cucumbers]
emb|CDP18792.1|  unnamed protein product                                142   4e-36   Coffea canephora [robusta coffee]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             141   4e-36   Capsella rubella
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             141   5e-36   
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          141   5e-36   Amborella trichopoda
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    141   5e-36   Camelina sativa [gold-of-pleasure]
gb|KJB55007.1|  hypothetical protein B456_009G060500                    141   5e-36   Gossypium raimondii
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    141   5e-36   Brassica rapa
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    140   6e-36   Camelina sativa [gold-of-pleasure]
emb|CDX75211.1|  BnaA01g04910D                                          140   6e-36   
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    140   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             140   1e-35   
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    139   2e-35   Phoenix dactylifera
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             139   2e-35   
gb|KJB55009.1|  hypothetical protein B456_009G060500                    139   2e-35   Gossypium raimondii
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    138   3e-35   
gb|ACR34530.1|  unknown                                                 139   4e-35   Zea mays [maize]
ref|NP_001149005.1|  aspartate aminotransferase                         139   4e-35   
emb|CAA56932.1|  aspartate aminotransferase                             138   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAC12674.1|  aspartate aminotransferase                              138   5e-35   Lotus corniculatus
gb|AAM67272.1|  aspartate aminotransferase                              138   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                            138   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031767.1|  aspartate aminotransferase                         138   5e-35   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   138   6e-35   Panicum miliaceum [broom millet]
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    138   7e-35   Phaseolus vulgaris [French bean]
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    137   8e-35   
emb|CDJ26231.1|  putative aspartate aminotransferase                    137   1e-34   Brassica oleracea
emb|CDX68807.1|  BnaC01g06460D                                          137   1e-34   
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    136   1e-34   Cucumis melo [Oriental melon]
gb|EPS60991.1|  aspartate aminotransferase                              131   2e-34   Genlisea aurea
ref|NP_001048397.1|  Os02g0797500                                       136   2e-34   
gb|KJB65890.1|  hypothetical protein B456_010G117400                    136   3e-34   Gossypium raimondii
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    135   6e-34   Brachypodium distachyon [annual false brome]
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    135   7e-34   Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                         135   7e-34   
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    135   8e-34   Glycine max [soybeans]
gb|ACU24502.1|  unknown                                                 135   8e-34   Glycine max [soybeans]
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            135   9e-34   Glycine soja [wild soybean]
gb|ACN40845.1|  unknown                                                 134   1e-33   Picea sitchensis
gb|ABK24563.1|  unknown                                                 134   1e-33   Picea sitchensis
gb|AAO23563.1|  aspartate aminotransferase                              134   2e-33   Oryza sativa [red rice]
gb|ABR16448.1|  unknown                                                 133   2e-33   Picea sitchensis
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    134   2e-33   Setaria italica
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    133   2e-33   
gb|KJB65891.1|  hypothetical protein B456_010G117400                    133   2e-33   Gossypium raimondii
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    133   2e-33   Glycine max [soybeans]
dbj|BAJ92741.1|  predicted protein                                      133   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96638.1|  predicted protein                                      133   4e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001190885.1|  aspartate aminotransferase                         131   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             129   7e-32   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             129   8e-32   
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               128   2e-31   
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               127   3e-31   Triticum urartu
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                127   4e-31   Erythranthe guttata [common monkey flower]
ref|XP_008378725.1|  PREDICTED: aspartate aminotransferase P2, mi...    120   8e-31   Malus domestica [apple tree]
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                125   1e-30   Erythranthe guttata [common monkey flower]
emb|CAN64661.1|  hypothetical protein VITISV_034785                     117   9e-28   Vitis vinifera
ref|XP_001785888.1|  predicted protein                                  114   3e-26   
gb|KJB55008.1|  hypothetical protein B456_009G060500                    108   9e-25   Gossypium raimondii
ref|XP_005642879.1|  aspartate aminotransferase                         106   1e-23   Coccomyxa subellipsoidea C-169
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             103   8e-23   Chlorella variabilis
ref|XP_001700039.1|  aspartate aminotransferase                         100   2e-21   Chlamydomonas reinhardtii
ref|XP_002950644.1|  aspartate aminotransferase                       96.3    4e-20   Volvox carteri f. nagariensis
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...  93.2    8e-19   Phoenix dactylifera
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...  93.2    9e-19   
ref|XP_010878037.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    2e-18   Esox lucius
ref|XP_003064597.1|  aspartate amino transferase                      91.7    2e-18   Micromonas pusilla CCMP1545
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115           90.9    4e-18   Trametes versicolor FP-101664 SS1
gb|ACI34022.1|  Aspartate aminotransferase, mitochondrial precursor   90.5    6e-18   Salmo salar
ref|XP_004067248.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.1    7e-18   Oryzias latipes [Japanese rice fish]
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                 90.1    7e-18   Jaapia argillacea MUCL 33604
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                 89.4    1e-17   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_005814426.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.4    2e-17   Xiphophorus maculatus
ref|XP_008292179.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.0    2e-17   Stegastes partitus
ref|XP_007359882.1|  PLP-dependent transferase                        89.0    2e-17   Dichomitus squalens LYAD-421 SS1
ref|XP_003970037.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.0    2e-17   Takifugu rubripes [tiger puffer]
ref|XP_007549969.1|  PREDICTED: aspartate aminotransferase, mitoc...  88.6    2e-17   Poecilia formosa
ref|XP_003442303.1|  PREDICTED: aspartate aminotransferase, mitoc...  88.6    2e-17   Oreochromis niloticus
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15             88.6    3e-17   Trametes cinnabarina
ref|XP_004543093.1|  PREDICTED: aspartate aminotransferase, mitoc...  88.6    3e-17   Maylandia zebra
ref|XP_006780104.1|  PREDICTED: aspartate aminotransferase, mitoc...  88.6    3e-17   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010739613.1|  PREDICTED: aspartate aminotransferase, mitoc...  88.2    3e-17   Larimichthys crocea [croceine croaker]
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                 87.8    5e-17   Gymnopus luxurians FD-317 M1
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial     87.0    6e-17   Auxenochlorella protothecoides
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                 87.0    7e-17   Fistulina hepatica ATCC 64428
ref|XP_002501168.1|  aspartate aminotransferase                       87.0    7e-17   Micromonas commoda
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475           87.4    7e-17   
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371               87.0    8e-17   Scleroderma citrinum Foug A
ref|XP_001828762.2|  aspartate Aminotransferase                       87.0    9e-17   Coprinopsis cinerea okayama7#130
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...  86.7    1e-16   
ref|XP_008401656.1|  PREDICTED: aspartate aminotransferase, mitoc...  87.0    1e-16   Poecilia reticulata
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517               86.7    1e-16   Pleurotus ostreatus PC15
gb|KIM85250.1|  hypothetical protein PILCRDRAFT_5589                  86.3    2e-16   Piloderma croceum F 1598
ref|XP_007762781.1|  hypothetical protein CONPUDRAFT_78940            85.9    2e-16   Coniophora puteana RWD-64-598 SS2
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                 85.9    2e-16   Plicaturopsis crispa FD-325 SS-3
dbj|BAK02685.1|  predicted protein                                    85.9    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                  85.9    2e-16   Sphaerobolus stellatus SS14
ref|XP_005152326.1|  PREDICTED: aspartate aminotransferase, mitoc...  85.9    2e-16   Melopsittacus undulatus
gb|KFP90495.1|  hypothetical protein N311_04899                       85.1    4e-16   Apaloderma vittatum
gb|KFO71408.1|  hypothetical protein N303_10396                       84.7    4e-16   Cuculus canorus
ref|NP_956283.1|  aspartate aminotransferase 2                        85.1    4e-16   Danio rerio [leopard danio]
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242            85.1    5e-16   Gloeophyllum trabeum ATCC 11539
ref|XP_010582297.1|  PREDICTED: aspartate aminotransferase, mitoc...  84.7    5e-16   Haliaeetus leucocephalus
ref|XP_002388829.1|  hypothetical protein MPER_12110                  79.7    6e-16   
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644           84.7    6e-16   Serpula lacrymans var. lacrymans S7.9
ref|XP_008308463.1|  PREDICTED: aspartate aminotransferase, mitoc...  84.7    7e-16   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CEG81320.1|  Putative Aspartate aminotransferase                  80.1    7e-16   Rhizopus microsporus
gb|KIK28496.1|  hypothetical protein PISMIDRAFT_673506                84.3    8e-16   Pisolithus microcarpus 441
gb|KFV95661.1|  hypothetical protein N327_00168                       82.8    9e-16   Fulmarus glacialis
ref|XP_006863643.1|  PREDICTED: aspartate aminotransferase, mitoc...  84.0    1e-15   Chrysochloris asiatica
ref|XP_002680594.1|  aspartate aminotransferase                       84.3    1e-15   Naegleria gruberi strain NEG-M
emb|CCX32042.1|  Similar to Aspartate aminotransferase, mitochond...  84.0    1e-15   Pyronema omphalodes CBS 100304
emb|CCO28282.1|  aspartate aminotransferase                           81.3    1e-15   Rhizoctonia solani AG-1 IB
gb|KFQ35253.1|  hypothetical protein N331_07571                       83.6    1e-15   Merops nubicus
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                83.6    1e-15   Paxillus rubicundulus Ve08.2h10
gb|KFO04448.1|  hypothetical protein N312_06091                       83.6    1e-15   Balearica regulorum gibbericeps
ref|XP_007390433.1|  hypothetical protein PHACADRAFT_134034           83.6    1e-15   Phanerochaete carnosa HHB-10118-sp
gb|KFP71016.1|  hypothetical protein N310_05849                       83.6    1e-15   Acanthisitta chloris
gb|KFQ42654.1|  hypothetical protein N333_09691                       83.6    1e-15   Nestor notabilis
gb|KFO92044.1|  hypothetical protein N320_04667                       83.6    1e-15   Buceros rhinoceros silvestris
gb|KFP55374.1|  hypothetical protein N322_09365                       83.6    1e-15   Cariama cristata
gb|KFP19653.1|  hypothetical protein Z169_06078                       83.6    1e-15   Egretta garzetta
gb|KGL91867.1|  hypothetical protein N301_16701                       83.6    1e-15   Charadrius vociferus
gb|KFO97280.1|  hypothetical protein N300_07039                       83.2    1e-15   Calypte anna
gb|KFQ16652.1|  hypothetical protein N330_09915                       83.2    1e-15   Leptosomus discolor
gb|KFM02723.1|  hypothetical protein AS27_01862                       83.2    1e-15   Aptenodytes forsteri
gb|KFQ68668.1|  hypothetical protein N335_07592                       83.2    2e-15   Phaethon lepturus
gb|KFQ73258.1|  hypothetical protein N337_00339                       83.2    2e-15   Phoenicopterus ruber ruber
gb|KFZ50221.1|  hypothetical protein N321_06413                       83.2    2e-15   Antrostomus carolinensis
gb|KFW71608.1|  hypothetical protein AS28_11098                       83.2    2e-15   Pygoscelis adeliae
gb|KFV53116.1|  hypothetical protein N328_06671                       83.2    2e-15   Gavia stellata
gb|KFR02997.1|  hypothetical protein Y956_09274                       83.2    2e-15   Nipponia nippon
gb|KFV00678.1|  hypothetical protein N340_11396                       83.2    2e-15   Tauraco erythrolophus
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                 83.6    2e-15   Hebeloma cylindrosporum h7
emb|CEP19900.1|  hypothetical protein                                 83.6    2e-15   Parasitella parasitica
ref|XP_001176672.2|  PREDICTED: aspartate aminotransferase, mitoc...  83.6    2e-15   
ref|XP_001520484.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    2e-15   
emb|CDQ61923.1|  unnamed protein product                              78.6    2e-15   Oncorhynchus mykiss
gb|KFQ63469.1|  hypothetical protein N334_09493                       83.2    2e-15   Pelecanus crispus
pdb|1AKA|A  Chain A, Structural Basis For The Catalytic Activity ...  82.8    2e-15   Gallus gallus [bantam]
pdb|7AAT|A  Chain A, X-Ray Structure Refinement And Comparison Of...  82.8    2e-15   Gallus gallus [bantam]
gb|KIJ21699.1|  aspartate transaminase                                83.2    2e-15   Paxillus involutus ATCC 200175
gb|EJT99836.1|  aspartate aminotransferase                            83.2    2e-15   Dacryopinax primogenitus
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828           83.2    2e-15   Heterobasidion irregulare TC 32-1
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                83.2    2e-15   Hydnomerulius pinastri MD-312
gb|KFP56730.1|  hypothetical protein N323_06988                       82.8    2e-15   Cathartes aura
gb|KFW90670.1|  hypothetical protein N336_10326                       82.8    3e-15   Phalacrocorax carbo [common cormorant]
gb|KFP38914.1|  hypothetical protein N324_09434                       82.8    3e-15   Chlamydotis macqueenii
gb|EOA96948.1|  Aspartate aminotransferase, mitochondrial             82.8    3e-15   Anas platyrhynchos [duck]
gb|KFV92257.1|  hypothetical protein N326_05957                       82.8    3e-15   Eurypyga helias
ref|XP_002954714.1|  aspartate aminotransferase                       82.8    3e-15   Volvox carteri f. nagariensis
ref|XP_001731601.1|  hypothetical protein MGL_0869                    82.8    3e-15   Malassezia globosa CBS 7966
gb|EPB81442.1|  aspartate aminotransferase                            82.8    3e-15   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  82.4    3e-15   Apaloderma vittatum
ref|XP_009569498.1|  PREDICTED: aspartate aminotransferase, mitoc...  82.4    3e-15   Cuculus canorus
gb|AEI84600.1|  mitochondrial aspartate transaminase                  82.4    3e-15   Tigriopus californicus [tidepool copepod]
gb|AEI84595.1|  mitochondrial aspartate transaminase                  82.4    3e-15   Tigriopus californicus [tidepool copepod]
gb|AEI84591.1|  mitochondrial aspartate transaminase                  82.0    3e-15   Tigriopus californicus [tidepool copepod]
gb|AEI84602.1|  mitochondrial aspartate transaminase                  82.0    3e-15   Tigriopus californicus [tidepool copepod]
gb|AEI84598.1|  mitochondrial aspartate transaminase                  82.0    3e-15   Tigriopus californicus [tidepool copepod]
gb|AEI84593.1|  mitochondrial aspartate transaminase                  82.0    3e-15   Tigriopus californicus [tidepool copepod]
ref|XP_001744723.1|  hypothetical protein                             82.4    3e-15   Monosiga brevicollis MX1
emb|CDI81837.1|  aspartate aminotransferase, putative                 80.1    4e-15   Eimeria acervulina
gb|KFV01058.1|  hypothetical protein N339_06116                       82.0    4e-15   Pterocles gutturalis
dbj|GAN02936.1|  aspartate aminotransferase                           82.4    5e-15   Mucor ambiguus
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821            82.4    5e-15   Stereum hirsutum FP-91666 SS1
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952               82.0    5e-15   Fomitopsis pinicola FP-58527 SS1
ref|XP_005490808.1|  PREDICTED: aspartate aminotransferase, mitoc...  82.0    5e-15   
gb|KFO63074.1|  hypothetical protein N302_07001                       82.0    5e-15   Corvus brachyrhynchos
gb|KFV54532.1|  hypothetical protein N341_00606                       82.0    5e-15   Tyto alba [Schleiereule]
ref|XP_008175935.1|  PREDICTED: aspartate aminotransferase, mitoc...  82.0    5e-15   Chrysemys picta bellii
gb|KFV73576.1|  hypothetical protein N308_13552                       81.6    5e-15   Struthio camelus australis
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...  82.0    6e-15   Ciona intestinalis [sea vase]
gb|KFU92658.1|  hypothetical protein M959_01402                       81.6    6e-15   Chaetura pelagica
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                 82.0    6e-15   Pisolithus tinctorius Marx 270
ref|XP_009583475.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.5    6e-15   Fulmarus glacialis
dbj|GAA98712.1|  hypothetical protein E5Q_05400                       82.0    6e-15   Mixia osmundae IAM 14324
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...  81.6    7e-15   
gb|AID18683.1|  aspartate aminotransferase                            81.6    7e-15   Penaeus chinensis [fleshy prawn]
gb|KGL84885.1|  hypothetical protein N309_05764                       81.3    7e-15   Tinamus guttatus
gb|ACN40894.1|  unknown                                               82.0    8e-15   Picea sitchensis
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                 81.6    8e-15   Amanita muscaria Koide BX008
ref|XP_007852807.1|  aspartate aminotransferase                       81.6    8e-15   
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                 81.6    8e-15   Suillus luteus UH-Slu-Lm8-n1
emb|CCM01943.1|  predicted protein                                    81.3    8e-15   Fibroporia radiculosa
gb|ABR16105.1|  unknown                                               81.3    9e-15   Picea sitchensis
ref|XP_008944416.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    9e-15   Merops nubicus
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                 81.3    1e-14   Hypholoma sublateritium FD-334 SS-4
gb|KIR44346.1|  aspartate aminotransferase                            81.3    1e-14   Cryptococcus gattii CA1280
ref|XP_006109334.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    1e-14   
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Buceros rhinoceros silvestris
ref|XP_005229254.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   
ref|XP_009641563.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Egretta garzetta
ref|XP_009078129.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Acanthisitta chloris
gb|AFR98265.1|  aspartate aminotransferase                            81.3    1e-14   Cryptococcus neoformans var. grubii H99
ref|XP_009697580.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Cariama cristata
ref|XP_772230.1|  hypothetical protein CNBM0360                       81.3    1e-14   Cryptococcus neoformans var. neoformans B-3501A
ref|XP_007256293.1|  PREDICTED: aspartate aminotransferase, mitoc...  81.3    1e-14   Astyanax mexicanus [blind cave fish]
ref|XP_010298153.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Balearica regulorum gibbericeps
ref|XP_010013669.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Nestor notabilis
ref|XP_009881551.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Charadrius vociferus
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...  81.3    1e-14   Lepisosteus oculatus
ref|XP_008503619.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Calypte anna
ref|XP_010164289.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Antrostomus carolinensis
gb|EDL87267.1|  rCG39016, isoform CRA_b                               79.0    1e-14   Rattus norvegicus [brown rat]
ref|XP_010780845.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.3    1e-14   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003209725.2|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   
ref|XP_009958443.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Leptosomus discolor
ref|XP_009328640.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Pygoscelis adeliae
ref|XP_010292847.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Phaethon lepturus
ref|XP_009809693.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Gavia stellata
ref|XP_003227907.1|  PREDICTED: aspartate aminotransferase, mitoc...  81.3    1e-14   Anolis carolinensis [Carolina anole]
ref|XP_009980094.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Tauraco erythrolophus
ref|XP_009924468.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Haliaeetus albicilla
ref|XP_009468749.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Nipponia nippon
ref|XP_009289063.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   
ref|XP_005025720.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                 80.9    1e-14   Tulasnella calospora MUT 4182
emb|CEG72748.1|  Putative Aspartate aminotransferase                  80.9    1e-14   Rhizopus microsporus
ref|XP_568366.1|  aspartate transaminase                              80.9    1e-14   Cryptococcus neoformans var. neoformans JEC21
emb|CEL53865.1|  aspartate aminotransferase                           80.9    1e-14   Rhizoctonia solani AG-1 IB
ref|NP_001016933.1|  aspartate aminotransferase, mitochondrial pr...  80.9    1e-14   Xenopus tropicalis [western clawed frog]
gb|ADO27746.1|  mitochondrial aspartate aminotransferase              80.9    1e-14   Ictalurus furcatus
emb|CEI89409.1|  Putative Aspartate aminotransferase                  80.9    1e-14   Rhizopus microsporus
gb|KIR97164.1|  aspartate aminotransferase                            80.9    1e-14   Cryptococcus gattii VGII 2001/935-1
gb|KGB78925.1|  aspartate transaminase                                80.9    1e-14   Cryptococcus gattii VGII R265
ref|XP_009088934.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Serinus canaria [canary]
ref|XP_005526350.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.9    1e-14   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005643912.1|  aspartate aminotransferase                       80.9    1e-14   Coccomyxa subellipsoidea C-169
dbj|BAC56407.1|  similar to aspartate aminotransferase                78.2    1e-14   
dbj|BAC56411.1|  similar to aspartate aminotransferase                77.4    1e-14   
gb|KIR50768.1|  aspartate aminotransferase                            80.5    1e-14   
gb|AEB54629.1|  aspartate aminotransferase                            79.0    1e-14   
gb|KDR85045.1|  hypothetical protein GALMADRAFT_218131                80.9    1e-14   
gb|KIR78943.1|  aspartate aminotransferase                            80.5    2e-14   
ref|XP_003197192.1|  aspartate transaminase                           80.5    2e-14   
ref|XP_008562779.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    2e-14   
gb|KIR82897.1|  aspartate aminotransferase                            80.5    2e-14   
ref|XP_009485645.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.5    2e-14   
dbj|BAG63601.1|  unnamed protein product                              78.2    2e-14   
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                  80.5    2e-14   
emb|CDS12997.1|  Putative Aspartate aminotransferase                  80.5    2e-14   
ref|XP_010127976.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.1    2e-14   
ref|XP_010147321.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.1    2e-14   
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                 80.5    2e-14   
gb|EMP28841.1|  Aspartate aminotransferase                            80.1    2e-14   
ref|XP_009502368.1|  PREDICTED: aspartate aminotransferase, mitoc...  80.1    2e-14   
prf||0308236A  aminotransferase,Asp                                   80.1    2e-14
dbj|GAC99339.1|  potential aspartate aminotransferase                 80.5    2e-14   
ref|XP_002409595.1|  GOT2 aspartate aminotransferase, putative        80.1    2e-14   
ref|XP_003282681.2|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    2e-14   
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635            80.1    2e-14   
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1           80.1    2e-14   
gb|ACI33023.1|  Aspartate aminotransferase, mitochondrial precursor   80.1    2e-14   
ref|NP_001080255.1|  aspartate aminotransferase 2                     80.1    3e-14   
gb|AIT70228.1|  aspartate aminotransferase                            79.7    3e-14   
ref|XP_008483701.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    3e-14   
emb|CDQ57967.1|  unnamed protein product                              80.1    3e-14   
gb|ACI33481.1|  Aspartate aminotransferase, mitochondrial precursor   80.1    3e-14   
emb|CDQ68161.1|  unnamed protein product                              80.1    3e-14   
gb|AIT70209.1|  aspartate aminotransferase                            80.1    3e-14   
ref|XP_005318543.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    3e-14   
ref|XP_005098987.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    3e-14   
ref|XP_010080711.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    3e-14   
gb|EFB22248.1|  hypothetical protein PANDA_000063                     79.7    3e-14   
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640        80.1    3e-14   
ref|XP_008636972.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    3e-14   
gb|KIY72818.1|  hypothetical protein CYLTODRAFT_417594                79.7    3e-14   
ref|XP_010394985.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    3e-14   
ref|XP_007112903.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    4e-14   
prf||1003180A  aminotransferase,Asp                                   79.3    4e-14
ref|XP_005422803.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_009967572.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_006148520.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    4e-14   
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_008138091.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    4e-14   
ref|NP_001187511.1|  mitochondrial aspartate aminotransferase         79.7    4e-14   
ref|XP_007468385.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    4e-14   
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.7    4e-14   
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521            79.3    4e-14   
ref|XP_006454385.1|  glutamic oxaloacetic transaminase AAT1           79.7    4e-14   
ref|XP_009999988.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_005052542.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
pdb|3PD6|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...  79.3    4e-14   
pdb|3HLM|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...  79.3    4e-14   
gb|EMS22273.1|  L-aspartate:2-oxoglutarate aminotransferase           79.3    4e-14   
emb|CDI51517.1|  probable aspartate aminotransferase, mitochondri...  79.3    4e-14   
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    4e-14   
ref|XP_007407231.1|  hypothetical protein MELLADRAFT_42605            79.3    5e-14   
ref|XP_004583963.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    5e-14   
ref|XP_006020296.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    5e-14   
ref|XP_005873554.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    5e-14   
ref|XP_010224070.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    5e-14   
ref|XP_006099282.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    5e-14   
gb|EJT48226.1|  aspartate transaminase                                79.0    5e-14   
dbj|BAM85839.1|  mitochondrial aspartate aminotransferase 2           79.0    6e-14   
ref|XP_007090444.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.3    6e-14   
emb|CCU98142.1|  unnamed protein product                              79.0    6e-14   
ref|XP_007477592.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    6e-14   
ref|XP_004881984.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    6e-14   
prf||0410468A  aminotransferase,Asp                                   79.0    6e-14
gb|EPQ12242.1|  Aspartate aminotransferase, mitochondrial             79.0    6e-14   
gb|ERE79836.1|  putative sodium-coupled neutral amino acid transp...  80.1    6e-14   
gb|EST06526.1|  aspartate aminotransferase                            79.0    6e-14   
ref|XP_005692154.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    6e-14   
ref|XP_007882640.1|  PREDICTED: aspartate aminotransferase, mitoc...  79.0    6e-14   
ref|XP_005843806.1|  hypothetical protein CHLNCDRAFT_59799            79.0    6e-14   
gb|EIE83310.1|  aspartate aminotransferase                            79.0    7e-14   
ref|XP_007879119.1|  hypothetical protein PFL1_03411                  79.0    7e-14   
gb|AIT70230.1|  aspartate aminotransferase                            78.6    7e-14   
emb|CCF47934.1|  probable aspartate aminotransferase, mitochondri...  79.0    7e-14   
ref|XP_006817148.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    8e-14   
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...  79.0    8e-14   
ref|XP_011386419.1|  putative aspartate aminotransferase              78.6    8e-14   
ref|XP_010890986.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    9e-14   
ref|XP_001968339.1|  GG24563                                          78.6    9e-14   
ref|XP_002087596.1|  GE15280                                          78.6    9e-14   
ref|XP_004690563.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    9e-14   
emb|CDH50946.1|  aspartate aminotransferase                           78.6    9e-14   
ref|XP_006110233.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    9e-14   
ref|NP_990854.1|  aspartate aminotransferase, mitochondrial precu...  78.6    9e-14   
ref|XP_008067406.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    9e-14   
gb|AIT70234.1|  aspartate aminotransferase                            78.6    9e-14   
gb|KDN53315.1|  hypothetical protein K437DRAFT_292488                 78.6    9e-14   
ref|XP_006863642.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    1e-13   
ref|XP_002912325.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.6    1e-13   
gb|KHJ91721.1|  hypothetical protein OESDEN_08403                     74.3    1e-13   
ref|XP_006732870.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|KHJ75069.1|  hypothetical protein OESDEN_25315                     74.7    1e-13   
gb|AIT70223.1|  aspartate aminotransferase                            78.2    1e-13   
ref|XP_004431730.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_010376502.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_008700791.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial        78.2    1e-13   
sp|P08907.1|AATM_HORSE  RecName: Full=Aspartate aminotransferase,...  78.2    1e-13   
ref|XP_002761002.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|NP_777231.1|  aspartate aminotransferase, mitochondrial           78.2    1e-13   
ref|XP_004524663.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_007112902.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_005899976.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|EPX74222.1|  aspartate aminotransferase                            78.2    1e-13   
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|EGU12946.1|  Aspartate aminotransferase                            79.3    1e-13   
ref|XP_010329683.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_010860133.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|EHH31721.1|  Aspartate aminotransferase, mitochondrial             78.2    1e-13   
dbj|BAE87538.1|  unnamed protein product                              78.2    1e-13   
ref|XP_004524661.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_004015091.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...  78.2    1e-13   
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_005981403.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|KHJ48996.1|  hypothetical protein D918_00114                       78.2    1e-13   
ref|NP_001270119.1|  aspartate aminotransferase, mitochondrial        78.2    1e-13   
ref|XP_010594999.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  78.2    1e-13   
ref|NP_999093.1|  aspartate aminotransferase, mitochondrial precu...  78.2    1e-13   
ref|NP_034455.1|  aspartate aminotransferase, mitochondrial           78.2    1e-13   
gb|AAA37265.1|  mitochondrial aspartate aminotransferase              78.2    1e-13   
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|XP_001103601.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|ELW66217.1|  Putative sodium-coupled neutral amino acid transp...  79.3    1e-13   
gb|AAB91426.1|  aspartate aminotransferase precursor                  78.2    1e-13   
emb|CAH92240.1|  hypothetical protein                                 78.2    1e-13   
ref|NP_001124888.1|  aspartate aminotransferase, mitochondrial        78.2    1e-13   
gb|AAH00525.1|  Glutamic-oxaloacetic transaminase 2, mitochondria...  78.2    1e-13   
ref|XP_523381.2|  PREDICTED: aspartate aminotransferase, mitochon...  78.2    1e-13   
ref|XP_003823746.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|KHN79736.1|  Aspartate aminotransferase, mitochondrial             78.2    1e-13   
ref|XP_005078702.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|EHH60442.1|  Aspartate aminotransferase, mitochondrial             78.2    1e-13   
ref|XP_003743821.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
gb|KEP52891.1|  aspartate aminotransferase                            78.2    1e-13   
ref|XP_004057786.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
ref|NP_002071.2|  aspartate aminotransferase, mitochondrial isofo...  78.2    1e-13   
ref|XP_003792641.1|  PREDICTED: aspartate aminotransferase, mitoc...  78.2    1e-13   
dbj|BAD96991.1|  aspartate aminotransferase 2 precursor variant       78.2    1e-13   
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.8    1e-13   
ref|XP_007067232.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.8    1e-13   
gb|AIT70211.1|  aspartate aminotransferase                            77.8    2e-13   
ref|NP_037309.1|  aspartate aminotransferase, mitochondrial           77.8    2e-13   
ref|NP_998544.1|  aspartate aminotransferase 2a                       77.8    2e-13   
gb|KHN72652.1|  Aspartate aminotransferase, mitochondrial             77.8    2e-13   
ref|XP_006052520.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.8    2e-13   
gb|EPY74624.1|  Aspartate aminotransferase, mitochondrial precurs...  77.8    2e-13   
ref|XP_005504845.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    2e-13   
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...  77.8    2e-13   
gb|AEE61384.1|  unknown                                               77.4    2e-13   
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...  77.4    2e-13   
gb|AGC92244.1|  putative aspartate aminotransferase isoform 2         77.0    2e-13   
dbj|BAF83536.1|  unnamed protein product                              77.4    2e-13   
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1           77.4    2e-13   
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    2e-13   
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873           77.4    2e-13   
ref|XP_009249048.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.0    2e-13   
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                 77.4    2e-13   
ref|XP_011354974.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    2e-13   
gb|AIT70243.1|  aspartate aminotransferase                            77.4    2e-13   
ref|NP_001040337.1|  aspartate aminotransferase                       77.4    2e-13   
ref|XP_004350746.1|  aspartate aminotransferase                       77.0    2e-13   
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    2e-13   
ref|XP_004371581.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.4    3e-13   
ref|XP_011187384.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.0    3e-13   
ref|XP_002067099.1|  GK24813                                          77.0    3e-13   
gb|ELK38479.1|  Aspartate aminotransferase, mitochondrial             77.0    3e-13   
gb|ACO10550.1|  Aspartate aminotransferase, mitochondrial precursor   77.0    3e-13   
emb|CBQ68007.1|  probable aspartate aminotransferase, mitochondri...  77.0    3e-13   
ref|XP_004663500.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.0    3e-13   
ref|XP_318743.3|  AGAP009685-PA                                       77.0    3e-13   
gb|AIT70208.1|  aspartate aminotransferase                            76.6    3e-13   
gb|ERG84385.1|  aspartate                                             76.6    3e-13   
ref|XP_005388565.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.0    3e-13   
ref|XP_010615470.1|  PREDICTED: aspartate aminotransferase, mitoc...  77.0    4e-13   
ref|XP_011187383.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    4e-13   
ref|XP_008832465.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    4e-13   
ref|XP_009058471.1|  hypothetical protein LOTGIDRAFT_217673           76.6    4e-13   
ref|XP_001495474.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    4e-13   
ref|XP_007438961.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    4e-13   
gb|AIT70204.1|  aspartate aminotransferase                            76.3    4e-13   
gb|EUC63953.1|  aspartate aminotransferase                            76.6    4e-13   
gb|KFH62511.1|  aspartate aminotransferase                            76.6    4e-13   
ref|XP_008175936.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.3    4e-13   
ref|XP_002041752.1|  GM16578                                          77.8    4e-13   
ref|XP_006214550.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    5e-13   
ref|XP_002077805.1|  GD22881                                          76.6    5e-13   
gb|KFM62857.1|  Aspartate aminotransferase, mitochondrial             73.6    5e-13   
ref|XP_001771002.1|  predicted protein                                76.3    5e-13   
emb|CDH49583.1|  aspartate aminotransferase                           76.3    5e-13   
ref|XP_010983999.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.6    5e-13   
ref|XP_010965547.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.3    5e-13   
dbj|GAA87425.1|  aspartate aminotransferase                           76.3    5e-13   
ref|XP_006193091.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  76.3    5e-13   
gb|AAP06430.1|  similar to NM_076646 Aspartate aminotransferase i...  74.3    5e-13   
ref|NP_741811.1|  Protein GOT-2.2, isoform b                          74.7    6e-13   
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial             76.3    6e-13   
gb|KGB78963.1|  aspartate aminotransferase                            76.3    6e-13   
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial             76.3    6e-13   
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...  76.3    6e-13   
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial             76.3    6e-13   
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial             76.3    6e-13   
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                76.3    6e-13   
ref|XP_011200779.1|  PREDICTED: aspartate aminotransferase, mitoc...  76.3    6e-13   



>gb|KDO46793.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=363

 Score =   165 bits (418),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  553  EYL  561
            EYL
Sbjct  121  EYL  123



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  553  EYL  561
            EYL
Sbjct  121  EYL  123



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  553  EYL  561
            EYL
Sbjct  121  EYL  123



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 103/126 (82%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  363
            M ST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M   VNVS
Sbjct  1    MVSTMFSLASATPSASFSLQDNLKSKLKLGTTSQSAFFGKDFVKAKSNGRTTMTVAVNVS  60

Query  364  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  543
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERG  120

Query  544  ENKEYL  561
            +NKEYL
Sbjct  121  DNKEYL  126



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  363
            MAST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M  +VNVS
Sbjct  1    MASTMFSLASAAPSASFSLQDNLKSKLKLGTTSQSAFFGKDFAKAKSNGRTTMAVSVNVS  60

Query  364  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  543
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLMLERG  120

Query  544  ENKEYL  561
            +NKEYL
Sbjct  121  DNKEYL  126



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 102/130 (78%), Gaps = 7/130 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  351
            MAST+ +LAS +PS SLS+Q+ LK K +L      TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASTTPSASLSMQEILKGKARLGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VNVSRFEGI+MAPPDPILGVSEAF+ADTD  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADTDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  532  LQRGENKEYL  561
            L+RGENKEYL
Sbjct  121  LERGENKEYL  130



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 101/130 (78%), Gaps = 7/130 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF-------GNATKSHGRMRMVAT  351
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF        N  KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKTRLGSGSVSTLFNKEKGNPSNKKKSFGRISMTVA  60

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  532  LQRGENKEYL  561
            L+RGENKEYL
Sbjct  121  LERGENKEYL  130



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = +1

Query  181  SPITMASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVA  348
            S   MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+GR  M  
Sbjct  4    SSFAMASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGRTTMAV  62

Query  349  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  528
             VNVSRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL
Sbjct  63   AVNVSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENL  122

Query  529  MLQRGENKEYL  561
            +L+RGENKEYL
Sbjct  123  ILERGENKEYL  133



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 103/130 (79%), Gaps = 7/130 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GNAT---KSHGRMRMVAT  351
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF    GN +   KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKMRLGSSSVSTLFNKEKGNPSIKKKSFGRISMTVA  60

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  532  LQRGENKEYL  561
            L+RGENKEYL
Sbjct  121  LERGENKEYL  130



>ref|XP_006495466.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Citrus 
sinensis]
Length=113

 Score =   145 bits (367),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  520  ENLMLQRGENKEYL  561
            ENLML+RGENKEYL
Sbjct  61   ENLMLERGENKEYL  74



>gb|AFP86894.1| aspartate aminotransferase, partial [Ilex paraguariensis]
Length=368

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 84/111 (76%), Gaps = 7/111 (6%)
 Frame = +1

Query  250  QDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVATVNVSRFEGISMAPPDPILG  408
            QD LK K KL      +  G         TK+ GR+ M   V VSRFE I+MAPPDPILG
Sbjct  21   QDTLKTKLKLTSSNHTSFLGKGKSVPFTNTKTFGRITMAVAVKVSRFESITMAPPDPILG  80

Query  409  VSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            VSEAF+ADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYL
Sbjct  81   VSEAFRADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYL  131



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 103/127 (81%), Gaps = 5/127 (4%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVATVNV  360
            MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+G+  M   VNV
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGQTTMAVAVNV  59

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+R
Sbjct  60   SRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILER  119

Query  541  GENKEYL  561
            GENKEYL
Sbjct  120  GENKEYL  126



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 101/126 (80%), Gaps = 3/126 (2%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  363
            MAST+F+LAS +PS S+SLQD LK K K+    Q    G      KS+GR  M   VNVS
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKIGTSSQRAFPGKDFMKAKSNGRTTMAVAVNVS  60

Query  364  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  543
            RFEGI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+RG
Sbjct  61   RFEGITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILERG  120

Query  544  ENKEYL  561
            ENKEYL
Sbjct  121  ENKEYL  126



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 101/130 (78%), Gaps = 7/130 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  351
            MAST+ +LASA+PS SLS+Q+ LK K +       TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASATPSASLSMQEILKGKARPGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  532  LQRGENKEYL  561
            L+RGENKEYL
Sbjct  121  LERGENKEYL  130



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 87/110 (79%), Gaps = 7/110 (6%)
 Frame = +1

Query  250  QDKLKAKPKLREYG------QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGV  411
            Q+ LK K KLR  G      +   F N  KS GR+ MVA VN SRF+GI+MAPPDPILGV
Sbjct  22   QESLKGKLKLRSSGLSFTKEKINPFANG-KSFGRVSMVAAVNASRFDGIAMAPPDPILGV  80

Query  412  SEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            SEAFKADT+ +KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENKE +
Sbjct  81   SEAFKADTNALKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEVI  130



>gb|ABN48559.1| chloroplast aspartate aminotransferase [Brassica juncea]
Length=135

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  553  EYL  561
            EYL
Sbjct  115  EYL  117



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  250  QDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKA  429
             D  K K KL    +  LF N T+S GR+ MVA V  SRF+G++MAPPDPILGVSEAFKA
Sbjct  15   HDTHKGKIKLGSLERSNLFLN-TQSAGRVSMVAAVKTSRFDGVTMAPPDPILGVSEAFKA  73

Query  430  DTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
             T+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYL
Sbjct  74   STNLMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYL  117



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 7/129 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKL-REY-----GQCTLFGNATKSHGRMRMVATV  354
            MAST+ +LAS SPS SLS  +  K K KL R +      +  LF   T+S GR+ MVA V
Sbjct  1    MASTMLSLASVSPSASLSTHETPKGKVKLGRSFLSLNKERNNLFAK-TESFGRISMVAAV  59

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            NVS+FEG++MAPPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPYVLDVVKKAENLM+
Sbjct  60   NVSKFEGVTMAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPYVLDVVKKAENLMI  119

Query  535  QRGENKEYL  561
            +RGENKEYL
Sbjct  120  ERGENKEYL  128



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  520  ENLMLQRGENKEYL  561
            ENLML+RGENKEYL
Sbjct  61   ENLMLERGENKEYL  74



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFKA T+E KLNLGVGAYRTE+LQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKASTNESKLNLGVGAYRTEDLQPY  106

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKKAENLM++RGENKEYL
Sbjct  107  VLDVVKKAENLMIERGENKEYL  128



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RGENKEYL
Sbjct  105  VLNVVKKAENLMLERGENKEYL  126



>gb|KJB55010.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=339

 Score =   144 bits (363),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 97/130 (75%), Gaps = 9/130 (7%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  532  LQRGENKEYL  561
            L++GEN+EYL
Sbjct  119  LEKGENREYL  128



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TK  GR+ M   VNVSRFEGI+MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPY
Sbjct  45   TKHFGRVSMSVAVNVSRFEGITMAPPDPILGVSEAFKADTDERKLNLGVGAYRTEELQPY  104

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL VVK AENLML+RGENKEYL
Sbjct  105  VLKVVKTAENLMLERGENKEYL  126



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RGENKEYL
Sbjct  105  VLNVVKKAENLMLKRGENKEYL  126



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 94/130 (72%), Gaps = 8/130 (6%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             NVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  532  LQRGENKEYL  561
            L+RG+NKEYL
Sbjct  120  LERGQNKEYL  129



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            T+S GR+ MVA VNVS+FEG+++APPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPY
Sbjct  47   TESFGRISMVAAVNVSKFEGVTLAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPY  106

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKKAENLM++RGENKEYL
Sbjct  107  VLDVVKKAENLMIERGENKEYL  128



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            +S  R+ MVATVN SRF+G+SMAP DPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  43   QSFSRVSMVATVNASRFDGVSMAPADPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  102

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RGENKEYL
Sbjct  103  LNVVKKAENLMLERGENKEYL  123



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS++F+LA AS S S+   D LK K +L      T F          TKS GR+ M A 
Sbjct  1    MASSMFSLAGASLSPSM--HDTLKEKVRLGSGSIGTWFTKDKVHSFMKTKSSGRISMTAA  58

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VN+SRFEGI+MA PDPILGVSEAF+AD D  KLNLGVGAYRTEEL PYVLDVVKKAENLM
Sbjct  59   VNISRFEGITMALPDPILGVSEAFRADNDAKKLNLGVGAYRTEELHPYVLDVVKKAENLM  118

Query  532  LQRGENKEYL  561
            L+RGENKEYL
Sbjct  119  LERGENKEYL  128



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
            F N ++S GR+ M   VNVSRFEGI MAPPDPILGVSEAFKADT  +KLNLGVGAYRTEE
Sbjct  47   FSN-SRSSGRISMAVAVNVSRFEGIPMAPPDPILGVSEAFKADTSNVKLNLGVGAYRTEE  105

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
            LQPYVL+VVKKAENLML+RGENKEYL
Sbjct  106  LQPYVLNVVKKAENLMLERGENKEYL  131



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            ++S GR+ M   VNVSRFEG++MAPPDPILGVSEAF+ADT++ KLNLGVGAYRTEELQPY
Sbjct  53   SQSFGRISMTVAVNVSRFEGVTMAPPDPILGVSEAFRADTNDAKLNLGVGAYRTEELQPY  112

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RGENKEYL
Sbjct  113  VLNVVKKAENLMLERGENKEYL  134



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 97/130 (75%), Gaps = 9/130 (7%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  532  LQRGENKEYL  561
            L++GEN+EYL
Sbjct  119  LEKGENREYL  128



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 9/130 (7%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F           KS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKIKSFGRISMVVA  58

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL+PYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELEPYVLDVVKKADKLL  118

Query  532  LQRGENKEYL  561
            L++GEN+EYL
Sbjct  119  LEKGENREYL  128



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +1

Query  250  QDKLKAKPKLREYG--QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAF  423
             DKLK       +   Q   F NA KS  R+ MVA VNVSRFEGI MAPPDPILGVSEAF
Sbjct  14   NDKLKVGGNSLRFSKEQSNTFSNA-KSSCRISMVAAVNVSRFEGIPMAPPDPILGVSEAF  72

Query  424  KADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            +ADT + KLNLGVGAYRTEELQPYVL VV KAENLML+RG+NKEYL
Sbjct  73   RADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLMLERGQNKEYL  118



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 98/130 (75%), Gaps = 7/130 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  351
            MAS++ +LAS SPS SLS+ + LK K +       T F          TKS GR+ M   
Sbjct  1    MASSMLSLASTSPSASLSVHETLKGKVRHGTGSLTTWFNKEKANRFRNTKSPGRISMAIA  60

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
            VNVSRFEGI+MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL PYVL+VVKKAENLM
Sbjct  61   VNVSRFEGITMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELHPYVLNVVKKAENLM  120

Query  532  LQRGENKEYL  561
            L+RGE KEYL
Sbjct  121  LERGEYKEYL  130



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VV+KAENLML+RGENKEYL
Sbjct  98   LNVVRKAENLMLERGENKEYL  118



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VV+KAENLML+RGENKEYL
Sbjct  98   LNVVRKAENLMLERGENKEYL  118



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            K  GR+ M   VNVSRFEGI++APPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  104  KHFGRVSMTVAVNVSRFEGITIAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  163

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L VV+KAENLML+RGENKEYL
Sbjct  164  LKVVEKAENLMLERGENKEYL  184



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 94/130 (72%), Gaps = 8/130 (6%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  351
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             NVSRFEGI MAPPDPILGVSEAF+AD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFRADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  532  LQRGENKEYL  561
            L+RG+NKEY+
Sbjct  120  LERGQNKEYV  129



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT+++KLNLGVGAYRTEELQPYV
Sbjct  39   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTNDVKLNLGVGAYRTEELQPYV  98

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RGENKEYL
Sbjct  99   LNVVKKAENLMLERGENKEYL  119



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TKS GR+ MV T NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  47   TKSFGRISMVITSNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  106

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKA+ L+L+RGEN+EYL
Sbjct  107  VLNVVKKADKLLLERGENREYL  128



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAST F+L SAS        DK     KL   G    F   TKS GR+ M   V  SRF+
Sbjct  1    MASTTFSLVSASVFPREISVDK----QKLGNSGSNAFF--KTKSFGRVTMSIAVKTSRFD  54

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            GI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTEEL PYVL VVKKAENLML+RGENK
Sbjct  55   GITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEELHPYVLSVVKKAENLMLERGENK  114

Query  553  EYL  561
            EYL
Sbjct  115  EYL  117



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 96/134 (72%), Gaps = 17/134 (13%)
 Frame = +1

Query  178  PSP-ITMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMR  339
            P+P ++MAS++ +L S S       +DKLK     + P L+            KS  R+ 
Sbjct  37   PNPALSMASSMLSLGSTSLLPREISKDKLKLGTSGSNPFLK-----------AKSFSRVT  85

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  86   MTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYVLNVVKKA  145

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  146  ENLMLERGDNKEYL  159



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  48   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  107

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKK E+LML+RG+NKEYL
Sbjct  108  VLDVVKKVESLMLERGDNKEYL  129



>prf||2009357A Asp aminotransferase
Length=463

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RGENKEYL
Sbjct  109  LNVVKKAENLMLERGENKEYL  129



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RGENKEYL
Sbjct  109  LNVVKKAENLMLERGENKEYL  129



>prf||1908424A Asp aminotransferase
Length=465

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RGENKEYL
Sbjct  109  LNVVKKAENLMLERGENKEYL  129



>gb|KHG09550.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=332

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS GR+ MV   NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  102

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKKA+ L+L++GEN+EYL
Sbjct  103  VLDVVKKADKLLLEKGENREYL  124



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  553  EYL  561
            EYL
Sbjct  115  EYL  117



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  553  EYL  561
            EYL
Sbjct  115  EYL  117



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  372
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  553  EYL  561
            EYL
Sbjct  115  EYL  117



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  47   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  106

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKK E LML+RG+NKEYL
Sbjct  107  VLDVVKKVEALMLERGDNKEYL  128



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 5/101 (5%)
 Frame = +1

Query  268  KPKLREYGQCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTD  438
            KPKL    Q ++FG     T+S  R  M   +NVSRFE I+MAPPDPILGVSEAF+ADT+
Sbjct  115  KPKL--LNQASVFGKRFVNTESFTRTTMAVALNVSRFESITMAPPDPILGVSEAFRADTN  172

Query  439  EMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            EMKLNLGVGAYRTE+LQPYVL+VVKKAE LML+RGENKEYL
Sbjct  173  EMKLNLGVGAYRTEDLQPYVLNVVKKAEKLMLERGENKEYL  213



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMAVAVTPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            ++ G + M   VNVSRFEG++MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  53   QNSGGVTMTVAVNVSRFEGVTMAPPDPILGVSEAFKADTNSMKLNLGVGAYRTEELQPYV  112

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  113  LNVVKKAENLMLERGDNKEYL  133



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 98/132 (74%), Gaps = 9/132 (7%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQD--KLKAKPKLREYGQCTLFGN-------ATKSHGRMRMV  345
            MAS+VF+LASA+PS SLS  D  K+ ++ KL        F          TKS GR+ MV
Sbjct  1    MASSVFSLASATPSASLSSHDIEKISSQGKLNLRNTSLCFKKEKNNPFMKTKSFGRISMV  60

Query  346  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  525
               NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ 
Sbjct  61   VASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADK  120

Query  526  LMLQRGENKEYL  561
            L+L++GEN+EYL
Sbjct  121  LLLEKGENREYL  132



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPY
Sbjct  36   AKSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPY  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RG+NKEYL
Sbjct  96   VLNVVKKAENLMLERGDNKEYL  117



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPY
Sbjct  36   AKSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPY  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RG+NKEYL
Sbjct  96   VLNVVKKAENLMLERGDNKEYL  117



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSISRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPY
Sbjct  36   AKSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPY  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RG+NKEYL
Sbjct  96   VLNVVKKAENLMLERGDNKEYL  117



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            K+ GR+ +   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVSLAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VV+KAENLML+RGENKEYL
Sbjct  98   LNVVRKAENLMLERGENKEYL  118



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPY
Sbjct  36   AKSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPY  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RG+NKEYL
Sbjct  96   VLNVVKKAENLMLERGDNKEYL  117



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TKS GR+ MV   NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  79   TKSFGRISMVVASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  138

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKKA+ L+L++GEN+EYL
Sbjct  139  VLDVVKKADKLLLEKGENREYL  160



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R+ M  +VNVSRFEG++MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEELQPYVL+VV
Sbjct  13   RVSMTVSVNVSRFEGVTMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELQPYVLNVV  72

Query  511  KKAENLMLQRGENKEYL  561
            KKAE LML+RGENKEYL
Sbjct  73   KKAEKLMLERGENKEYL  89



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QPYVL+VVKKAENLML++GENKEYL
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYL  123



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QPYVL+VVKKAENLML++GENKEYL
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYL  123



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +1

Query  328  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  507
            GR+ M   VN SRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+V
Sbjct  44   GRISMAVAVNASRFEGIPMAPPDPILGVSEAFKADKCDLKLNLGVGAYRTEELQPYVLNV  103

Query  508  VKKAENLMLQRGENKEYL  561
            VKKAENLML RGENKEYL
Sbjct  104  VKKAENLMLNRGENKEYL  121



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L+VVKKAENLML+RG+NKEYL
Sbjct  97   LNVVKKAENLMLERGDNKEYL  117



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 7/107 (7%)
 Frame = +1

Query  259  LKAKPKLREYGQ------CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEA  420
            + A+ K+  +G+      C + G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEA
Sbjct  16   IAARSKVLGWGKNQGRNGCRV-GITRKNFGRVLMALAVDVSRFEGVPMAPPDPILGVSEA  74

Query  421  FKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            FKAD +++KLNLGVGAYRTEELQPYVL+VVKKAENLML++GENKEYL
Sbjct  75   FKADKNDLKLNLGVGAYRTEELQPYVLNVVKKAENLMLEKGENKEYL  121



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 6/103 (6%)
 Frame = +1

Query  262  KAKPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKAD  432
            K KPK+   G    F  +    +S GR+  VA VN SRFEGI MAPPDPILGVSEAFKAD
Sbjct  26   KGKPKIG--GNALRFNKSFPNARSSGRVMAVA-VNGSRFEGIPMAPPDPILGVSEAFKAD  82

Query  433  TDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            T ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NKEYL
Sbjct  83   TSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYL  125



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 76/93 (82%), Gaps = 3/93 (3%)
 Frame = +1

Query  292  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  462
            Q TLFG      KS  R  + + V VSRF  I+MAPPDPILGVSEAF+ADT EMKLNLGV
Sbjct  23   QSTLFGKDYIRAKSFTRKSVTSAVEVSRFGDITMAPPDPILGVSEAFRADTHEMKLNLGV  82

Query  463  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            GAYRTE+LQPYVL+VVKKAENLML+RGENKEYL
Sbjct  83   GAYRTEDLQPYVLNVVKKAENLMLERGENKEYL  115



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             K   R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPY
Sbjct  36   AKCFSRVTMSVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPY  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RG+NKEYL
Sbjct  96   VLNVVKKAENLMLERGDNKEYL  117



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 91/129 (71%), Gaps = 16/129 (12%)
 Frame = +1

Query  190  TMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATV  354
            +MAS++ +L S S       +DKLK     + P L+            K   R+ M   V
Sbjct  51   SMASSMLSLGSTSLLPREINKDKLKLGTSGSNPFLK-----------AKCFSRVTMSVAV  99

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
              SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML
Sbjct  100  KPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLML  159

Query  535  QRGENKEYL  561
            +RG+NKEYL
Sbjct  160  ERGDNKEYL  168



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYVLDVVKK 
Sbjct  1    MVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYVLDVVKKV  60

Query  520  ENLMLQRGENKEYL  561
            E+LML+RG+NKEYL
Sbjct  61   ESLMLERGDNKEYL  74



>gb|EPS60991.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=200

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             +S  R  MV    VSRF  +S+APPDPILGVSEAFKADT ++KLNLGVGAYRTE+LQPY
Sbjct  18   ARSFNRASMVIASGVSRFNEVSLAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEDLQPY  77

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAENLML+RGENKEYL
Sbjct  78   VLNVVKKAENLMLERGENKEYL  99



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = +1

Query  295  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  474
            C L G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYR
Sbjct  35   CRL-GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYR  93

Query  475  TEELQPYVLDVVKKAENLMLQRGENKEYL  561
            TEELQPYVL+VVKKAE LML++GENKEYL
Sbjct  94   TEELQPYVLNVVKKAETLMLEKGENKEYL  122



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKKA+ L+L++GEN EYL
Sbjct  103  VLDVVKKADKLLLEKGENLEYL  124



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G A K+ GR+ M   V+ SRFEG+ MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL
Sbjct  35   GIARKNFGRVVMALAVDTSRFEGVPMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEEL  94

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QP VL+VVKKAENLML++GENKEYL
Sbjct  95   QPSVLNVVKKAENLMLEKGENKEYL  119



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  114  ENLMLERGDNKEYL  127



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  114  ENLMLERGDNKEYL  127



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  114  ENLMLERGDNKEYL  127



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  114  ENLMLERGDNKEYL  127



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  520  ENLMLQRGENKEYL  561
            ENLML+RG+NKEYL
Sbjct  114  ENLMLERGDNKEYL  127



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  41   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  100

Query  511  KKAENLMLQRGENKEYL  561
            KKAEN+ML++GENKEYL
Sbjct  101  KKAENMMLEKGENKEYL  117



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  52   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  111

Query  511  KKAENLMLQRGENKEYL  561
            KKAEN+ML++GENKEYL
Sbjct  112  KKAENMMLEKGENKEYL  128



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  328  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  507
            GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEELQPYVL+V
Sbjct  1    GRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYRTEELQPYVLNV  60

Query  508  VKKAENLMLQRGENKEYL  561
            VKKAE LML++GENKEYL
Sbjct  61   VKKAETLMLEKGENKEYL  78



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M    NVSRFEG+ MAPPDPILGVSEAFKADTD++KLNLGVGAYRTE+L+PYVL+VVKKA
Sbjct  1    MAVATNVSRFEGVKMAPPDPILGVSEAFKADTDDLKLNLGVGAYRTEDLRPYVLNVVKKA  60

Query  520  ENLMLQRGENKEYL  561
            EN+ML++GENKEYL
Sbjct  61   ENMMLEKGENKEYL  74



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEEL
Sbjct  38   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSDLKLNLGVGAYRTEEL  97

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QPYVL+VVKKAENLML++GE KEYL
Sbjct  98   QPYVLNVVKKAENLMLEKGEYKEYL  122



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G   K+ GR+ M   V+VSRFE + MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  2    GITRKNFGRVMMALAVDVSRFEIVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  61

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QPYVL+VVKKAE LML++GENKEYL
Sbjct  62   QPYVLNVVKKAETLMLEKGENKEYL  86



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VLDVVKK   L+L++GEN EYL
Sbjct  103  VLDVVKKVNKLLLEKGENLEYL  124



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +1

Query  193  MASTVFTlasaspsvslslQDKLKAKPKLRE----YGQCTLFGNATKSHGRMRMVATVNV  360
            MAS+V + AS S S S SL    K KP +R+    + +     ++++S GR+ M   VNV
Sbjct  1    MASSVLSAASHSVSPSCSLSTTHKGKPMIRDNTLGFHRGPNSFSSSRSRGRISMAVAVNV  60

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            SRFEGI MAPPDPILGVSEAFK D  ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  61   SRFEGIPMAPPDPILGVSEAFKVDNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  120

Query  541  GENKEYL  561
            G+NKEYL
Sbjct  121  GDNKEYL  127



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QP VL+VVKKAE LML++GENKEYL
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYL  121



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            QP VL+VVKKAE LML++GENKEYL
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYL  121



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/67 (91%), Positives = 66/67 (99%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  46   SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  105

Query  541  GENKEYL  561
            G+NKEYL
Sbjct  106  GDNKEYL  112



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  520  ENLMLQRGENKEYL  561
            E LML+RGENKEYL
Sbjct  61   EQLMLERGENKEYL  74



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  520  ENLMLQRGENKEYL  561
            E LML+RGENKEYL
Sbjct  61   EQLMLERGENKEYL  74



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  328  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  507
            G + M   V+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQP VL+V
Sbjct  70   GHITMALAVDASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEELQPAVLNV  129

Query  508  VKKAENLMLQRGENKEYL  561
            VKKAE LML++GENKEYL
Sbjct  130  VKKAEKLMLEKGENKEYL  147



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 8/109 (7%)
 Frame = +1

Query  256  KLKAKPKLREYGQCTLFGNATKSHGRMR-------MVATVNVSRFEGISMAPPDPILGVS  414
            +L+  P +R +   ++F     S  R R       M   V+ SRFEG+ MAPPDPILGVS
Sbjct  25   RLRMTP-IRTFPSNSIFQRPFSSASRDRVNTSHITMAVAVDASRFEGVPMAPPDPILGVS  83

Query  415  EAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            EAFKADT ++KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYL
Sbjct  84   EAFKADTSDLKLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYL  132



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +1

Query  292  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  462
            Q T  GN    +KS  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLGV
Sbjct  34   QMTFLGNDHINSKSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLGV  93

Query  463  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            GAYRTE+LQPYVL+VVKKAE LML+  ENKEYL
Sbjct  94   GAYRTEDLQPYVLNVVKKAETLMLEWAENKEYL  126



>ref|XP_008378725.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
 ref|XP_008378741.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
Length=126

 Score =   120 bits (300),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFK+ T+E KL+LGVGAYRTEELQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKSSTNESKLDLGVGAYRTEELQPY  106

Query  496  VLDVVKKAENL  528
            VLDVVKK  +L
Sbjct  107  VLDVVKKVRSL  117



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 72/94 (77%), Gaps = 4/94 (4%)
 Frame = +1

Query  292  QCTLFGN----ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLG  459
            Q T  GN    + +S  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLG
Sbjct  34   QMTFLGNDHINSKQSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLG  93

Query  460  VGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            VGAYRTE+LQPYVL+VVKKAE LML+  ENKEYL
Sbjct  94   VGAYRTEDLQPYVLNVVKKAETLMLEWAENKEYL  127



>emb|CAN64661.1| hypothetical protein VITISV_034785 [Vitis vinifera]
Length=420

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  23   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  82

Query  496  VLDVVKK  516
            VL+VVKK
Sbjct  83   VLNVVKK  89



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M    +VSRFE ++MAP DPILGVSEAFK D  E KLNLGVGAYRTE+LQPYVL+VVKKA
Sbjct  52   MSVATDVSRFESVTMAPADPILGVSEAFKKDNSEKKLNLGVGAYRTEDLQPYVLEVVKKA  111

Query  520  ENLMLQRGENKEYL  561
            E  ML+ G+NKEYL
Sbjct  112  EKKMLEGGDNKEYL  125



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+L++GEN+EYL
Sbjct  1    MAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLLLEKGENREYL  60



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  522
            V T   SR   + + PPDPILGVSEAFK DT+++KLNLGVGAYRTEEL+PYVL+VVKKAE
Sbjct  47   VDTKKQSRLAFVDLQPPDPILGVSEAFKRDTNDLKLNLGVGAYRTEELKPYVLNVVKKAE  106

Query  523  NLMLQRGENKEYL  561
             +ML+  ENKEYL
Sbjct  107  KIMLESEENKEYL  119



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            SR + +  APPDPILGVSEAFK DT   KLNLGVGAYRTEELQPYVL VV+KAE  ML +
Sbjct  41   SRLDAVEQAPPDPILGVSEAFKKDTSPDKLNLGVGAYRTEELQPYVLKVVRKAEERMLAK  100

Query  541  GENKEYL  561
             ENKEYL
Sbjct  101  DENKEYL  107



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            SRF  ++ APPDPILGVSEAFKA TD  KLNLGVGAYR E+L+P VL VVKKAE+ +  R
Sbjct  28   SRFADVAQAPPDPILGVSEAFKASTDPNKLNLGVGAYRDEQLKPVVLSVVKKAESKIFSR  87

Query  541  GENKEYL  561
             ENKEYL
Sbjct  88   NENKEYL  94



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +1

Query  331  RMRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  507
            R R+   V  +SRF  ++ APPDPILGVSEAF+A T   KLNLGVGAYR E+L+P VL V
Sbjct  27   RSRLALQVRCMSRFADVAQAPPDPILGVSEAFRASTSPSKLNLGVGAYRDEDLKPVVLSV  86

Query  508  VKKAENLMLQRGENKEYL  561
            VKKAE  +  R ENKEYL
Sbjct  87   VKKAEAKIFSRNENKEYL  104



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             K+ G    V   N SRFEG++  PPDP   + EAF+ADT + K+NL V AYR  ELQP+
Sbjct  37   AKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADTSDTKVNLWVRAYRV-ELQPF  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAE LML++GE+KEYL
Sbjct  96   VLNVVKKAEKLMLEKGEDKEYL  117



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = +1

Query  316  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  495
             K+ G    V   N SRFEG++  PPDP   + EAF+ADT + K+NL V AYR  ELQP+
Sbjct  37   AKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADTSDTKVNLWVRAYRV-ELQPF  95

Query  496  VLDVVKKAENLMLQRGENKEYL  561
            VL+VVKKAE LML++GE+KEYL
Sbjct  96   VLNVVKKAEKLMLEKGEDKEYL  117



>ref|XP_010878037.1| PREDICTED: aspartate aminotransferase, mitochondrial [Esox lucius]
Length=428

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  343  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  522
            V+T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VLD V+KAE
Sbjct  23   VSTRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLDCVRKAE  82

Query  523  NLMLQRGENKEYL  561
             L+  +  +KEYL
Sbjct  83   ALISSKQLDKEYL  95



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +1

Query  373  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  552
            G+  +PPDPILGVS AF+A  D  KLNLGVGAYRTEELQPYVL+VV++AE  M+  G +K
Sbjct  14   GVEPSPPDPILGVSVAFRACDDPNKLNLGVGAYRTEELQPYVLEVVREAERRMIAAGHDK  73

Query  553  EYL  561
            EYL
Sbjct  74   EYL  76



>ref|XP_008033064.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
 gb|EIW64721.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
Length=425

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  349  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  528
            T ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +
Sbjct  19   TGSLSAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEI  78

Query  529  MLQRGENKEYL  561
            ++Q+  +KEYL
Sbjct  79   LVQQNPDKEYL  89



>gb|ACI34022.1| Aspartate aminotransferase, mitochondrial precursor [Salmo salar]
Length=428

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            + +++T N S + G+ M PPDPILGVSEAFK DT   K+NLGVGAYR +  +P+VLD V+
Sbjct  20   LGVLSTRNSSWWGGVQMGPPDPILGVSEAFKRDTSPKKMNLGVGAYRDDHGKPFVLDCVR  79

Query  514  KAENLMLQRGENKEYL  561
            KAE L+  +  +KEYL
Sbjct  80   KAEALISSKQLDKEYL  95



>ref|XP_004067248.1| PREDICTED: aspartate aminotransferase, mitochondrial [Oryzias 
latipes]
Length=428

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE+L+  +  +KEYL
Sbjct  70   GKPFVLSCVRKAESLIAAKQLDKEYL  95



>gb|KDQ63696.1| hypothetical protein JAAARDRAFT_29716 [Jaapia argillacea MUCL 
33604]
Length=429

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  334  MRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            +RM AT   VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR ++ +PYVL  V
Sbjct  16   LRMSATAAPVSTWSAVPAGPPDPILGVSEAFKADKDSKKINLGVGAYRDDKGKPYVLSSV  75

Query  511  KKAENLMLQRGENKEYL  561
            KKAE L+     +KEYL
Sbjct  76   KKAEELLASSHPDKEYL  92



>gb|KIP12008.1| hypothetical protein PHLGIDRAFT_27620 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=425

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAEN++  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDEHGKPYVLNSVKKAENIIAS  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   SNPDKEYL  89



>ref|XP_005814426.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Xiphophorus 
maculatus]
Length=428

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + + G +   ++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPALGAL---SSRNSSWWAGVQMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE LM  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEALMASKQLDKEYL  95



>ref|XP_008292179.1| PREDICTED: aspartate aminotransferase, mitochondrial [Stegastes 
partitus]
Length=428

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE L+  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEALIAAKQLDKEYL  95



>ref|XP_007359882.1| PLP-dependent transferase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF66648.1| PLP-dependent transferase [Dichomitus squalens LYAD-421 SS1]
Length=425

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +++
Sbjct  21   SLSVWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEILV  80

Query  535  QRGENKEYL  561
            Q+  +KEYL
Sbjct  81   QQNPDKEYL  89



>ref|XP_003970037.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Takifugu 
rubripes]
Length=428

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   + AT N S + G+ M PPDPILGV+EAFK D++  K+NLGVGAYR ++
Sbjct  13   LGNISPSMG---VFATRNSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE L+  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEALIAAKQLDKEYL  95



>ref|XP_007549969.1| PREDICTED: aspartate aminotransferase, mitochondrial [Poecilia 
formosa]
Length=428

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + + G +   ++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPALGAL---SSRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE LM  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEALMASKQLDKEYL  95



>ref|XP_003442303.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Oreochromis 
niloticus]
Length=428

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE ++  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYL  95



>emb|CDO75262.1| hypothetical protein BN946_scf184967.g15 [Trametes cinnabarina]
Length=425

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            ++S +  +   PPDPILGV+EA+KAD D  K+NLGVGAYR E  +PYVL+ VKKAE L++
Sbjct  21   SLSVWSAVPAGPPDPILGVTEAWKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEELLV  80

Query  535  QRGENKEYL  561
            Q+  +KEYL
Sbjct  81   QQNPDKEYL  89



>ref|XP_004543093.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005741732.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pundamilia 
nyererei]
 ref|XP_005915269.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Haplochromis 
burtoni]
Length=428

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE ++  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYL  95



>ref|XP_006780104.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Neolamprologus 
brichardi]
Length=428

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE ++  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYL  95



>ref|XP_010739613.1| PREDICTED: aspartate aminotransferase, mitochondrial [Larimichthys 
crocea]
Length=428

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +1

Query  304  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  483
             GN + S G   +++T N S + G+ M PPDPILGVSEAFK D++  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVSEAFKRDSNPKKMNLGVGAYRDDQ  69

Query  484  LQPYVLDVVKKAENLMLQRGENKEYL  561
             +P+VL  V+KAE ++  +  +KEYL
Sbjct  70   GKPFVLSCVRKAEAIIADKQLDKEYL  95



>gb|KIK71059.1| hypothetical protein GYMLUDRAFT_33186 [Gymnopus luxurians FD-317 
M1]
Length=423

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            + + A   +S F  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PY+L+ VK
Sbjct  11   INLTAKRAISAFAAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYILNSVK  70

Query  514  KAENLMLQRGENKEYL  561
            KAE L+     +KEYL
Sbjct  71   KAEELVANSKPDKEYL  86



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  400  ILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            ILGVSEAFK +T   KLNLGVGAYRTEELQPYVL VV KAE  ML+RG+NKEYL
Sbjct  23   ILGVSEAFKRETSTDKLNLGVGAYRTEELQPYVLRVVGKAEKRMLERGDNKEYL  76



>gb|KIY47045.1| hypothetical protein FISHEDRAFT_46081 [Fistulina hepatica ATCC 
64428]
Length=411

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M AT ++S +  +   PPDPILGVSEAFKAD D +K+NLGVGAYR E  +PY+L  V+KA
Sbjct  1    MNATRSISAWSAVVAGPPDPILGVSEAFKADKDPLKINLGVGAYRDEHGKPYILKSVQKA  60

Query  520  ENLMLQRGENKEYL  561
            E ++     +KEYL
Sbjct  61   EQIIEVSRPDKEYL  74



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            M   A    S   G+  AP DPILGVS AF+  T+  KLNLGVGAYRTE+L+PYVLDVV+
Sbjct  1    MSTRAAAGPSFLSGVEQAPADPILGVSVAFRESTNPNKLNLGVGAYRTEDLKPYVLDVVR  60

Query  514  KAENLMLQRGENKEYL  561
            +AE  M++   +KEYL
Sbjct  61   QAEKRMIEADYDKEYL  76



>ref|XP_007339747.1| hypothetical protein AURDEDRAFT_111475 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD51900.1| hypothetical protein AURDEDRAFT_111475 [Auricularia delicata 
TFB-10046 SS5]
Length=423

 Score = 87.4 bits (215),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            R V   ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  VKK
Sbjct  12   RAVGLRSISAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLPSVKK  71

Query  517  AENLMLQRGENKEYL  561
            AE L+     +KEYL
Sbjct  72   AEELIAASKADKEYL  86



>gb|KIM66148.1| hypothetical protein SCLCIDRAFT_1211371 [Scleroderma citrinum 
Foug A]
Length=424

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 56/85 (66%), Gaps = 2/85 (2%)
 Frame = +1

Query  307  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  486
            G A +S    R VA+V  S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  
Sbjct  5    GAARRSPALFRNVASV--STWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDENG  62

Query  487  QPYVLDVVKKAENLMLQRGENKEYL  561
            +PYVL+ VKKAE  M     +KEYL
Sbjct  63   KPYVLNAVKKAEEKMAAAQLDKEYL  87



>ref|XP_001828762.2| aspartate Aminotransferase [Coprinopsis cinerea okayama7#130]
 gb|EAU93028.2| aspartate Aminotransferase [Coprinopsis cinerea okayama7#130]
Length=426

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            +R  A  ++S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PY+L  VK
Sbjct  14   LRAPAFRSISAWANVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDEHGKPYILQTVK  73

Query  514  KAENLMLQRGENKEYL  561
            KAE ++  +  +KEYL
Sbjct  74   KAEEIVASQNPDKEYL  89



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  376  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  555
            I M   +P + +S+AF AD  EMKL+LG+GAYRTE+LQPYVL+VVKKAE LML+R ENKE
Sbjct  9    IGMGAEEPSVELSKAFGADRYEMKLDLGLGAYRTEDLQPYVLNVVKKAEKLMLERCENKE  68

Query  556  YL  561
            YL
Sbjct  69   YL  70



>ref|XP_008401656.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Poecilia reticulata]
Length=427

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            +V  +  S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KA
Sbjct  21   IVLVLCSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSCVRKA  80

Query  520  ENLMLQRGENKEYL  561
            E LM  +  +KEYL
Sbjct  81   EALMTSKQLDKEYL  94



>gb|KDQ30745.1| hypothetical protein PLEOSDRAFT_1088517 [Pleurotus ostreatus 
PC15]
Length=426

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  VKKAE ++  
Sbjct  22   VSTWSAVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDEHGKPYVLTSVKKAEQILTA  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   SNPDKEYL  89



>gb|KIM85250.1| hypothetical protein PILCRDRAFT_5589 [Piloderma croceum F 1598]
Length=423

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE+L+  
Sbjct  19   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAESLLTA  78

Query  538  RGENKEYL  561
               +KEYL
Sbjct  79   TSPDKEYL  86



>ref|XP_007762781.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW86661.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
Length=410

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKADTD  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  6    LSTWSAVPAGPPDPILGITEAFKADTDSRKINLGVGAYRDENGKPYVLNAVKKAEEIITA  65

Query  538  RGENKEYL  561
               +KEYL
Sbjct  66   AKLDKEYL  73



>gb|KII93192.1| hypothetical protein PLICRDRAFT_35377 [Plicaturopsis crispa FD-325 
SS-3]
Length=426

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL  VKKAE L+  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDENGKPYVLGSVKKAEELVAS  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   SNPDKEYL  89



>dbj|BAK02685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R    A    S +  + M PPDPILGV+EAFKADT+  K+NLGVGAYR +  +P+VL  V
Sbjct  11   RATTTAQRAASTWANVKMGPPDPILGVTEAFKADTNPKKMNLGVGAYRDDAGKPFVLSSV  70

Query  511  KKAENLMLQRGENKEYL  561
            +KAE LM+ +  +KEYL
Sbjct  71   RKAEKLMMDQKLDKEYL  87



>gb|KIJ27386.1| hypothetical protein M422DRAFT_37801 [Sphaerobolus stellatus 
SS14]
Length=423

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            R  A  +VS +  +   PPDPILGVSEAFKAD    K+NLGVGAYR E  +PYVL  VKK
Sbjct  10   RRSAVRSVSLWANVPAGPPDPILGVSEAFKADPSPKKINLGVGAYRDENGKPYVLPSVKK  69

Query  517  AENLMLQRGENKEY  558
            AE ++L    NKEY
Sbjct  70   AETILLANKVNKEY  83



>ref|XP_005152326.1| PREDICTED: aspartate aminotransferase, mitochondrial [Melopsittacus 
undulatus]
Length=423

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R+   AT   S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V
Sbjct  14   RLVAAATRASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCV  73

Query  511  KKAENLMLQRGENKEYL  561
            +KAE ++  +  +KEYL
Sbjct  74   RKAEAMIASKKMDKEYL  90



>gb|KFP90495.1| hypothetical protein N311_04899, partial [Apaloderma vittatum]
Length=405

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFO71408.1| hypothetical protein N303_10396, partial [Cuculus canorus]
Length=401

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|NP_956283.1| aspartate aminotransferase 2 [Danio rerio]
 gb|AAH49435.1| Glutamic-oxaloacetic transaminase 2b, mitochondrial (aspartate 
aminotransferase 2) [Danio rerio]
Length=428

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE+L+  +
Sbjct  29   SWWTEVQMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAESLIASK  88

Query  541  GENKEYL  561
              +KEYL
Sbjct  89   ALDKEYL  95



>ref|XP_007860389.1| hypothetical protein GLOTRDRAFT_53242 [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ60769.1| hypothetical protein GLOTRDRAFT_53242 [Gloeophyllum trabeum ATCC 
11539]
Length=426

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR ++ +PYVL+ VKKAE ++  
Sbjct  22   VSTWSTVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDDKGKPYVLNCVKKAEEILTT  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   SNPDKEYL  89



>ref|XP_010582297.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
leucocephalus]
Length=421

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            R  A    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+K
Sbjct  14   RFAAARASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRK  73

Query  517  AENLMLQRGENKEYL  561
            AE ++  +  +KEYL
Sbjct  74   AEAMIASKKMDKEYL  88



>ref|XP_002388829.1| hypothetical protein MPER_12110 [Moniliophthora perniciosa FA553]
 gb|EEB89759.1| hypothetical protein MPER_12110 [Moniliophthora perniciosa FA553]
Length=91

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            ++S +      P DPILGV+EAFKAD D  K+NLGVGAYR +  +PYVL  VKKAE+L+ 
Sbjct  22   SISVWSSTPAGPADPILGVTEAFKADKDPRKINLGVGAYRDDNGKPYVLPSVKKAEDLIA  81

Query  535  QRGENKEYL  561
                +KEYL
Sbjct  82   SSKPDKEYL  90



>ref|XP_007318932.1| hypothetical protein SERLADRAFT_449644 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN99351.1| hypothetical protein SERLA73DRAFT_108809 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24913.1| hypothetical protein SERLADRAFT_449644 [Serpula lacrymans var. 
lacrymans S7.9]
Length=425

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  +  
Sbjct  21   LSTWSAVPAGPPDPILGITEAFKADKDARKINLGVGAYRDENGKPYVLNAVKKAEEFLTA  80

Query  538  RGENKEYL  561
               +KEYL
Sbjct  81   AKNDKEYL  88



>ref|XP_008308463.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cynoglossus 
semilaevis]
Length=428

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 63/90 (70%), Gaps = 5/90 (6%)
 Frame = +1

Query  292  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  471
            QC   GN + + G   ++++ + S + G+ M PPDPILGV+EAFK D++  K+NLGVGAY
Sbjct  11   QC--LGNISPALG---VLSSRHSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAY  65

Query  472  RTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            R ++ +P+VL  V+KAE L+  +  +KEYL
Sbjct  66   RDDQGKPFVLSCVRKAEALIAAKQLDKEYL  95



>emb|CEG81320.1| Putative Aspartate aminotransferase [Rhizopus microsporus]
Length=107

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +1

Query  340  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  519
            M +   VS +  +   PPD ILGV+EA+K D    K+NLGVGAYR +  +PYVL+ VKKA
Sbjct  15   MASRAFVSTWNAVPQGPPDAILGVTEAYKKDQSPNKMNLGVGAYRDDNGKPYVLNAVKKA  74

Query  520  ENLMLQRGENKEY  558
            E L++++G +KEY
Sbjct  75   EKLIMEKGLDKEY  87



>gb|KIK28496.1| hypothetical protein PISMIDRAFT_673506 [Pisolithus microcarpus 
441]
Length=424

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  ++ 
Sbjct  20   LSTWAAVPAGPPDPILGITEAFKADQDPRKINLGVGAYRDENGKPYVLNAVKKAEEKIIA  79

Query  538  RGENKEYL  561
              ++KEYL
Sbjct  80   AKQDKEYL  87



>gb|KFV95661.1| hypothetical protein N327_00168, partial [Fulmarus glacialis]
Length=310

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|XP_006863643.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X2 [Chrysochloris asiatica]
Length=415

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            R+++ +  +   G++M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+K
Sbjct  8    RLLSGITAAFHPGLAMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRK  67

Query  517  AENLMLQRGENKEYL  561
            AE  +  +  +KEYL
Sbjct  68   AEAQIAAKNMDKEYL  82



>ref|XP_002680594.1| aspartate aminotransferase [Naegleria gruberi]
 gb|EFC47850.1| aspartate aminotransferase [Naegleria gruberi]
Length=475

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 7/90 (8%)
 Frame = +1

Query  292  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  471
            Q  L+ N T +  +M        S F  I  AP DPILG+SEAFK DT   K+NLGVGAY
Sbjct  58   QSFLYSNTTAASNKM-------TSIFGTIPTAPRDPILGLSEAFKEDTSPSKVNLGVGAY  110

Query  472  RTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            RTEE +P VL+VVKK E  +L++  +KEY+
Sbjct  111  RTEEGKPLVLNVVKKVEQKILEQNLDKEYI  140



>emb|CCX32042.1| Similar to Aspartate aminotransferase, mitochondrial; acc. no. 
P12344 [Pyronema omphalodes CBS 100304]
Length=426

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +1

Query  298  TLFGNATKSHGRMRM-VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  474
            T+ G +T +   +++ VA  +VS +  +   PPD ILG++EAFKADT+  K+NLGVGAYR
Sbjct  7    TVVGKSTNAASTVKLAVAARSVSTWSAVPQGPPDAILGITEAFKADTNPKKINLGVGAYR  66

Query  475  TEELQPYVLDVVKKAENLMLQRGENKEY  558
             +  +PYVL  V+ AE  +LQ+  +KEY
Sbjct  67   DDAGKPYVLPSVRTAEERILQKALDKEY  94



>emb|CCO28282.1| aspartate aminotransferase [Rhizoctonia solani AG-1 IB]
Length=179

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            R+     VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR +  +PY+L  V+ 
Sbjct  16   RLSLRAGVSTWANVPAGPPDPILGVSEAFKADKDSRKINLGVGAYRDDSGKPYILPSVQA  75

Query  517  AENLMLQRGENKEYL  561
            AE+ +     +KEYL
Sbjct  76   AEDKIAASKADKEYL  90



>gb|KFQ35253.1| hypothetical protein N331_07571, partial [Merops nubicus]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KIK94907.1| hypothetical protein PAXRUDRAFT_827518 [Paxillus rubicundulus 
Ve08.2h10]
Length=424

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDSRKINLGVGAYRDENGKPYVLNAVKKAEEKMAS  79

Query  538  RGENKEYL  561
               +KEYL
Sbjct  80   AKLDKEYL  87



>gb|KFO04448.1| hypothetical protein N312_06091, partial [Balearica regulorum 
gibbericeps]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|XP_007390433.1| hypothetical protein PHACADRAFT_134034 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60996.1| hypothetical protein PHACADRAFT_134034 [Phanerochaete carnosa 
HHB-10118-sp]
Length=425

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  22   LSTWSAVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDENGKPYVLNSVKKAEQIIES  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   GQPDKEYL  89



>gb|KFP71016.1| hypothetical protein N310_05849, partial [Acanthisitta chloris]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFQ42654.1| hypothetical protein N333_09691, partial [Nestor notabilis]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFO92044.1| hypothetical protein N320_04667, partial [Buceros rhinoceros 
silvestris]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFP55374.1| hypothetical protein N322_09365, partial [Cariama cristata]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFP19653.1| hypothetical protein Z169_06078, partial [Egretta garzetta]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KGL91867.1| hypothetical protein N301_16701, partial [Charadrius vociferus]
Length=401

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFO97280.1| hypothetical protein N300_07039, partial [Calypte anna]
Length=401

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFQ16652.1| hypothetical protein N330_09915, partial [Leptosomus discolor]
Length=401

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFM02723.1| hypothetical protein AS27_01862, partial [Aptenodytes forsteri]
Length=401

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFQ68668.1| hypothetical protein N335_07592, partial [Phaethon lepturus]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFQ73258.1| hypothetical protein N337_00339, partial [Phoenicopterus ruber 
ruber]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFZ50221.1| hypothetical protein N321_06413, partial [Caprimulgus carolinensis]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFW71608.1| hypothetical protein AS28_11098, partial [Pygoscelis adeliae]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFV53116.1| hypothetical protein N328_06671, partial [Gavia stellata]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFR02997.1| hypothetical protein Y956_09274, partial [Nipponia nippon]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFV00678.1| hypothetical protein N340_11396, partial [Tauraco erythrolophus]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KIM48153.1| hypothetical protein M413DRAFT_439876 [Hebeloma cylindrosporum 
h7]
Length=426

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PY+L  VKKAE ++  
Sbjct  22   VSTWSNVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYILPSVKKAEEIVQS  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   SKPDKEYL  89



>emb|CEP19900.1| hypothetical protein [Parasitella parasitica]
Length=428

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            +M +   VS +  +   PPD ILGV+EAFK DT   K+NLGVGAYR +  +PYVL  VKK
Sbjct  14   QMASRAFVSTWNAVPQGPPDAILGVTEAFKKDTSPNKMNLGVGAYRDDGGKPYVLSSVKK  73

Query  517  AENLMLQRGENKEY  558
            AE LML++  +KEY
Sbjct  74   AERLMLEKNMDKEY  87



>ref|XP_001176672.2| PREDICTED: aspartate aminotransferase, mitochondrial-like isoform 
2 [Strongylocentrotus purpuratus]
Length=431

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +1

Query  346  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  525
            A+   S ++G+ M PPDPILGVSEAFK DT+  K+NLGVGAYR +E +P+VL  VK+ E+
Sbjct  27   ASAKSSLWDGVEMGPPDPILGVSEAFKRDTNTNKINLGVGAYRDDEGKPFVLQSVKQVED  86

Query  526  LMLQRGENKEYL  561
             +     +KEYL
Sbjct  87   KVRNMSLDKEYL  98



>ref|XP_001520484.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Ornithorhynchus anatinus]
Length=95

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  1    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLPSVRKAEAQIAAK  60

Query  541  GENKEYL  561
              +KEYL
Sbjct  61   NLDKEYL  67



>emb|CDQ61923.1| unnamed protein product [Oncorhynchus mykiss]
Length=88

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            + +++T N S + G+ M PPDPILGVSEAFK DT   K+NLGVGAYR +  +P+VLD V+
Sbjct  20   LGVLSTRNSSWWGGVQMGPPDPILGVSEAFKRDTSPKKMNLGVGAYRDDHGKPFVLDCVR  79

Query  514  K  516
            K
Sbjct  80   K  80



>gb|KFQ63469.1| hypothetical protein N334_09493, partial [Pelecanus crispus]
Length=401

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKA|B Chain B, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKB|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKC|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate- 
Binding Lysine Residue
Length=401

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|7AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|A Chain A, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|B Chain B, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|1TAR|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAR|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1OXO|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1OXO|B Chain B, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1IVR|A Chain A, Structure Of Aspartate Aminotransferase
 pdb|1AMA|A Chain A, Domain Closure In Mitochondrial Aspartate Aminotransferase
 pdb|1MAP|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1MAQ|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1OXP|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Closed Conformation
Length=401

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KIJ21699.1| aspartate transaminase [Paxillus involutus ATCC 200175]
Length=424

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDESGKPYVLNAVKKAEEKMAS  79

Query  538  RGENKEYL  561
               +KEYL
Sbjct  80   AKLDKEYL  87



>gb|EJT99836.1| aspartate aminotransferase [Dacryopinax sp. DJM-731 SS1]
Length=425

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = +1

Query  334  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  513
            +R+ AT  VS +  +   PPDPILGV+EAFKADT+  K+NLGVGAYR E  +PY+L  V+
Sbjct  14   VRLAATRPVSVWSTVPQGPPDPILGVTEAFKADTNPRKINLGVGAYRDENGKPYILPSVQ  73

Query  514  KAENLMLQRGENKEYL  561
            +AEN  L    +KEYL
Sbjct  74   EAEN-RLHGQVDKEYL  88



>ref|XP_009541187.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87264.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
Length=425

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
             +VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +
Sbjct  19   ASVSTWSHVPAGPPDPILGVSEAFKADKDARKINLGVGAYRDGNGKPYVLSAVKKAEEAL  78

Query  532  LQRGENKEYL  561
                 +KEYL
Sbjct  79   RAANPDKEYL  88



>gb|KIJ68385.1| hypothetical protein HYDPIDRAFT_173129 [Hydnomerulius pinastri 
MD-312]
Length=424

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG+SEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGISEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEAKMAL  79

Query  538  RGENKEYL  561
               +KEYL
Sbjct  80   AKLDKEYL  87



>gb|KFP56730.1| hypothetical protein N323_06988, partial [Cathartes aura]
Length=401

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFW90670.1| hypothetical protein N336_10326, partial [Phalacrocorax carbo]
Length=401

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFP38914.1| hypothetical protein N324_09434, partial [Chlamydotis macqueenii]
Length=401

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|EOA96948.1| Aspartate aminotransferase, mitochondrial, partial [Anas platyrhynchos]
Length=402

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  3    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  62

Query  541  GENKEYL  561
              +KEYL
Sbjct  63   KMDKEYL  69



>gb|KFV92257.1| hypothetical protein N326_05957, partial [Eurypyga helias]
Length=401

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|XP_002954714.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ44120.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=426

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +E +  APPDPI+GV++A++AD D  KLNLGVGAYRTEE +PYVL  V++AE  +L  
Sbjct  22   SNWEHVQQAPPDPIIGVTDAWRADPDPRKLNLGVGAYRTEEGKPYVLKAVREAEQQILAD  81

Query  541  -GENKEYL  561
               NKEYL
Sbjct  82   PAMNKEYL  89



>ref|XP_001731601.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
 gb|EDP44387.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
Length=427

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +1

Query  322  SHGRMRMVATVNVSRFE----GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  489
            S   + M   VN  R++    G+   PPDPILGV+EAFK D D  K+NLGVGAYR E  +
Sbjct  9    SRSTLAMKPVVNSVRYQSVWAGVPAGPPDPILGVTEAFKHDKDPRKINLGVGAYRDEHGK  68

Query  490  PYVLDVVKKAENLMLQRGENKEYL  561
            PYVL  V+KA++ + +   NKEYL
Sbjct  69   PYVLPSVRKADHHIAKSNLNKEYL  92



>gb|EPB81442.1| aspartate aminotransferase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=423

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            +M +   +S +  +   PPD ILGV+EAFK DT   K+NLGVGAYR +  +PYVL  VKK
Sbjct  14   QMASRAFISTWNAVPQGPPDAILGVTEAFKRDTSPKKMNLGVGAYRDDGGKPYVLSSVKK  73

Query  517  AENLMLQRGENKEY  558
            AE LML++  +KEY
Sbjct  74   AEKLMLEKNMDKEY  87



>ref|XP_009870982.1| PREDICTED: LOW QUALITY PROTEIN: aspartate aminotransferase, mitochondrial 
[Apaloderma vittatum]
Length=390

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASKKMDKEYL  60



>ref|XP_009569498.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cuculus 
canorus]
Length=393

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASKKMDKEYL  60



>gb|AEI84600.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84601.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>gb|AEI84595.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84596.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>gb|AEI84591.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84592.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84597.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>gb|AEI84602.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84603.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84604.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84605.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84606.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84607.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>gb|AEI84598.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84599.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>gb|AEI84593.1| mitochondrial aspartate transaminase [Tigriopus californicus]
 gb|AEI84594.1| mitochondrial aspartate transaminase [Tigriopus californicus]
Length=387

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  385  APPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEY  558
             PPDPILGVSEAFK DT+ +K+NLGVGAYR ++ +P+VL  V++AE ++ Q+G NKEY
Sbjct  1    GPPDPILGVSEAFKKDTNPLKMNLGVGAYRDDQGKPFVLPSVREAERIIAQKGLNKEY  58



>ref|XP_001744723.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90672.1| predicted protein [Monosiga brevicollis MX1]
Length=399

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPD ILG++EAFK DT  +K NLGVGAYRT+E +P+VL  V+KAE  +LQ 
Sbjct  6    SVWADVPMGPPDAILGITEAFKKDTSSVKANLGVGAYRTDEGKPFVLSCVRKAEERILQE  65

Query  541  GENKEY  558
              NKEY
Sbjct  66   NLNKEY  71



>emb|CDI81837.1| aspartate aminotransferase, putative [Eimeria acervulina]
Length=188

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 1/70 (1%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            N+S F  + +APPDPILG + AFKAD    K+NLG+GAYRT+E +PYV  VV+KAE  +L
Sbjct  30   NMSLFSSVPVAPPDPILGTALAFKADPSPQKINLGIGAYRTDEGKPYVFSVVRKAEAEIL  89

Query  535  Q-RGENKEYL  561
            +    +KEYL
Sbjct  90   KDESLDKEYL  99



>gb|KFV01058.1| hypothetical protein N339_06116, partial [Pterocles gutturalis]
Length=401

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEATIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>dbj|GAN02936.1| aspartate aminotransferase [Mucor ambiguus]
Length=423

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +1

Query  337  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  516
            +M +   +S +  +   PPD ILGV+EAFK DT   K+NLGVGAYR +  +PYVL  VKK
Sbjct  14   QMASRAFISTWNAVPQGPPDAILGVTEAFKRDTSPKKMNLGVGAYRDDGGKPYVLTSVKK  73

Query  517  AENLMLQRGENKEY  558
            AE LML++  +KEY
Sbjct  74   AERLMLEKNMDKEY  87



>ref|XP_007298245.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92100.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
Length=427

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +1

Query  352  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  531
              VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +
Sbjct  21   AGVSTWSHVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDGNGKPYVLGAVKKAEEAI  80

Query  532  LQRGENKEYL  561
                 +KEYL
Sbjct  81   RASNADKEYL  90



>gb|EPT04274.1| hypothetical protein FOMPIDRAFT_1021952 [Fomitopsis pinicola 
FP-58527 SS1]
Length=425

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +1

Query  346  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  525
            A   +S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR    +PYVL  VKKAE 
Sbjct  18   AAAALSTWSNVPAGPPDPILGVTEAFKADQDSRKINLGVGAYRDGNGKPYVLSSVKKAEE  77

Query  526  LMLQRGENKEYL  561
             +     +KEYL
Sbjct  78   FLTASNPDKEYL  89



>ref|XP_005490808.1| PREDICTED: aspartate aminotransferase, mitochondrial [Zonotrichia 
albicollis]
Length=422

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  23   SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  82

Query  541  GENKEYL  561
              +KEYL
Sbjct  83   KMDKEYL  89



>gb|KFO63074.1| hypothetical protein N302_07001, partial [Corvus brachyrhynchos]
Length=401

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KFV54532.1| hypothetical protein N341_00606, partial [Tyto alba]
Length=401

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPFVLNCVRKAEAMIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|XP_008175935.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Chrysemys picta bellii]
Length=429

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +1

Query  301  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  480
            L   A + H  +  VA    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  10   LLSAAAQRHLCLAPVAARASSWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDD  69

Query  481  ELQPYVLDVVKKAENLMLQRGENKEYL  561
              +P+VL+ V+KAE  +  +  +KEYL
Sbjct  70   NGKPFVLNSVRKAEAQIAAKKMDKEYL  96



>gb|KFV73576.1| hypothetical protein N308_13552, partial [Struthio camelus australis]
Length=401

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIASK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>ref|XP_002126101.1| PREDICTED: aspartate aminotransferase, mitochondrial [Ciona intestinalis]
Length=425

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = +1

Query  295  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  474
            C+L    +  H  +        S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR
Sbjct  10   CSLLQKCSVGHRSLNRTG----SWWSNVEMGPPDPILGVTEAFKRDTNPKKMNLGVGAYR  65

Query  475  TEELQPYVLDVVKKAENLMLQRGENKEYL  561
             ++ +PYVL  VKKAE L +Q G +KEYL
Sbjct  66   DDQGKPYVLPTVKKAE-LAIQ-GLDKEYL  92



>gb|KFU92658.1| hypothetical protein M959_01402, partial [Chaetura pelagica]
Length=401

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++   
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASN  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|KIO08228.1| hypothetical protein M404DRAFT_997154 [Pisolithus tinctorius 
Marx 270]
Length=424

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  346  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  525
            +T ++S +  +   PPD ILG++EAFKAD D  K+NLGVGAYR E  +PYVL+VVKKAE 
Sbjct  16   STASLSTWGAVPAGPPDAILGITEAFKADKDPRKINLGVGAYRDENGKPYVLNVVKKAEE  75

Query  526  LMLQRGENKEYL  561
             +     +KEYL
Sbjct  76   RITAAKMDKEYL  87



>ref|XP_009583475.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Fulmarus glacialis]
Length=301

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>dbj|GAA98712.1| hypothetical protein E5Q_05400 [Mixia osmundae IAM 14324]
 gb|KEI41895.1| hypothetical protein L969DRAFT_91367 [Mixia osmundae IAM 14324]
Length=427

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            V  +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  V+KAE  ++ 
Sbjct  27   VKTWANVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDENGKPYVLPSVRKAEEAVIA  86

Query  538  RGENKEYL  561
            +  +KEYL
Sbjct  87   KKGDKEYL  94



>ref|XP_004317705.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tursiops 
truncatus]
Length=430

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +1

Query  376  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  555
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL VV+KAE  +  R  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPVVRKAEAQIAARNLDKE  95

Query  556  YL  561
            YL
Sbjct  96   YL  97



>gb|AID18683.1| aspartate aminotransferase [Fenneropenaeus chinensis]
Length=427

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  319  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  498
            ++   ++ V +   S + G+ M PPD ILGV+EAFK DT+  K+NLGVGAYR +  +P+V
Sbjct  14   QNQASIQHVCSRASSWWSGVEMGPPDAILGVTEAFKRDTNPKKMNLGVGAYRDDNGKPFV  73

Query  499  LDVVKKAENLMLQRGENKEYL  561
            L  V+KAE L++ +  +KEYL
Sbjct  74   LPSVRKAEELIVSQKLDKEYL  94



>gb|KGL84885.1| hypothetical protein N309_05764, partial [Tinamus guttatus]
Length=401

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIAAK  61

Query  541  GENKEYL  561
              +KEYL
Sbjct  62   KMDKEYL  68



>gb|ACN40894.1| unknown [Picea sitchensis]
Length=462

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +1

Query  277  LREYGQCTLFGNATKSHGRMRMVATVN--VSRFEGISMAPPDPILGVSEAFKADTDEMKL  450
            +R+    ++ G A +  G +R   T    VS F+ +  AP DPILGV+ A+  D   +KL
Sbjct  31   VRQLAATSMEGQADRD-GDLRFQPTAGSAVSAFQHLEQAPEDPILGVTVAYNKDPSPVKL  89

Query  451  NLGVGAYRTEELQPYVLDVVKKAENLMLQ-RGENKEYL  561
            NLGVGAYRTEE +P VLDVV++AE L++Q R   KEY+
Sbjct  90   NLGVGAYRTEEGKPLVLDVVRQAEELLIQDRSRYKEYI  127



>gb|KIL70778.1| hypothetical protein M378DRAFT_183367 [Amanita muscaria Koide 
BX008]
Length=424

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR    +PYVL+ VKKAE ++ 
Sbjct  19   SISCWSAVPAGPPDPILGVTEAFKADKDPKKINLGVGAYRDGAGKPYVLNSVKKAEEIVK  78

Query  535  QRGENKEYL  561
                +KEYL
Sbjct  79   ASNPDKEYL  87



>ref|XP_007852807.1| aspartate aminotransferase [Moniliophthora roreri MCA 2997]
 gb|ESK87894.1| aspartate aminotransferase [Moniliophthora roreri MCA 2997]
Length=427

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  355  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  534
            ++S +  ++  PPD ILGV+EAFKAD D  K+NLGVGAYR +  +PYVL  VKKAE+L+ 
Sbjct  22   SISVWSSVAAGPPDSILGVTEAFKADKDPRKINLGVGAYRDDNGKPYVLPSVKKAEDLVA  81

Query  535  QRGENKEYL  561
                +KEYL
Sbjct  82   SSKPDKEYL  90



>gb|KIK43563.1| hypothetical protein CY34DRAFT_803728 [Suillus luteus UH-Slu-Lm8-n1]
Length=424

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILG++EAFKAD D  ++NLGVGAYR E+ +PYVL+ VKKAE  +  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDSRRINLGVGAYRDEDGKPYVLNAVKKAEEKITA  79

Query  538  RGENKEYL  561
               +KEYL
Sbjct  80   AKLDKEYL  87



>emb|CCM01943.1| predicted protein [Fibroporia radiculosa]
Length=423

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  537
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADQDSKKINLGVGAYRDGNGKPYVLSSVKKAEEYLSA  81

Query  538  RGENKEYL  561
               +KEYL
Sbjct  82   ANPDKEYL  89



>gb|ABR16105.1| unknown [Picea sitchensis]
Length=424

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  331  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  510
            R +  A   VS F+ +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VLDVV
Sbjct  12   RFQPTAGSAVSAFQHLEQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLDVV  71

Query  511  KKAENLMLQ-RGENKEYL  561
            ++AE L++Q R   KEY+
Sbjct  72   RQAEELLIQDRSRYKEYI  89



>ref|XP_008944416.1| PREDICTED: aspartate aminotransferase, mitochondrial [Merops 
nubicus]
Length=393

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASKKMDKEYL  60



>gb|KJA29187.1| hypothetical protein HYPSUDRAFT_32564 [Hypholoma sublateritium 
FD-334 SS-4]
Length=424

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +1

Query  313  ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQP  492
            A +S    R V +++V  +  +   PPD ILG++EAFKAD D  K+NLGVGAYR E  +P
Sbjct  7    ARRSVASARCVRSLSV--WSNVQAGPPDAILGITEAFKADKDPRKINLGVGAYRDENGKP  64

Query  493  YVLDVVKKAENLMLQRGENKEYL  561
            Y+L  V+KAE ++L    NKEYL
Sbjct  65   YILPSVQKAEEIVLASVPNKEYL  87



>gb|KIR44346.1| aspartate aminotransferase [Cryptococcus gattii CA1280]
 gb|KIR57424.1| aspartate aminotransferase [Cryptococcus gattii CA1873]
Length=406

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  367  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  546
            + G+   PPDPILGV++AFK DT   K+NLGVGAYR E+ +PY+LD V KAE+++ ++  
Sbjct  7    WAGVPEGPPDPILGVTDAFKKDTSSKKVNLGVGAYRDEDGKPYILDSVLKAEDILHKKKL  66

Query  547  NKEYL  561
            +KEYL
Sbjct  67   DKEYL  71



>ref|XP_006109334.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Myotis lucifugus]
Length=177

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  ++KAE  +  +
Sbjct  9    SWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSIRKAEAQIAAK  68

Query  541  GENKEYL  561
              +KEYL
Sbjct  69   NLDKEYL  75



>ref|XP_010138136.1| PREDICTED: aspartate aminotransferase, mitochondrial [Buceros 
rhinoceros silvestris]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>ref|XP_005229254.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco peregrinus]
 ref|XP_005440356.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco cherrug]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>ref|XP_009641563.1| PREDICTED: aspartate aminotransferase, mitochondrial [Egretta 
garzetta]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>ref|XP_009078129.1| PREDICTED: aspartate aminotransferase, mitochondrial [Acanthisitta 
chloris]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>gb|AFR98265.1| aspartate aminotransferase [Cryptococcus neoformans var. grubii 
H99]
Length=413

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  367  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  546
            + G+   PPDPILGV++AFK DT   K+NLGVGAYR E+ +PYVLD V KAE+++ ++  
Sbjct  7    WAGVPEGPPDPILGVTDAFKKDTSPKKVNLGVGAYRDEDGKPYVLDSVLKAEDILHKKKL  66

Query  547  NKEYL  561
            +KEYL
Sbjct  67   DKEYL  71



>ref|XP_009697580.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cariama 
cristata]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>ref|XP_772230.1| hypothetical protein CNBM0360 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL17583.1| hypothetical protein CNBM0360 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=416

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +1

Query  367  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  546
            + G+   PPDPILGV++AFK DT   K+NLGVGAYR E+ +PYVLD V KAE+++ ++  
Sbjct  7    WAGVPEGPPDPILGVTDAFKKDTSPKKVNLGVGAYRDEDGKPYVLDSVLKAEDILHKKKL  66

Query  547  NKEYL  561
            +KEYL
Sbjct  67   DKEYL  71



>ref|XP_007256293.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Astyanax 
mexicanus]
Length=428

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  361  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  540
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +PYVL  V+KAE  +  +
Sbjct  29   SWWTDVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPYVLSCVRKAEAQIAAK  88

Query  541  GENKEYL  561
              +KEYL
Sbjct  89   SLDKEYL  95



>ref|XP_010298153.1| PREDICTED: aspartate aminotransferase, mitochondrial [Balearica 
regulorum gibbericeps]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60



>ref|XP_010013669.1| PREDICTED: aspartate aminotransferase, mitochondrial [Nestor 
notabilis]
Length=393

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  382  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  561
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASKKMDKEYL  60



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880