BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031H04

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612875.1|  PREDICTED: importin subunit alpha-2                178   2e-51   Nicotiana tomentosiformis
ref|XP_002279724.1|  PREDICTED: importin subunit alpha-2                184   3e-51   Vitis vinifera
gb|KDO48094.1|  hypothetical protein CISIN_1g0096471mg                  178   5e-51   Citrus sinensis [apfelsine]
ref|XP_006428837.1|  hypothetical protein CICLE_v10011496mg             177   6e-49   Citrus clementina [clementine]
ref|XP_008387618.1|  PREDICTED: importin subunit alpha-2-like           173   7e-49   
ref|XP_006339060.1|  PREDICTED: importin subunit alpha-2-like           175   3e-48   Solanum tuberosum [potatoes]
gb|KDP29087.1|  hypothetical protein JCGZ_16476                         175   4e-48   Jatropha curcas
ref|XP_004249499.1|  PREDICTED: importin subunit alpha-2                173   3e-47   
ref|XP_008387624.1|  PREDICTED: importin subunit alpha-2-like           172   5e-47   
ref|XP_007027273.1|  Importin subunit alpha-2 isoform 2                 171   1e-46   
emb|CAN61727.1|  hypothetical protein VITISV_032422                     171   2e-46   Vitis vinifera
ref|XP_009358163.1|  PREDICTED: importin subunit alpha-2-like           171   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_007027272.1|  Importin alpha isoform 1                           170   4e-46   
ref|XP_009342579.1|  PREDICTED: importin subunit alpha-2-like           169   5e-46   Pyrus x bretschneideri [bai li]
gb|KHG28931.1|  hypothetical protein F383_14389                         169   8e-46   Gossypium arboreum [tree cotton]
gb|KJB11224.1|  hypothetical protein B456_001G248100                    169   1e-45   Gossypium raimondii
ref|XP_008345418.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    166   2e-45   
ref|XP_009783203.1|  PREDICTED: importin subunit alpha-2                167   3e-45   Nicotiana sylvestris
ref|XP_008239299.1|  PREDICTED: importin subunit alpha-2                165   3e-44   Prunus mume [ume]
ref|XP_010696399.1|  PREDICTED: importin subunit alpha-2                165   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006398757.1|  hypothetical protein EUTSA_v10013263mg             163   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_007204998.1|  hypothetical protein PRUPE_ppa004234mg             163   1e-43   Prunus persica
ref|XP_002323457.1|  hypothetical protein POPTR_0016s08790g             163   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004304406.1|  PREDICTED: importin subunit alpha-9                163   1e-43   Fragaria vesca subsp. vesca
ref|XP_002525173.1|  Importin alpha-2 subunit, putative                 162   2e-43   Ricinus communis
gb|KHN48318.1|  Importin subunit alpha-2                                156   3e-43   Glycine soja [wild soybean]
ref|XP_010490774.1|  PREDICTED: LOW QUALITY PROTEIN: importin sub...    162   4e-43   
ref|XP_010037940.1|  PREDICTED: importin subunit alpha-2                161   8e-43   Eucalyptus grandis [rose gum]
ref|XP_007144541.1|  hypothetical protein PHAVU_007G164500g             160   8e-43   Phaseolus vulgaris [French bean]
ref|XP_010107576.1|  Importin subunit alpha-2                           159   2e-42   
ref|XP_011006955.1|  PREDICTED: importin subunit alpha-2                159   5e-42   Populus euphratica
emb|CAB86074.1|  importin alpha-like protein                            158   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536981.2|  PREDICTED: importin subunit alpha-2-like           151   6e-42   
ref|NP_195927.2|  importin alpha isoform 9                              158   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KEH42271.1|  importin subunit alpha-like protein                     158   7e-42   Medicago truncatula
gb|KHN39102.1|  Importin subunit alpha-2                                152   9e-42   Glycine soja [wild soybean]
ref|XP_002873075.1|  binding protein                                    157   2e-41   
gb|KDO48095.1|  hypothetical protein CISIN_1g0096471mg                  154   2e-41   Citrus sinensis [apfelsine]
emb|CDY55698.1|  BnaC02g03390D                                          157   2e-41   Brassica napus [oilseed rape]
ref|XP_009125477.1|  PREDICTED: importin subunit alpha-2-like           156   4e-41   Brassica rapa
ref|XP_010423779.1|  PREDICTED: importin subunit alpha-2-like           156   4e-41   Camelina sativa [gold-of-pleasure]
gb|KFK24759.1|  hypothetical protein AALP_AA8G021400                    155   7e-41   Arabis alpina [alpine rockcress]
ref|XP_006289370.1|  hypothetical protein CARUB_v10002864mg             155   9e-41   Capsella rubella
emb|CDY04878.1|  BnaAnng00600D                                          155   1e-40   
ref|XP_010452168.1|  PREDICTED: importin subunit alpha-2-like           154   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010543379.1|  PREDICTED: importin subunit alpha-2                154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_003542503.1|  PREDICTED: importin subunit alpha-2-like iso...    151   2e-39   
ref|XP_003542502.1|  PREDICTED: importin subunit alpha-2-like iso...    151   2e-39   Glycine max [soybeans]
ref|XP_006594124.1|  PREDICTED: importin subunit alpha-2-like iso...    151   2e-39   
ref|XP_004497474.1|  PREDICTED: importin subunit alpha-2-like           151   3e-39   Cicer arietinum [garbanzo]
ref|XP_011077370.1|  PREDICTED: importin subunit alpha-2                150   5e-39   Sesamum indicum [beniseed]
gb|KDP29088.1|  hypothetical protein JCGZ_16477                         139   2e-38   Jatropha curcas
ref|XP_008449812.1|  PREDICTED: importin subunit alpha-2 isoform X1     147   1e-37   Cucumis melo [Oriental melon]
ref|XP_010920895.1|  PREDICTED: importin subunit alpha-2 isoform X1     145   3e-37   Elaeis guineensis
ref|XP_010920896.1|  PREDICTED: importin subunit alpha-2 isoform X2     145   3e-37   
ref|XP_010245001.1|  PREDICTED: importin subunit alpha-2-like           141   6e-37   Nelumbo nucifera [Indian lotus]
gb|EYU38519.1|  hypothetical protein MIMGU_mgv1a004564mg                136   4e-34   Erythranthe guttata [common monkey flower]
ref|XP_004142168.1|  PREDICTED: importin subunit alpha-2-like           136   4e-34   
ref|XP_008793530.1|  PREDICTED: importin subunit alpha-2                135   9e-34   Phoenix dactylifera
ref|XP_004162005.1|  PREDICTED: importin subunit alpha-2-like           131   4e-32   
ref|XP_009421388.1|  PREDICTED: importin subunit alpha-2                126   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004968263.1|  PREDICTED: importin subunit alpha-2-like           121   1e-28   Setaria italica
ref|XP_006836482.1|  hypothetical protein AMTR_s00108p00104150          118   2e-27   
ref|NP_001147773.1|  importin alpha-2 subunit                           116   7e-27   Zea mays [maize]
gb|ACN31641.1|  unknown                                                 115   2e-26   Zea mays [maize]
emb|CDP06714.1|  unnamed protein product                                114   7e-26   Coffea canephora [robusta coffee]
gb|EPS72639.1|  hypothetical protein M569_02116                         113   7e-26   Genlisea aurea
ref|XP_002457309.1|  hypothetical protein SORBIDRAFT_03g005380          110   1e-24   Sorghum bicolor [broomcorn]
gb|EAZ10619.1|  hypothetical protein OsJ_00451                          108   4e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA31220.1|  unnamed protein product                                108   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042074.1|  Os01g0158000                                       108   5e-24   
gb|EEC69979.1|  hypothetical protein OsI_00484                          108   6e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_003567730.1|  PREDICTED: importin subunit alpha-2                108   7e-24   Brachypodium distachyon [annual false brome]
gb|EMT10396.1|  Importin subunit alpha-2                                107   2e-23   
gb|EMS52684.1|  Importin subunit alpha-2                                107   2e-23   Triticum urartu
emb|CDM81997.1|  unnamed protein product                                106   3e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006643773.1|  PREDICTED: importin subunit alpha-2-like           106   3e-23   Oryza brachyantha
ref|XP_008449813.1|  PREDICTED: importin subunit alpha-2 isoform X2   80.5    3e-14   Cucumis melo [Oriental melon]
ref|XP_001775435.1|  predicted protein                                66.6    2e-09   
emb|CDY10407.1|  BnaCnng03080D                                        64.3    9e-09   Brassica napus [oilseed rape]
ref|XP_001758629.1|  predicted protein                                60.5    2e-07   
ref|XP_002985897.1|  hypothetical protein SELMODRAFT_123107           54.3    2e-05   
ref|XP_002976434.1|  hypothetical protein SELMODRAFT_105015           53.5    3e-05   



>ref|XP_009612875.1| PREDICTED: importin subunit alpha-2 [Nicotiana tomentosiformis]
Length=267

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADEG  S+KRDPIKSSVGN AAQ+RR++AV+VGKERRE LMRTKRLCRVG++GDSD A 
Sbjct  1    MADEGLISYKRDPIKSSVGNAAAQKRRQHAVSVGKERREALMRTKRLCRVGVSGDSDDAS  60

Query  368  --EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              + DMMI+EEQSILE +TSSAV+ELKLAVA+QGKG  QKRVNALRELRRLLS+SEFPPV
Sbjct  61   LDDGDMMIEEEQSILEARTSSAVDELKLAVAYQGKGETQKRVNALRELRRLLSKSEFPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            E AL AGA+PLL++CLSFGS
Sbjct  121  EVALQAGAIPLLIQCLSFGS  140



>ref|XP_002279724.1| PREDICTED: importin subunit alpha-2 [Vitis vinifera]
 emb|CBI32701.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+G ASH+RDPIKSSVGN AA RRR+ A+TVGKERRE L+RTKRLCRVGI+GDSDV  
Sbjct  1    MADDGLASHRRDPIKSSVGNVAANRRRQQAITVGKERREALVRTKRLCRVGISGDSDVPV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            + DMMIDEEQSILE QTSSAVEELK  V +QGKGA+QKRV+ALR+LRRLLSRSEFPP+EA
Sbjct  61   DGDMMIDEEQSILETQTSSAVEELKSTVIYQGKGAMQKRVSALRDLRRLLSRSEFPPIEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+ +LV+CLSFGS
Sbjct  121  ALKAGAVSVLVQCLSFGS  138



>gb|KDO48094.1| hypothetical protein CISIN_1g0096471mg, partial [Citrus sinensis]
Length=315

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+    HKRDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG + D +V+ 
Sbjct  1    MADDSLNHHKRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGTSADGEVSS  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            ++DMM+DEEQSILE QTSSAVEELK AVA+ GKGA+QKRVNALRELRRLLSR EFPP+E 
Sbjct  61   DSDMMVDEEQSILEMQTSSAVEELKSAVAYHGKGAMQKRVNALRELRRLLSRFEFPPIET  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+P+LV+CL+FGS
Sbjct  121  ALKAGAIPVLVQCLAFGS  138



>ref|XP_006428837.1| hypothetical protein CICLE_v10011496mg [Citrus clementina]
 ref|XP_006480649.1| PREDICTED: importin subunit alpha-2-like [Citrus sinensis]
 gb|ESR42077.1| hypothetical protein CICLE_v10011496mg [Citrus clementina]
Length=518

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+    HKRDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG + D +V+ 
Sbjct  1    MADDSLNHHKRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGTSADGEVSS  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            ++DMM+DEEQSILE QTSSAVEELK AVA+ GKGA+QKRVNALRELRRLLSR EFPP+E 
Sbjct  61   DSDMMVDEEQSILEMQTSSAVEELKSAVAYHGKGAMQKRVNALRELRRLLSRFEFPPIET  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+P+LV+CL+FGS
Sbjct  121  ALKAGAIPVLVQCLAFGS  138



>ref|XP_008387618.1| PREDICTED: importin subunit alpha-2-like [Malus domestica]
Length=334

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADE  ASH+RDPIKSSV N A QRRR+ AV+VGKERRE L+R KRLCRVGI+GDSD   
Sbjct  1    MADESMASHRRDPIKSSVANVAGQRRRQQAVSVGKERRELLVRAKRLCRVGISGDSDDXV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            E++M+IDEEQSILE QTSSAVE LK AVA+QGKGA++KRV+ALRELRRLLSRSEFPPVEA
Sbjct  61   ESEMIIDEEQSILEAQTSSAVEGLKSAVAYQGKGALEKRVSALRELRRLLSRSEFPPVEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AG +PLLV+CLSFGS
Sbjct  121  ALKAGVIPLLVQCLSFGS  138



>ref|XP_006339060.1| PREDICTED: importin subunit alpha-2-like [Solanum tuberosum]
Length=520

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADEG  SHKRDPIK+SVGN AAQRRR++AVTVGKERRE LMRTKRLCRVG++GD D A 
Sbjct  1    MADEGLVSHKRDPIKASVGNAAAQRRRQHAVTVGKERREALMRTKRLCRVGVSGDFDEAS  60

Query  368  --EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              ++DMMI+E+Q+ILE  TS+AVEELKL VA+QGKGA +KRVNALRELRR LSRSEFPPV
Sbjct  61   IDDSDMMIEEDQAILEALTSAAVEELKLDVAYQGKGATEKRVNALRELRRFLSRSEFPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            EAAL AGA+PLL++CLSFGS
Sbjct  121  EAALQAGAIPLLIQCLSFGS  140



>gb|KDP29087.1| hypothetical protein JCGZ_16476 [Jatropha curcas]
Length=518

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MA++G ASH+RDPIKSSVGN AAQ+RR+NAV VGKERRE+L+R KRLCRVG +GD D  P
Sbjct  1    MAEDGLASHRRDPIKSSVGNVAAQKRRQNAVAVGKERRESLVRAKRLCRVGTSGDIDTPP  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            ++DM+IDEEQSILE QT++AV+ELK A+A QGKGA+QK+V ALRELRRLLSRSEFPP+EA
Sbjct  61   DSDMIIDEEQSILEAQTTTAVDELKSAIAFQGKGAIQKKVGALRELRRLLSRSEFPPIEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+PLLV+CLSFGS
Sbjct  121  ALKAGAIPLLVQCLSFGS  138



>ref|XP_004249499.1| PREDICTED: importin subunit alpha-2 [Solanum lycopersicum]
Length=520

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADEG  SHKRDPIK+SVGN AAQRRR++AVTVGKERRE LMRTKRLCRVG++ D D A 
Sbjct  1    MADEGLVSHKRDPIKASVGNAAAQRRRQHAVTVGKERREALMRTKRLCRVGVSADFDEAS  60

Query  368  --EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              ++DMMI+E+Q+ILE  TS+AVEELKL VA+QGKGA +KRVNALRELRR LSRSEFPPV
Sbjct  61   MDDSDMMIEEDQAILEALTSAAVEELKLDVAYQGKGATEKRVNALRELRRFLSRSEFPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            EAAL AG +PLL++CLSFGS
Sbjct  121  EAALQAGVIPLLIQCLSFGS  140



>ref|XP_008387624.1| PREDICTED: importin subunit alpha-2-like [Malus domestica]
 ref|XP_008359653.1| PREDICTED: importin subunit alpha-2-like [Malus domestica]
Length=521

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADE  ASH+RDPIKSSV N A QRRR+ AV+VGKERRE L+R KRLCRVGI+GDSD   
Sbjct  1    MADESMASHRRDPIKSSVANVAGQRRRQQAVSVGKERRELLVRAKRLCRVGISGDSDDXV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            E++M+IDEEQSILE QTSSAVE LK AVA+QGKGA++KRV+ALRELRRLLSRSEFPPVEA
Sbjct  61   ESEMIIDEEQSILEAQTSSAVEGLKSAVAYQGKGALEKRVSALRELRRLLSRSEFPPVEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AG +PLLV+CLSFGS
Sbjct  121  ALKAGVIPLLVQCLSFGS  138



>ref|XP_007027273.1| Importin subunit alpha-2 isoform 2 [Theobroma cacao]
 gb|EOY07775.1| Importin subunit alpha-2 isoform 2 [Theobroma cacao]
Length=483

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+ AASH+RDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG + D DV  
Sbjct  1    MADDSAASHRRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGPSADGDVPV  60

Query  368  EA-DMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
            E  DM+ DEE+ +LE QTSSAVE+LK  VA+QGKGA+QKRVNALRELRRLLS+SEFPP+E
Sbjct  61   EGNDMITDEEEFLLEAQTSSAVEDLKSTVAYQGKGAMQKRVNALRELRRLLSKSEFPPIE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALKAGAIPLLVQCLSFGS  139



>emb|CAN61727.1| hypothetical protein VITISV_032422 [Vitis vinifera]
Length=530

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 123/155 (79%), Gaps = 17/155 (11%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSS-----------------VGNTAAQRRRENAVTVGKERRETLMR  316
            MAD+G ASH+RDPIKSS                  GN AA RRR+ A+TVGKERRE L+R
Sbjct  1    MADDGLASHRRDPIKSSGIFTFILTIVSLSLPSPFGNVAANRRRQQAITVGKERREALVR  60

Query  317  TKRLCRVGITGDSDVAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAl  496
            TKRLCRVGI+GDSDV  + DMMIDEEQSILE QTSSAVEELK  V +QGKGA+QKRV+AL
Sbjct  61   TKRLCRVGISGDSDVPVDGDMMIDEEQSILETQTSSAVEELKSTVIYQGKGAMQKRVSAL  120

Query  497  relrrllsrseFPPVEaalxagalpllVKCLSFGS  601
            R+LRRLLSRSEFPP+EAAL AGA+ +LV+CLSFGS
Sbjct  121  RDLRRLLSRSEFPPIEAALKAGAVSVLVQCLSFGS  155



>ref|XP_009358163.1| PREDICTED: importin subunit alpha-2-like [Pyrus x bretschneideri]
Length=521

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+  ASH+RDPIKSSV N A QRRR+ AV+VGKERRE+L+R KRLCRVGI+GDSD   
Sbjct  1    MADDNTASHRRDPIKSSVANVAGQRRRQQAVSVGKERRESLVRAKRLCRVGISGDSDDTV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            +++M+IDEEQSILE QTSSAVE LK  VA+QGKGA+QKRV+AL ELRRLLSRSEFPPVEA
Sbjct  61   DSEMIIDEEQSILEAQTSSAVEGLKSVVAYQGKGALQKRVSALHELRRLLSRSEFPPVEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+PLLV+CLSFGS
Sbjct  121  ALKAGAIPLLVQCLSFGS  138



>ref|XP_007027272.1| Importin alpha isoform 1 [Theobroma cacao]
 gb|EOY07774.1| Importin alpha isoform 1 [Theobroma cacao]
Length=519

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+ AASH+RDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG + D DV  
Sbjct  1    MADDSAASHRRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGPSADGDVPV  60

Query  368  EA-DMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
            E  DM+ DEE+ +LE QTSSAVE+LK  VA+QGKGA+QKRVNALRELRRLLS+SEFPP+E
Sbjct  61   EGNDMITDEEEFLLEAQTSSAVEDLKSTVAYQGKGAMQKRVNALRELRRLLSKSEFPPIE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALKAGAIPLLVQCLSFGS  139



>ref|XP_009342579.1| PREDICTED: importin subunit alpha-2-like [Pyrus x bretschneideri]
Length=521

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADE  ASH+RDPIKSSV   A QRRR+ AV++GKERRE L+R KRLCRVGI+GDSD   
Sbjct  1    MADESMASHRRDPIKSSVATVAGQRRRQQAVSIGKERRELLVRAKRLCRVGISGDSDDTV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            E++M+IDEEQSILE QTSSAVE LK AVA+QGKGA++KRV+ALRELRRLLSRSEFPPVEA
Sbjct  61   ESEMIIDEEQSILEAQTSSAVEGLKSAVAYQGKGALEKRVSALRELRRLLSRSEFPPVEA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AG +PLLV+CLSFGS
Sbjct  121  ALKAGVIPLLVQCLSFGS  138



>gb|KHG28931.1| hypothetical protein F383_14389 [Gossypium arboreum]
Length=519

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV-A  364
            MAD+  ASH+RDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG +GD DV  
Sbjct  1    MADDSPASHRRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGPSGDGDVPG  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E DM+ DEE  +L+ QTSSAVE+LK A+A+QGKGA+QKRVNALRELRRLLS+SEFPPVE
Sbjct  61   EENDMVTDEEGFLLDAQTSSAVEDLKSAIAYQGKGAMQKRVNALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALKAGAIPLLVQCLSFGS  139



>gb|KJB11224.1| hypothetical protein B456_001G248100 [Gossypium raimondii]
Length=519

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV-A  364
            MAD+  ASH+RDPIKSSVGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG +GD DV  
Sbjct  1    MADDSPASHRRDPIKSSVGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGPSGDGDVPG  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E DM+ DEE  +L+ QTSSAVE+LK A+A+QGKGA+QKRVNALRELRRLLS+SEFPP+E
Sbjct  61   EENDMVTDEEGFLLDAQTSSAVEDLKSAIAYQGKGAMQKRVNALRELRRLLSKSEFPPIE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALKAGAIPLLVQCLSFGS  139



>ref|XP_008345418.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-2-like 
[Malus domestica]
Length=399

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+  ASH+RDPIKSSV N A QRRR  AV+VGKERRE+L+R KRLCRVGI+GDSD   
Sbjct  1    MADDTMASHRRDPIKSSVANVAGQRRRXQAVSVGKERRESLVRAKRLCRVGISGDSDDTV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            + +M+IDEEQSIL+ QTSSAVE LK AVA+QGKGA+QK+V ALRELRRLLSRSEFPPVE 
Sbjct  61   DGEMIIDEEQSILDAQTSSAVEGLKSAVAYQGKGALQKKVXALRELRRLLSRSEFPPVEV  120

Query  548  alxagalpllVKCLSFGS  601
             L AGA+PLLV+C SFGS
Sbjct  121  VLQAGAIPLLVQCFSFGS  138



>ref|XP_009783203.1| PREDICTED: importin subunit alpha-2 [Nicotiana sylvestris]
Length=520

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG--DSDV  361
            MADEG  SHKR+PIKSSVGN AAQ+RR++AVTVGKERRE LMRTKRLCRVG++G  D   
Sbjct  1    MADEGLISHKREPIKSSVGNAAAQKRRQHAVTVGKERREALMRTKRLCRVGVSGDSDDAS  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              +ADMMI+EEQSILE +TSSAV+ELKLAVA+QGKG  QKRVNALRELRRLLS+SEFPPV
Sbjct  61   LDDADMMIEEEQSILEARTSSAVDELKLAVAYQGKGETQKRVNALRELRRLLSKSEFPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            E AL AGA+PLL++CLSFGS
Sbjct  121  EVALQAGAIPLLIQCLSFGS  140



>ref|XP_008239299.1| PREDICTED: importin subunit alpha-2 [Prunus mume]
Length=522

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEG-AASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVA  364
            MAD+  A  H+R+P+KSSV N A QRRR+ A+T+GKERRE+L+R KRLCRVG +GD DV 
Sbjct  1    MADDNIAPPHRREPVKSSVANVAGQRRRQQAITIGKERRESLVRAKRLCRVGTSGDPDVP  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
              ++MMIDEEQSILE QTSSAVEELK AVA+QGKGA+QK+V+ALRELRRLLSRSEFPPVE
Sbjct  61   SNSEMMIDEEQSILEAQTSSAVEELKSAVAYQGKGALQKKVSALRELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALVAGAIPLLVQCLSFGS  139



>ref|XP_010696399.1| PREDICTED: importin subunit alpha-2 [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD   ASHKRDPIKSSVGN A QRRR+NAV V KERRETL+RTKRLCR GI GD     
Sbjct  1    MADGSLASHKRDPIKSSVGNLATQRRRQNAVVVAKERRETLIRTKRLCRTGIGGDDVGET  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            +ADMM+DEE SILE QTSSAVEELK AV +QGKGA+ KRV+ALRELRRLLSRSE PPV+ 
Sbjct  61   DADMMLDEEPSILEAQTSSAVEELKAAVVYQGKGALMKRVSALRELRRLLSRSELPPVDV  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+P+LV+CLSFGS
Sbjct  121  ALKAGAIPVLVQCLSFGS  138



>ref|XP_006398757.1| hypothetical protein EUTSA_v10013263mg [Eutrema salsugineum]
 gb|ESQ40210.1| hypothetical protein EUTSA_v10013263mg [Eutrema salsugineum]
Length=519

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDS-DVA  364
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGDDEDAL  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MMIDEEQ ILE QTS AVEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPP+E
Sbjct  61   VENEMMIDEEQPILEAQTSKAVEELKSAVQYQGKGAIQKRVTALRELRRLLSKSEFPPIE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>ref|XP_007204998.1| hypothetical protein PRUPE_ppa004234mg [Prunus persica]
 gb|EMJ06197.1| hypothetical protein PRUPE_ppa004234mg [Prunus persica]
Length=522

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEG-AASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVA  364
            MAD+  A  H+R+P+KSSV N A QRRR+ A+T+GKERRE+L+R KRLCRVG +GD DV 
Sbjct  1    MADDNMAPPHRREPVKSSVVNLAGQRRRQQAITIGKERRESLVRAKRLCRVGTSGDPDVP  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             +++MMIDE+QSILE QTSSAVEELK AVA+QGKGA+QK+V+ALRELRRLLSRSEFPPVE
Sbjct  61   SDSEMMIDEDQSILEAQTSSAVEELKSAVAYQGKGALQKKVSALRELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALKAGAIPLLVQCLSFGS  139



>ref|XP_002323457.1| hypothetical protein POPTR_0016s08790g [Populus trichocarpa]
 gb|EEF05218.1| hypothetical protein POPTR_0016s08790g [Populus trichocarpa]
Length=522

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGIT-GDSDVA  364
            MA++G   H+RDPIKSSVGN AA RRR+NAV VGKERRE+L+R KRLCRVG +  DSD++
Sbjct  1    MAEDGLNPHRRDPIKSSVGNVAAHRRRQNAVAVGKERRESLVRAKRLCRVGPSCDDSDIS  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E DM+IDEEQSILE QTSSAVEELK AV+ QGKGA+QK V ALRE+RRLLS+SEFPPVE
Sbjct  61   IENDMIIDEEQSILEAQTSSAVEELKSAVSFQGKGAMQKLVGALREMRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AA+ AGA+PLLV+CLSFGS
Sbjct  121  AAIKAGAIPLLVQCLSFGS  139



>ref|XP_004304406.1| PREDICTED: importin subunit alpha-9 [Fragaria vesca subsp. vesca]
Length=521

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+  AS +RDPIKSSVGN A QRRR+NA+TVGKERRE+L+R KRLCR G  GDS    
Sbjct  1    MADDTTASQRRDPIKSSVGNVAGQRRRQNAITVGKERRESLIRAKRLCREGTNGDSVDPF  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            + +MMID+EQ ILE QTS+AVEELK AVAHQGKGA QKRV+ LR LRRLLSRSEFPPV+A
Sbjct  61   DGEMMIDQEQPILEAQTSAAVEELKSAVAHQGKGAWQKRVSTLRALRRLLSRSEFPPVDA  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+PLLV+CLSFGS
Sbjct  121  ALKAGAVPLLVQCLSFGS  138



>ref|XP_002525173.1| Importin alpha-2 subunit, putative [Ricinus communis]
 gb|EEF37139.1| Importin alpha-2 subunit, putative [Ricinus communis]
Length=517

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 4/138 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MA+EG  S KR+PIKSSVGN AAQ+R++NAV VGKERRE+L+R KRLCRVG +GDSD   
Sbjct  1    MAEEGLTSLKREPIKSSVGNVAAQKRKQNAVAVGKERRESLVRAKRLCRVGTSGDSD---  57

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
             ++M+IDEEQSIL+ QTSSAVEELK AVA QGKGA+QK+V ALRELRRLLSRSEFPP+EA
Sbjct  58   -SEMIIDEEQSILDAQTSSAVEELKSAVAFQGKGAMQKKVGALRELRRLLSRSEFPPIEA  116

Query  548  alxagalpllVKCLSFGS  601
            A+ AGA+ LLV+CLSFGS
Sbjct  117  AIKAGAIILLVQCLSFGS  134



>gb|KHN48318.1| Importin subunit alpha-2 [Glycine soja]
Length=261

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 117/138 (85%), Gaps = 4/138 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD G  S++RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KR CRVGI G      
Sbjct  1    MADSGFTSNRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRFCRVGIDGGDG---  57

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
             +DM+I+EEQSILE QTS+AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFPPVE+
Sbjct  58   -SDMLIEEEQSILESQTSAAVENLKSAIAFQGKGAVKKRVGALQELRRLLSRSEFPPVES  116

Query  548  alxagalpllVKCLSFGS  601
            A+ AGA+PLLV+CLSFGS
Sbjct  117  AINAGAVPLLVQCLSFGS  134



>ref|XP_010490774.1| PREDICTED: LOW QUALITY PROTEIN: importin subunit alpha-2-like 
[Camelina sativa]
Length=520

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGTASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGDVEDAC  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MMIDEEQ ILE Q S AVEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPPVE
Sbjct  61   VENEMMIDEEQPILEAQASKAVEELKFAVQYQGKGAMQKRVTALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>ref|XP_010037940.1| PREDICTED: importin subunit alpha-2 [Eucalyptus grandis]
 gb|KCW49716.1| hypothetical protein EUGRSUZ_K03215 [Eucalyptus grandis]
Length=530

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 11/148 (7%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDS----  355
            MAD+ A+  +RDPIKSSVGN AAQRRR  AV VGKERRE+L+R KRLCR+G++G +    
Sbjct  1    MADD-ASPLRRDPIKSSVGNVAAQRRRRQAVAVGKERRESLVRAKRLCRIGVSGSANGEG  59

Query  356  ------DVAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrll  517
                  DV+P+ DM++DEEQS+LE QTSSAVEELK A+A+QGKGA+QKRV+ALRELRRLL
Sbjct  60   EGEGEGDVSPDIDMVVDEEQSVLEAQTSSAVEELKAAIAYQGKGAMQKRVSALRELRRLL  119

Query  518  srseFPPVEaalxagalpllVKCLSFGS  601
            S+SEFPPVEAAL AGA+P+LV+CLSFGS
Sbjct  120  SKSEFPPVEAALNAGAIPILVQCLSFGS  147



>ref|XP_007144541.1| hypothetical protein PHAVU_007G164500g [Phaseolus vulgaris]
 gb|ESW16535.1| hypothetical protein PHAVU_007G164500g [Phaseolus vulgaris]
Length=519

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 120/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGI-TGDSDVA  364
            MAD G  S++RDPIKSSVGN AA RRR++AV VGKERRE+LMR KRLCRVGI  GD +V+
Sbjct  1    MADSGVTSNRRDPIKSSVGNAAASRRRQHAVAVGKERRESLMRAKRLCRVGIGGGDDEVS  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             ++DM+IDEEQS+LE QTS AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFPPVE
Sbjct  61   IDSDMLIDEEQSLLESQTSVAVENLKSALASQGKGAVKKRVGALQELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            +AL AGA+P+LV+CL FGS
Sbjct  121  SALKAGAVPMLVQCLCFGS  139



>ref|XP_010107576.1| Importin subunit alpha-2 [Morus notabilis]
 gb|EXC16258.1| Importin subunit alpha-2 [Morus notabilis]
Length=475

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSD---  358
            MA+ GA  H+RDPIKSSVGN AA RRR++AVTVGKERRE+L+R KRLCRVG +G+ D   
Sbjct  1    MAENGAILHRRDPIKSSVGNVAAHRRRQHAVTVGKERRESLVRAKRLCRVGTSGEGDGEG  60

Query  359  VAP-EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFP  535
             AP E+ M+I+EEQSILE QTSSAVEELK AV++QGKGA+QKRV  LRELRR+LSRSEFP
Sbjct  61   EAPLESGMIIEEEQSILEAQTSSAVEELKAAVSNQGKGALQKRVATLRELRRILSRSEFP  120

Query  536  PVEaalxagalpllVKCLSFGS  601
            P+E AL AGA+ +LV+CLSFGS
Sbjct  121  PIETALRAGAISVLVQCLSFGS  142



>ref|XP_011006955.1| PREDICTED: importin subunit alpha-2 [Populus euphratica]
Length=519

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGIT-GDSDVA  364
            MA++G   H+RDPIKSSVGN AA RRR+NAV VGK+RRE+L+R KRLCRVG +  DSD+ 
Sbjct  1    MAEDGLNPHRRDPIKSSVGNVAAHRRRQNAVAVGKDRRESLVRAKRLCRVGPSCDDSDIC  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E DM+IDEEQSILE QT SAVEELK AV+ QGKGA+QK V ALRE+RRLLS+SEFPPVE
Sbjct  61   IENDMIIDEEQSILEAQTLSAVEELKSAVSFQGKGAMQKLVGALREMRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AA+ AGA+PLLV+CLSFGS
Sbjct  121  AAIKAGAIPLLVQCLSFGS  139



>emb|CAB86074.1| importin alpha-like protein [Arabidopsis thaliana]
Length=483

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRKQAVTVAKERRELLVRAKRLCRVGTNGDVEDAL  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MM+DEEQ ILE Q S +VEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPPVE
Sbjct  61   VENEMMVDEEQPILEAQASKSVEELKSAVQYQGKGAMQKRVTALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALRAGAIPLLVQCLSFGS  139



>ref|XP_003536981.2| PREDICTED: importin subunit alpha-2-like [Glycine max]
Length=201

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGI-TGDSDVA  364
            MAD G  S +RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KRLCRVGI  G+ + +
Sbjct  1    MADSGFTSDRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRLCRVGIGGGNGEFS  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             ++ M+ DEEQSILE QT +AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFPPVE
Sbjct  61   VDSVMLTDEEQSILESQTLAAVENLKSALAFQGKGAVKKRVGALQELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            +A+ AGA+PLL++CLSFGS
Sbjct  121  SAINAGAVPLLMQCLSFGS  139



>ref|NP_195927.2| importin alpha isoform 9 [Arabidopsis thaliana]
 sp|F4KF65.1|IMPA9_ARATH RecName: Full=Importin subunit alpha-9; Short=IMPa-9 [Arabidopsis 
thaliana]
 gb|AED90553.1| importin alpha isoform 9 [Arabidopsis thaliana]
Length=519

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRKQAVTVAKERRELLVRAKRLCRVGTNGDVEDAL  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MM+DEEQ ILE Q S +VEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPPVE
Sbjct  61   VENEMMVDEEQPILEAQASKSVEELKSAVQYQGKGAMQKRVTALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALRAGAIPLLVQCLSFGS  139



>gb|KEH42271.1| importin subunit alpha-like protein [Medicago truncatula]
Length=519

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGIT-GDSDVA  364
            MAD G A++KRDPIKSSV N A  RRR+ AVTVGKERRE+L+R KRLCRVG++  + DV 
Sbjct  1    MADPGFATNKRDPIKSSVVNAAGTRRRQLAVTVGKERRESLVRAKRLCRVGVSDAEVDVD  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MMIDEEQSILE QTS AVE LK A+A+QGKGAVQKRV AL+ELRRLLSRSEFPPVE
Sbjct  61   VEGEMMIDEEQSILESQTSLAVENLKSALAYQGKGAVQKRVGALQELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            +A+ AGA+ +LV+CLSFGS
Sbjct  121  SAVKAGAVAILVQCLSFGS  139



>gb|KHN39102.1| Importin subunit alpha-2 [Glycine soja]
Length=238

 Score =   152 bits (384),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGI-TGDSDVA  364
            MAD G  S +RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KRLCRVGI  G+ + +
Sbjct  1    MADSGFTSDRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRLCRVGIGGGNGEFS  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             ++ M+ DEEQSILE QT +AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFPPVE
Sbjct  61   VDSVMLTDEEQSILESQTLAAVENLKSALAFQGKGAVKKRVGALQELRRLLSRSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            +A+ AGA+PLL++CLSFGS
Sbjct  121  SAINAGAVPLLMQCLSFGS  139



>ref|XP_002873075.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49334.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G+AS++RDPIKSSVG+ A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGSASNRRDPIKSSVGHVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGDVEDSL  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MMIDEEQ ILE Q S +VEELK AV +QGKGA+QKRV ALRELRR+LS+SEFPPVE
Sbjct  61   VENEMMIDEEQPILEAQASKSVEELKSAVQYQGKGAMQKRVTALRELRRILSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>gb|KDO48095.1| hypothetical protein CISIN_1g0096471mg, partial [Citrus sinensis]
Length=327

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +2

Query  239  VGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAPEADMMIDEEQSILEFQT  418
            VGN AAQRRR+NAVTVGKERRE+L+R KRLCRVG + D +V+ ++DMM+DEEQSILE QT
Sbjct  30   VGNVAAQRRRQNAVTVGKERRESLVRAKRLCRVGTSADGEVSSDSDMMVDEEQSILEMQT  89

Query  419  SSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpllVKCLSFG  598
            SSAVEELK AVA+ GKGA+QKRVNALRELRRLLSR EFPP+E AL AGA+P+LV+CL+FG
Sbjct  90   SSAVEELKSAVAYHGKGAMQKRVNALRELRRLLSRFEFPPIETALKAGAIPVLVQCLAFG  149

Query  599  S  601
            S
Sbjct  150  S  150



>emb|CDY55698.1| BnaC02g03390D [Brassica napus]
Length=520

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG--DSDV  361
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE+L+R KRLCRVG  G  D D 
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRESLVRAKRLCRVGTNGGDDEDA  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E +MMIDEEQ +LE QT  AVEELK AV  QGKGA+QKRV ALRELRRLLS+SEFPP+
Sbjct  61   RVENEMMIDEEQPVLEAQTVKAVEELKSAVQSQGKGAMQKRVTALRELRRLLSKSEFPPI  120

Query  542  EaalxagalpllVKCLSFGS  601
            +AAL AGA+PLLV+CLSFGS
Sbjct  121  DAALTAGAIPLLVQCLSFGS  140



>ref|XP_009125477.1| PREDICTED: importin subunit alpha-2-like [Brassica rapa]
Length=521

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG--DSDV  361
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  G  D D 
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGGDDEDA  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E +MMIDEEQ +LE QT  AVEELK AV  QGKGA+QKRV ALRELRRLLS+SEFPP+
Sbjct  61   RVENEMMIDEEQPVLEAQTVKAVEELKSAVQSQGKGAMQKRVTALRELRRLLSKSEFPPI  120

Query  542  EaalxagalpllVKCLSFGS  601
            +AAL AGA+PLLV+CLSFGS
Sbjct  121  DAALTAGAVPLLVQCLSFGS  140



>ref|XP_010423779.1| PREDICTED: importin subunit alpha-2-like [Camelina sativa]
Length=520

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGTASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGDVEDAC  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +MMIDEEQ ILE Q S AVEELK AV +Q KGA+QKRV ALRELRRLLS+SEFPPVE
Sbjct  61   VENEMMIDEEQPILEAQASKAVEELKSAVQYQEKGAMQKRVIALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>gb|KFK24759.1| hypothetical protein AALP_AA8G021400 [Arabis alpina]
Length=519

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDS-DVA  364
            MAD+G+ S++RDPIKSSVGN A QRRR+ AVTV KERRE ++R KRLCRVG  GD  D  
Sbjct  1    MADDGSLSNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELVVRAKRLCRVGTNGDDEDAY  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E++MMIDEEQ ILE QT  AVEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPP E
Sbjct  61   VESEMMIDEEQPILEAQTIKAVEELKSAVQYQGKGAMQKRVAALRELRRLLSKSEFPPTE  120

Query  545  aalxagalpllVKCLSFGS  601
            AA+ AGA+PLLV+CLSFGS
Sbjct  121  AAINAGAIPLLVQCLSFGS  139



>ref|XP_006289370.1| hypothetical protein CARUB_v10002864mg [Capsella rubella]
 gb|EOA22268.1| hypothetical protein CARUB_v10002864mg [Capsella rubella]
Length=519

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE L++ KRLCRVG  GD  D  
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVKAKRLCRVGTNGDVEDAC  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E +M+IDEEQ ILE Q + AVEELK AV +QGKGA+QKRV ALRELRRLLS+SEFPPV+
Sbjct  61   VENEMLIDEEQPILEAQANKAVEELKSAVQYQGKGAMQKRVTALRELRRLLSKSEFPPVK  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>emb|CDY04878.1| BnaAnng00600D [Brassica napus]
Length=521

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG--DSDV  361
            MAD+G+AS++RDPIKSSVGN A QRRR+ AVTV KERRE+L+R KRLCRVG  G  D D 
Sbjct  1    MADDGSASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRESLVRAKRLCRVGTNGGDDEDA  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E +MMIDEEQ +LE QT  AVEELK AV  QGKG +QKRV ALRELRRLLS+SEFPP+
Sbjct  61   FVENEMMIDEEQPVLEAQTVKAVEELKSAVQSQGKGVMQKRVTALRELRRLLSKSEFPPI  120

Query  542  EaalxagalpllVKCLSFGS  601
            +AAL AGA+PLLV+CLSFGS
Sbjct  121  DAALSAGAIPLLVQCLSFGS  140



>ref|XP_010452168.1| PREDICTED: importin subunit alpha-2-like [Camelina sativa]
Length=520

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGD-SDVA  364
            MAD+G AS++RDPIKSSVGN A QRRR+ AVTV KERRE L+R KRLCRVG  GD  D  
Sbjct  1    MADDGTASNRRDPIKSSVGNVAGQRRRQQAVTVAKERRELLVRAKRLCRVGTNGDVEDAC  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             + +MMIDE+Q ILE Q S AVEELK AV +QGKGA+QK V ALRELRRLLS+SEFPPVE
Sbjct  61   VDNEMMIDEDQPILEAQASKAVEELKSAVQYQGKGAMQKMVIALRELRRLLSKSEFPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AGA+PLLV+CLSFGS
Sbjct  121  AALSAGAIPLLVQCLSFGS  139



>ref|XP_010543379.1| PREDICTED: importin subunit alpha-2 [Tarenaya hassleriana]
Length=517

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD+G+AS +RDPIKSSVGN A QRRR+ AVTV KERRE+L+R KRLCRVG +G+ D   
Sbjct  1    MADDGSASLRRDPIKSSVGNIAGQRRRQQAVTVAKERRESLVRAKRLCRVGTSGE-DEHF  59

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            E +M+IDEEQ +LE QT+ AV+ELK AV +QGKGA QKR+ ALRELRRLLS+SEFPPVEA
Sbjct  60   ENEMIIDEEQPLLEAQTAKAVDELKSAVQYQGKGATQKRIAALRELRRLLSKSEFPPVEA  119

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+ LLV+CLSFGS
Sbjct  120  ALKAGAITLLVQCLSFGS  137



>ref|XP_003542503.1| PREDICTED: importin subunit alpha-2-like isoformX2 [Glycine max]
Length=522

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRV----GITGDS  355
            MAD G  S++RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KR CRV    G  GD 
Sbjct  1    MADSGFTSNRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRFCRVGIDGGDGGDG  60

Query  356  DVAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFP  535
            +V+ ++DM+I+EEQSILE QTS+AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFP
Sbjct  61   EVSVDSDMLIEEEQSILESQTSAAVENLKSAIAFQGKGAVKKRVGALQELRRLLSRSEFP  120

Query  536  PVEaalxagalpllVKCLSFGS  601
            PVE+A+ AGA+PLLV+CLSFGS
Sbjct  121  PVESAINAGAVPLLVQCLSFGS  142



>ref|XP_003542502.1| PREDICTED: importin subunit alpha-2-like isoformX1 [Glycine max]
Length=517

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRV----GITGDS  355
            MAD G  S++RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KR CRV    G  GD 
Sbjct  1    MADSGFTSNRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRFCRVGIDGGDGGDG  60

Query  356  DVAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFP  535
            +V+ ++DM+I+EEQSILE QTS+AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFP
Sbjct  61   EVSVDSDMLIEEEQSILESQTSAAVENLKSAIAFQGKGAVKKRVGALQELRRLLSRSEFP  120

Query  536  PVEaalxagalpllVKCLSFGS  601
            PVE+A+ AGA+PLLV+CLSFGS
Sbjct  121  PVESAINAGAVPLLVQCLSFGS  142



>ref|XP_006594124.1| PREDICTED: importin subunit alpha-2-like isoform X3 [Glycine 
max]
Length=510

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 4/142 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRV----GITGDS  355
            MAD G  S++RDPIKSSVGN AA RRR++AVTVGKERRE+LMR KR CRV    G  GD 
Sbjct  1    MADSGFTSNRRDPIKSSVGNAAASRRRQHAVTVGKERRESLMRAKRFCRVGIDGGDGGDG  60

Query  356  DVAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFP  535
            +V+ ++DM+I+EEQSILE QTS+AVE LK A+A QGKGAV+KRV AL+ELRRLLSRSEFP
Sbjct  61   EVSVDSDMLIEEEQSILESQTSAAVENLKSAIAFQGKGAVKKRVGALQELRRLLSRSEFP  120

Query  536  PVEaalxagalpllVKCLSFGS  601
            PVE+A+ AGA+PLLV+CLSFGS
Sbjct  121  PVESAINAGAVPLLVQCLSFGS  142



>ref|XP_004497474.1| PREDICTED: importin subunit alpha-2-like [Cicer arietinum]
Length=521

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 4/141 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV--  361
            MAD G AS+KRDPIKS VGN A  RRR++A+TVGKERRE+L+R KRLCRV ++ D+++  
Sbjct  1    MADSGFASNKRDPIKSLVGNAAGTRRRQHAITVGKERRESLVRAKRLCRVRVS-DAEIDL  59

Query  362  -APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPP  538
               EA+M+IDEEQSILE QTS AVE LK ++A+QGKGA+QKRV AL+ELRRLLSRSEFPP
Sbjct  60   DDVEAEMIIDEEQSILESQTSLAVENLKSSLAYQGKGAMQKRVGALQELRRLLSRSEFPP  119

Query  539  VEaalxagalpllVKCLSFGS  601
            VE+AL AGA+ +LV+CLSFGS
Sbjct  120  VESALKAGAVAILVQCLSFGS  140



>ref|XP_011077370.1| PREDICTED: importin subunit alpha-2 [Sesamum indicum]
Length=519

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVA  364
            M+DE +   KR PIKS VG+ A QRRRE+AV VGKERRE LMRTKRLCRVG++  ++DV 
Sbjct  1    MSDETSTPQKRGPIKSPVGSVAVQRRREHAVMVGKERREALMRTKRLCRVGVSSENADVP  60

Query  365  PEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVE  544
             E DMM+DEEQS+LE QT  AVEELK A+ +QGKGA+QKRV ALRELRRLLS+SE+PPVE
Sbjct  61   VEDDMMMDEEQSVLEDQTLKAVEELKHAIGYQGKGAMQKRVGALRELRRLLSKSEYPPVE  120

Query  545  aalxagalpllVKCLSFGS  601
            AAL AG +P LV+ LSFGS
Sbjct  121  AALKAGVMPTLVQFLSFGS  139



>gb|KDP29088.1| hypothetical protein JCGZ_16477 [Jatropha curcas]
Length=94

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MA++G ASH+RDPIKSSVGN AAQ+RR+NAV VGKERRE+L+R KRLCRVG +GD D  P
Sbjct  1    MAEDGLASHRRDPIKSSVGNVAAQKRRQNAVAVGKERRESLVRAKRLCRVGTSGDIDTPP  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQ  460
            ++DM+IDEEQSILE QT++AV+ELK A+A Q
Sbjct  61   DSDMIIDEEQSILEAQTTTAVDELKSAIAFQ  91



>ref|XP_008449812.1| PREDICTED: importin subunit alpha-2 isoform X1 [Cucumis melo]
Length=517

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD    S +RD IKSSVG  AA RRR++AV VGKERR+ L+R KR CR+GI GD+  A 
Sbjct  1    MADSSLPSPRRDSIKSSVGGVAAHRRRQHAVAVGKERRDLLVRAKRFCRIGI-GDAASAV  59

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            + +M++DEE SILE QTSSAV+ELK AVA+QGKGA+QKR++ALRELRRLLSRSEFPPVE 
Sbjct  60   DNEMIMDEELSILEVQTSSAVDELKSAVAYQGKGAMQKRIHALRELRRLLSRSEFPPVET  119

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+ LLV+CLSFGS
Sbjct  120  ALKAGAVSLLVQCLSFGS  137



>ref|XP_010920895.1| PREDICTED: importin subunit alpha-2 isoform X1 [Elaeis guineensis]
Length=523

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAA--SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV  361
            MADEG +  S +RD IKSSV NTAAQRRR++A+ VGKERRE L+RTKRLCRV +  DS+V
Sbjct  1    MADEGVSPPSQRRDSIKSSVHNTAAQRRRQHAIAVGKERREALIRTKRLCRVAVVDDSEV  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E DM++DEE+++L+ QTS  VE+LK A+++ GKGA QK++  LR LRRLLS+SE PPV
Sbjct  61   LLEGDMLVDEEKAVLDSQTSQTVEDLKSALSYHGKGATQKKIEILRALRRLLSKSEVPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            EAAL AGA+P+LV+CLSFGS
Sbjct  121  EAALQAGAIPVLVQCLSFGS  140



>ref|XP_010920896.1| PREDICTED: importin subunit alpha-2 isoform X2 [Elaeis guineensis]
Length=496

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAA--SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV  361
            MADEG +  S +RD IKSSV NTAAQRRR++A+ VGKERRE L+RTKRLCRV +  DS+V
Sbjct  1    MADEGVSPPSQRRDSIKSSVHNTAAQRRRQHAIAVGKERREALIRTKRLCRVAVVDDSEV  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E DM++DEE+++L+ QTS  VE+LK A+++ GKGA QK++  LR LRRLLS+SE PPV
Sbjct  61   LLEGDMLVDEEKAVLDSQTSQTVEDLKSALSYHGKGATQKKIEILRALRRLLSKSEVPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            EAAL AGA+P+LV+CLSFGS
Sbjct  121  EAALQAGAIPVLVQCLSFGS  140



>ref|XP_010245001.1| PREDICTED: importin subunit alpha-2-like [Nelumbo nucifera]
Length=303

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MADE   SH+RDPIKSSVGN AA RRR+ AVTVGKERR  L+R KRLCR G+  D+D++ 
Sbjct  1    MADESLPSHRRDPIKSSVGNVAAHRRRQYAVTVGKERRGALVRAKRLCRDGVVDDNDISL  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
              DM+  EE + L+  TS AVE+LK A+ +QGKGA+QK+V ALRELRRLLS SE PPVEA
Sbjct  61   VKDMVTSEEDAALDALTSRAVEDLKSAILYQGKGAMQKKVEALRELRRLLSNSELPPVEA  120

Query  548  alxagalpllVKCLSFG  598
            AL AGA+P LV+CLSFG
Sbjct  121  ALKAGAVPALVQCLSFG  137



>gb|EYU38519.1| hypothetical protein MIMGU_mgv1a004564mg [Erythranthe guttata]
Length=520

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSD--V  361
            MADE +   KR+ IKSSVG+ A QRRRE AV VGK+RRE LMRTKRLCRVG++ DS    
Sbjct  1    MADETSKHPKRESIKSSVGSIAGQRRREKAVMVGKQRRELLMRTKRLCRVGVSSDSANVD  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
            A + DMM+D EQSILE QT  AV+ELK AV++QGKGA+QKRVNALRELRRLLS+SE+PPV
Sbjct  61   ADDDDMMMDGEQSILEDQTLKAVQELKNAVSYQGKGAMQKRVNALRELRRLLSKSEYPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            E AL AGA+  LV+CLSFGS
Sbjct  121  EVALTAGAMSTLVQCLSFGS  140



>ref|XP_004142168.1| PREDICTED: importin subunit alpha-2-like [Cucumis sativus]
Length=518

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD    S +RD IKSSVG+ AA RRR++A+ VGKERR+ L+R KR CR+GI        
Sbjct  1    MADSSLPSPRRDSIKSSVGSVAANRRRQHAIAVGKERRDLLVRAKRFCRIGIGDGDGDGV  60

Query  368  EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEa  547
            + +M++DEE SILE QTSSAV+ELK AVA+QGKGA+QKR++ALRELRRLLSRSEFPPVE 
Sbjct  61   DNEMIMDEELSILEVQTSSAVDELKSAVAYQGKGAMQKRIHALRELRRLLSRSEFPPVET  120

Query  548  alxagalpllVKCLSFGS  601
            AL AGA+ LLV+CLSFGS
Sbjct  121  ALKAGAVSLLVQCLSFGS  138



>ref|XP_008793530.1| PREDICTED: importin subunit alpha-2 [Phoenix dactylifera]
Length=520

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +2

Query  188  MADEGAAS--HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV  361
            MADE  +    +RD IKSSV  TAAQRRR++A+ VGKERRE L+RTKRLCRV +  DS+ 
Sbjct  1    MADEEVSPPPQRRDSIKSSVHGTAAQRRRQHAIAVGKERREALIRTKRLCRVAVADDSEG  60

Query  362  APEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPV  541
              E DM++DEE+++L+ QTS  VE+LK A+ +QGKGA QK++  LR LRRLLS+SE PPV
Sbjct  61   LVEGDMLVDEEKAVLDSQTSQTVEDLKSALLYQGKGATQKKIETLRALRRLLSKSEVPPV  120

Query  542  EaalxagalpllVKCLSFGS  601
            EAAL AGA+P+LV+CLSFGS
Sbjct  121  EAALQAGAIPVLVQCLSFGS  140



>ref|XP_004162005.1| PREDICTED: importin subunit alpha-2-like [Cucumis sativus]
 gb|KGN54069.1| hypothetical protein Csa_4G280460 [Cucumis sativus]
Length=522

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = +2

Query  188  MADEGAASHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAP  367
            MAD    S +RD IKSSVG+ AA RRR++A+ VGKERR+ L+R KR CR+GI        
Sbjct  1    MADSSLPSPRRDSIKSSVGSVAANRRRQHAIAVGKERRDLLVRAKRFCRIGIGDGDGDGD  60

Query  368  ----EADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFP  535
                + +M++DEE SILE QTSSAV+ELK AVA+QGKGA+QKR++ALRELRRLLSRSEFP
Sbjct  61   GDGVDNEMIMDEELSILEVQTSSAVDELKSAVAYQGKGAMQKRIHALRELRRLLSRSEFP  120

Query  536  PVEaalxagalpllVKCLSFGS  601
            PVE AL AGA+ LLV+CLSFGS
Sbjct  121  PVETALKAGAVSLLVQCLSFGS  142



>ref|XP_009421388.1| PREDICTED: importin subunit alpha-2 [Musa acuminata subsp. malaccensis]
Length=521

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 3/141 (2%)
 Frame = +2

Query  188  MADEGAA---SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSD  358
            MADE  +   S+ R+ IK+SV NT+AQRRR+ AV VGKERRE L+RTKRLCR  +  D++
Sbjct  1    MADEDVSPQSSYHRNAIKTSVHNTSAQRRRQLAVAVGKERREALIRTKRLCREALFDDNE  60

Query  359  VAPEADMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPP  538
             + E +M IDEE+++L  Q S  +E+LK A+ +QGKGA QK+V ALR LRRLLS+SE PP
Sbjct  61   ASLEGNMNIDEERAVLNAQASQIIEDLKSAMTYQGKGAAQKKVEALRALRRLLSKSEIPP  120

Query  539  VEaalxagalpllVKCLSFGS  601
            V+AAL AGA+PLLV+CLSFGS
Sbjct  121  VKAALQAGAVPLLVQCLSFGS  141



>ref|XP_004968263.1| PREDICTED: importin subunit alpha-2-like [Setaria italica]
Length=527

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            H RD IKSSV N+A+ RRRE+A+ VGKERRE LMR KR+CR  ++G D  V  E DM+ID
Sbjct  18   HHRDAIKSSVHNSASSRRREHAIAVGKERREALMRAKRVCRAPLSGNDETVMEEGDMVID  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            E+++ LE QT+ AVEELK A++ QGKGA +K++  LR LRRLLS+SE PPVEAA+ AGA+
Sbjct  78   EKKADLEAQTAQAVEELKSALSTQGKGAQKKKIEVLRALRRLLSQSEVPPVEAAIKAGAI  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>ref|XP_006836482.1| hypothetical protein AMTR_s00108p00104150, partial [Amborella 
trichopoda]
 gb|ERM99335.1| hypothetical protein AMTR_s00108p00104150, partial [Amborella 
trichopoda]
Length=532

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +2

Query  209  SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAPEADMMID  388
            S KR+P+K S G  AAQRRR++AVT+GKERRE ++RTKRLCR G+ GD++   +A M++D
Sbjct  20   SLKREPLKFSAGKVAAQRRRQHAVTIGKERREAILRTKRLCRDGVVGDNEDQVDAGMILD  79

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE + L+ QT+  V ELK A+  QGK A++K++  LR LR LLS+S  PPVE A+ AG +
Sbjct  80   EEGAALDAQTNETVGELKSALRIQGKDALRKKLEVLRTLRCLLSKSTVPPVETAVQAGVV  139

Query  569  pllVKCLSFGS  601
            PLLV+CLSFGS
Sbjct  140  PLLVECLSFGS  150



>ref|NP_001147773.1| importin alpha-2 subunit [Zea mays]
 gb|ACG28682.1| importin alpha-2 subunit [Zea mays]
Length=526

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            + RD IKSSV NTAA RRRE A+ +GKERRE LMR KR+CR  ++G D   A E DM++D
Sbjct  18   YHRDAIKSSVRNTAANRRREQAIAIGKERREALMRAKRVCRAPLSGSDEAAAEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKGA  ++   LR LRRLLS+SE PPV+AA+ AGA+
Sbjct  78   EEKADLETRTTQAVEELKSALSSQGKGAQNRKTEVLRALRRLLSQSEVPPVDAAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQSLSFGS  148



>gb|ACN31641.1| unknown [Zea mays]
 gb|AFW80076.1| importin alpha-2 subunit [Zea mays]
Length=526

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVA-PEADMMID  388
            + RD IKSSV NTAA RRRE+A+ +GKERRE LMR KR+CR  ++G  + A  E DM++D
Sbjct  18   YHRDAIKSSVRNTAANRRREHAIAIGKERREALMRAKRVCRAPLSGSDEAAGEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKGA  ++   LR LRRLLS+SE PPV+AA+ AGA+
Sbjct  78   EEKADLETRTTQAVEELKSALSSQGKGAQNRKTEVLRALRRLLSQSEVPPVDAAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQSLSFGS  148



>emb|CDP06714.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 7/136 (5%)
 Frame = +2

Query  215  KRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV-------APEA  373
            +R  +    GN AAQRRR++A+TV KERRE ++RTKRLCRVG+ G  D            
Sbjct  21   RRKSLLFCFGNVAAQRRRQHAITVAKERREAVVRTKRLCRVGVGGGGDDQLTYDDDGDGG  80

Query  374  DMMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaal  553
            DMMID EQSILE QT SAV++LKLA+  QGKGA+QKRV ALRE+RRLLSRSEFPP+EAA+
Sbjct  81   DMMIDAEQSILEAQTCSAVQDLKLAMLFQGKGAMQKRVAALREVRRLLSRSEFPPIEAAI  140

Query  554  xagalpllVKCLSFGS  601
             AGA+PLLV+CLSFGS
Sbjct  141  KAGAIPLLVQCLSFGS  156



>gb|EPS72639.1| hypothetical protein M569_02116, partial [Genlisea aurea]
Length=494

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +2

Query  236  SVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGI-TGDSDVAPEADMMIDEEQSILEF  412
            SVG TA  RR+E AVT  KERRE LMR KRLCRV + + D  ++   D+++DEE SILE 
Sbjct  1    SVGATAVLRRKEMAVTAAKERREALMRAKRLCRVAVGSDDQPISDNDDIVMDEEPSILEI  60

Query  413  QTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpllVKCLS  592
            +   AVE LK AVA++GKG +QKRVN LR LR++LS+SE+PPVEA L AG +P LV+CLS
Sbjct  61   KALEAVEALKQAVAYRGKGEIQKRVNGLRCLRKILSKSEYPPVEAVLSAGGMPPLVQCLS  120

Query  593  FGS  601
            FGS
Sbjct  121  FGS  123



>ref|XP_002457309.1| hypothetical protein SORBIDRAFT_03g005380 [Sorghum bicolor]
 gb|EES02429.1| hypothetical protein SORBIDRAFT_03g005380 [Sorghum bicolor]
Length=565

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAPE-ADMMID  388
            + RD IKSSV NTAA RRRE A+ +GKERRE LMR KR+CR  ++G  + A E  DM+ D
Sbjct  56   YHRDAIKSSVRNTAANRRREQALAIGKERREALMRAKRVCRAPLSGSDEAAAEDGDMVTD  115

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            E ++ LE +T+ AVEELK A++ QGKGA +++   LR LRRLLS+SE PPV+AA+ AGA+
Sbjct  116  EGKADLEARTTQAVEELKSALSSQGKGAQKRKTEVLRALRRLLSQSEVPPVDAAIKAGAV  175

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  176  PLLVQYLSFGS  186



>gb|EAZ10619.1| hypothetical protein OsJ_00451 [Oryza sativa Japonica Group]
Length=504

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            H R+ +KSSV NTAA RRRE A+ +GKERRE L+R KR+CR  I+G D     E DM++D
Sbjct  18   HHREALKSSVRNTAASRRREQAIAIGKERREALIRAKRVCRAPISGSDEAEMEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKG  +K++ ALR+LRRLLS+ E P V+ A+ AGA+
Sbjct  78   EEKACLEAKTAHAVEELKSALSIQGKGVQKKKIEALRDLRRLLSQPEVPLVDTAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>dbj|BAA31220.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            H R+ +KSSV NTAA RRRE A+ +GKERRE L+R KR+CR  I+G D     E DM++D
Sbjct  18   HHREALKSSVRNTAASRRREQAIAIGKERREALIRAKRVCRAPISGSDEAEMEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKG  +K++ ALR+LRRLLS+ E P V+ A+ AGA+
Sbjct  78   EEKACLEAKTAHAVEELKSALSIQGKGVQKKKIEALRDLRRLLSQPEVPLVDTAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>ref|NP_001042074.1| Os01g0158000 [Oryza sativa Japonica Group]
 sp|Q9FYP9.1|IMA2_ORYSJ RecName: Full=Importin subunit alpha-2 [Oryza sativa Japonica 
Group]
 dbj|BAA31222.1| importin alpha [Oryza sativa Japonica Group]
 dbj|BAB08186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAB64664.1| SRP1 protein homolog [Oryza sativa Japonica Group]
 dbj|BAF03988.1| Os01g0158000 [Oryza sativa Japonica Group]
 dbj|BAG95907.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            H R+ +KSSV NTAA RRRE A+ +GKERRE L+R KR+CR  I+G D     E DM++D
Sbjct  18   HHREALKSSVRNTAASRRREQAIAIGKERREALIRAKRVCRAPISGSDEAEMEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKG  +K++ ALR+LRRLLS+ E P V+ A+ AGA+
Sbjct  78   EEKACLEAKTAHAVEELKSALSIQGKGVQKKKIEALRDLRRLLSQPEVPLVDTAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>gb|EEC69979.1| hypothetical protein OsI_00484 [Oryza sativa Indica Group]
Length=528

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            H R+ +KSSV NTAA RRRE A+ +GKERRE L+R KR+CR  I+G D     E DM++D
Sbjct  18   HHREALKSSVRNTAASRRREQAIAIGKERREALIRAKRVCRAPISGSDEAEMEEGDMVVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            EE++ LE +T+ AVEELK A++ QGKG  +K++ ALR+LRRLLS+ E P V+ A+ AGA+
Sbjct  78   EEKACLEAKTAHAVEELKSALSIQGKGVQKKKIEALRDLRRLLSQPEVPLVDTAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>ref|XP_003567730.1| PREDICTED: importin subunit alpha-2 [Brachypodium distachyon]
Length=527

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +2

Query  218  RDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVA-PEADMMIDEE  394
            R  IKSSV NTAA RRRE A+ +GKERRE L+R KR+CR  ++G  D    E DM++D+E
Sbjct  20   RYAIKSSVHNTAASRRREQAIAIGKERREALIRAKRVCRTPLSGSDDAGIEEDDMVVDKE  79

Query  395  QSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpl  574
            +  LE +T+ AVEELK A++ QGKGA +K+   LR LRRLLS+SE PP+EAA+ AGA+PL
Sbjct  80   KEGLEARTAQAVEELKSALSSQGKGAQKKKTEVLRALRRLLSQSEVPPIEAAIKAGAVPL  139

Query  575  lVKCLSFGS  601
            LV+ LSFGS
Sbjct  140  LVQYLSFGS  148



>gb|EMT10396.1| Importin subunit alpha-2 [Aegilops tauschii]
Length=571

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = +2

Query  209  SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMI  385
            SH R  IKSSV NTAA RRRE A+ +GKERRE LMR KR+CR  ++G D     + DM+I
Sbjct  16   SH-RYAIKSSVHNTAASRRREQAIAIGKERREALMRAKRVCRAPLSGSDEATIEDGDMVI  74

Query  386  DEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxaga  565
            DE+   LE +T+ AVEELK A++ QGKGA +K++ ALR +RR+LS+SE PP++ A+ AGA
Sbjct  75   DEKAD-LETRTAQAVEELKSALSSQGKGAQKKKIEALRAVRRVLSQSEVPPIQVAIKAGA  133

Query  566  lpllVKCLSFGS  601
            +PLLV+ LSFGS
Sbjct  134  VPLLVQYLSFGS  145



>gb|EMS52684.1| Importin subunit alpha-2 [Triticum urartu]
Length=571

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = +2

Query  209  SHKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMI  385
            SH R  IKSSV NTAA RRRE A+ +GKERRE LMR KR+CR  ++G D     + DM+I
Sbjct  16   SH-RYAIKSSVHNTAASRRREQAIAIGKERREALMRAKRVCRAPLSGSDEATIEDGDMVI  74

Query  386  DEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxaga  565
            DE+   LE +T+ AVEELK A++ QGKGA +K++ ALR +RR+LS+SE PP++ A+ AGA
Sbjct  75   DEKAD-LETRTAQAVEELKSALSSQGKGAQKKKIEALRAVRRVLSQSEVPPIQVAIKAGA  133

Query  566  lpllVKCLSFGS  601
            +PLLV+ LSFGS
Sbjct  134  VPLLVQYLSFGS  145



>emb|CDM81997.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITG-DSDVAPEADMMID  388
            + R  IKSSV NTAA RRRE A+ +GKERRE LMR KR+CR  ++G D     + DM+ID
Sbjct  16   NHRYAIKSSVHNTAASRRREQAIAIGKERREALMRAKRVCRAPLSGSDEATVEDGDMVID  75

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            E+   LE +T+ AVEELK A++ QGKGA +K++ ALR +RR+LS+SE PP++ A+ AGA+
Sbjct  76   EKAD-LETRTAQAVEELKSALSSQGKGAQKKKIEALRAVRRVLSQSEVPPIQVAIKAGAV  134

Query  569  pllVKCLSFGS  601
            PLLV+ +SFGS
Sbjct  135  PLLVQYMSFGS  145



>ref|XP_006643773.1| PREDICTED: importin subunit alpha-2-like [Oryza brachyantha]
Length=528

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  HKRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDV-APEADMMID  388
            + RD IKSSV NTAA RRRE A+ +GKERRE L+R KR+CR  ++G ++    E DMM+D
Sbjct  18   NHRDGIKSSVRNTAASRRREQAIAIGKERREALIRAKRVCRAPLSGSNEAEMEEGDMMVD  77

Query  389  EEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagal  568
            E ++ LE +T++ VEELK A+++QGKGA +K++  LR+LRRLLS+ E P V+AA+ AGA+
Sbjct  78   EGKASLEAKTANTVEELKSALSNQGKGAQKKKIEVLRDLRRLLSQPEVPLVDAAIKAGAV  137

Query  569  pllVKCLSFGS  601
            PLLV+ LSFGS
Sbjct  138  PLLVQYLSFGS  148



>ref|XP_008449813.1| PREDICTED: importin subunit alpha-2 isoform X2 [Cucumis melo]
Length=455

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  377  MMIDEEQSILEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalx  556
            M++DEE SILE QTSSAV+ELK AVA+QGKGA+QKR++ALRELRRLLSRSEFPPVE AL 
Sbjct  1    MIMDEELSILEVQTSSAVDELKSAVAYQGKGAMQKRIHALRELRRLLSRSEFPPVETALK  60

Query  557  agalpllVKCLSFGS  601
            AGA+ LLV+CLSFGS
Sbjct  61   AGAVSLLVQCLSFGS  75



>ref|XP_001775435.1| predicted protein [Physcomitrella patens]
 gb|EDQ59764.1| predicted protein [Physcomitrella patens]
Length=515

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 79/131 (60%), Gaps = 5/131 (4%)
 Frame = +2

Query  215  KRDPIKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGIT--GDSDVAPEADMMID  388
            +RDP KSSVG  A QRRR+ A+TVGK+RRE+++R KRL R       D D         D
Sbjct  14   RRDPFKSSVGKGAGQRRRQAALTVGKDRRESVVRAKRLRRADPAEQWDGDAMHIVTDGAD  73

Query  389  EEQSI--LEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxag  562
            +E +   LE +T +AV  LK   A Q K    KR+ AL+ LRRLLS S +PPV  A+ AG
Sbjct  74   DEAAYKDLEDKTVAAVLNLKDLYA-QPKENTAKRIEALQILRRLLSCSAYPPVHVAVQAG  132

Query  563  alpllVKCLSF  595
             +PLLV CL  
Sbjct  133  VVPLLVDCLGL  143



>emb|CDY10407.1| BnaCnng03080D [Brassica napus]
Length=494

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +2

Query  338  GITGDSDVAP--EADMMIDEEQSILEFQTSSAVEELKLAVAHQ---GKGAVQKRVNAlre  502
            G  GD +  P  E +MMIDEEQ +LE QTS AVEELK  V +        +QKRV ALRE
Sbjct  21   GTIGDDEEHPHVENEMMIDEEQPVLEAQTSKAVEELKSTVQYHIYLSSFFMQKRVTALRE  80

Query  503  lrrllsrseFPPVEaalxagalpllVKCLSFGS  601
            LRRLLS+SEFPP+EAAL AGA+PLLV+CLSFGS
Sbjct  81   LRRLLSKSEFPPIEAALSAGAVPLLVQCLSFGS  113



>ref|XP_001758629.1| predicted protein [Physcomitrella patens]
 gb|EDQ76607.1| predicted protein, partial [Physcomitrella patens]
Length=495

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 76/126 (60%), Gaps = 8/126 (6%)
 Frame = +2

Query  236  SVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGIT--GDSDVA--PEADMMIDEEQSI  403
            +VG  A QRRR+ A+T+GK+RR++++R KRL R      GD D           D    +
Sbjct  1    AVGKGAGQRRRQAAITIGKDRRDSVVRAKRLRRADPADHGDGDAMQLAAVAADDDVAYKL  60

Query  404  LEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpllVK  583
            LE  T++AV  LK    + GK A  K+V AL+ LRRLLS S +PPV  A+ AG +PLLV 
Sbjct  61   LEDSTAAAVLNLK----NIGKKATPKKVEALQTLRRLLSCSAYPPVHVAVQAGVVPLLVD  116

Query  584  CLSFGS  601
            CL FG+
Sbjct  117  CLGFGA  122



>ref|XP_002985897.1| hypothetical protein SELMODRAFT_123107, partial [Selaginella 
moellendorffii]
 gb|EFJ13074.1| hypothetical protein SELMODRAFT_123107, partial [Selaginella 
moellendorffii]
Length=512

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = +2

Query  227  IKSSVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAPEADMMI--DEEQS  400
            I  +V + A QRRR+ AV + KERR+  +R KR+ R       DV    +M    DE+  
Sbjct  8    IVQAVASGAGQRRRKLAVALSKERRDAAVRAKRMRR-----SQDVEDGMEMYCEGDEDSR  62

Query  401  I-LEFQTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpll  577
            I LE    SAV EL  A     KGA  +++ AL+++RR LS S  PPV  A+ AG +P+L
Sbjct  63   IALENDVKSAVAELVSASQDISKGASNRKLEALKKVRRFLSCSSLPPVSVAVEAGLIPVL  122

Query  578  VKCLSFGS  601
            V+CL FGS
Sbjct  123  VECLKFGS  130



>ref|XP_002976434.1| hypothetical protein SELMODRAFT_105015 [Selaginella moellendorffii]
 gb|EFJ22694.1| hypothetical protein SELMODRAFT_105015 [Selaginella moellendorffii]
Length=532

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 4/123 (3%)
 Frame = +2

Query  236  SVGNTAAQRRRENAVTVGKERRETLMRTKRLCRVGITGDSDVAPEADMMIDEEQSI-LEF  412
            +V + A QRRR+ AV + KERR+  +R KR+ R   + D +   E     DE+  I LE 
Sbjct  32   AVASGAGQRRRKLAVALSKERRDAAVRAKRMRR---SQDEEDGMEMYCEGDEDSRIALEN  88

Query  413  QTSSAVEELKLAVAHQGKGAVQKRVNAlrelrrllsrseFPPVEaalxagalpllVKCLS  592
               SAV EL  A     KGA  +++ AL+++RR LS S  PPV  A+ AG +P+LV+CL 
Sbjct  89   DVKSAVAELVSASQDISKGASHRKLEALKKVRRFLSCSSLPPVSVAVEAGLIPVLVECLK  148

Query  593  FGS  601
            FGS
Sbjct  149  FGS  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370