BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031F24

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AJD25207.1|  cytochrome P450 CYP86A91                                243   1e-73   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004229934.1|  PREDICTED: cytochrome P450 86A8-like               241   2e-73   Solanum lycopersicum
ref|XP_011092582.1|  PREDICTED: cytochrome P450 86A8-like               241   2e-73   Sesamum indicum [beniseed]
ref|XP_009629836.1|  PREDICTED: cytochrome P450 86A8                    240   5e-73   Nicotiana tomentosiformis
ref|XP_006339587.1|  PREDICTED: cytochrome P450 86A2-like               240   9e-73   Solanum tuberosum [potatoes]
ref|XP_009797232.1|  PREDICTED: cytochrome P450 86A8-like               239   1e-72   Nicotiana sylvestris
gb|EYU32135.1|  hypothetical protein MIMGU_mgv1a003916mg                238   1e-71   Erythranthe guttata [common monkey flower]
ref|XP_010544737.1|  PREDICTED: cytochrome P450 86A8                    228   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_004306772.1|  PREDICTED: cytochrome P450 86A8-like               228   4e-68   Fragaria vesca subsp. vesca
emb|CDP08799.1|  unnamed protein product                                227   1e-67   Coffea canephora [robusta coffee]
emb|CBI40391.3|  unnamed protein product                                226   2e-67   Vitis vinifera
ref|XP_010053722.1|  PREDICTED: cytochrome P450 86A8-like               226   2e-67   Eucalyptus grandis [rose gum]
gb|KDO86201.1|  hypothetical protein CISIN_1g009235mg                   225   3e-67   Citrus sinensis [apfelsine]
ref|XP_006445018.1|  hypothetical protein CICLE_v10019633mg             225   3e-67   
gb|KCW78083.1|  hypothetical protein EUGRSUZ_D02303                     226   4e-67   Eucalyptus grandis [rose gum]
ref|XP_002275115.1|  PREDICTED: cytochrome P450 86A8                    225   5e-67   Vitis vinifera
ref|XP_007218993.1|  hypothetical protein PRUPE_ppa004034mg             224   5e-67   Prunus persica
ref|XP_008244638.1|  PREDICTED: cytochrome P450 86A8-like               225   6e-67   Prunus mume [ume]
ref|XP_006293977.1|  hypothetical protein CARUB_v10022968mg             224   6e-67   Capsella rubella
ref|XP_008338834.1|  PREDICTED: cytochrome P450 86A8                    224   1e-66   Malus domestica [apple tree]
ref|XP_010506590.1|  PREDICTED: cytochrome P450 86A8-like isoform X1    224   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010518254.1|  PREDICTED: cytochrome P450 86A8-like               224   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010087951.1|  Cytochrome P450 86A2                               224   1e-66   Morus notabilis
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like               223   2e-66   Cicer arietinum [garbanzo]
ref|XP_010508082.1|  PREDICTED: cytochrome P450 86A8                    222   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010255320.1|  PREDICTED: cytochrome P450 86A8                    223   6e-66   Nelumbo nucifera [Indian lotus]
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase       222   7e-66   Medicago truncatula
ref|XP_008342161.1|  PREDICTED: cytochrome P450 86A8                    222   8e-66   
ref|XP_002882043.1|  CYP86A8                                            221   9e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_009367816.1|  PREDICTED: cytochrome P450 86A8 isoform X1         222   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_009367817.1|  PREDICTED: cytochrome P450 86A8 isoform X2         221   2e-65   Pyrus x bretschneideri [bai li]
ref|NP_182121.1|  cytochrome P450, family 86, subfamily A, polype...    221   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like               221   3e-65   Populus euphratica
ref|XP_002320802.1|  cytochrome P450 family protein                     221   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010670184.1|  PREDICTED: cytochrome P450 86A8                    220   3e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP28614.1|  hypothetical protein JCGZ_14385                         220   4e-65   Jatropha curcas
emb|CAN80156.1|  hypothetical protein VITISV_023926                     220   6e-65   Vitis vinifera
gb|KFK37382.1|  hypothetical protein AALP_AA4G249700                    219   6e-65   Arabis alpina [alpine rockcress]
gb|EPS59487.1|  hypothetical protein M569_15318                         218   9e-65   Genlisea aurea
ref|XP_006397782.1|  hypothetical protein EUTSA_v10001389mg             219   9e-65   Eutrema salsugineum [saltwater cress]
gb|KHN16811.1|  Cytochrome P450 86A2                                    214   1e-63   Glycine soja [wild soybean]
ref|XP_004138498.1|  PREDICTED: cytochrome P450 86A2-like               216   1e-63   Cucumis sativus [cucumbers]
gb|KEH21079.1|  cytochrome P450 family 94 protein                       216   1e-63   Medicago truncatula
ref|XP_003525390.1|  PREDICTED: cytochrome P450 86A8                    216   1e-63   Glycine max [soybeans]
emb|CDY18885.1|  BnaC04g04650D                                          216   1e-63   Brassica napus [oilseed rape]
ref|XP_008458223.1|  PREDICTED: cytochrome P450 86A8-like               216   1e-63   Cucumis melo [Oriental melon]
ref|XP_010275632.1|  PREDICTED: cytochrome P450 86A8-like               216   2e-63   Nelumbo nucifera [Indian lotus]
gb|ABC68403.1|  cytochrome P450 monooxygenase CYP86A24                  215   2e-63   Glycine max [soybeans]
ref|XP_009143197.1|  PREDICTED: cytochrome P450 86A8                    215   2e-63   Brassica rapa
emb|CDX74778.1|  BnaA05g05240D                                          215   2e-63   
ref|XP_007135090.1|  hypothetical protein PHAVU_010G099900g             215   3e-63   Phaseolus vulgaris [French bean]
ref|XP_004503701.1|  PREDICTED: cytochrome P450 86A2-like               214   6e-63   Cicer arietinum [garbanzo]
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like               213   1e-62   Glycine max [soybeans]
ref|XP_006583288.1|  PREDICTED: cytochrome P450 86A8-like               213   2e-62   Glycine max [soybeans]
gb|KJB52139.1|  hypothetical protein B456_008G247600                    213   3e-62   Gossypium raimondii
ref|XP_010457027.1|  PREDICTED: cytochrome P450 86A2-like               201   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_007040281.1|  Cytochrome P450, family 86, subfamily A, pol...    211   1e-61   
ref|XP_010089087.1|  Cytochrome P450 86A2                               211   1e-61   Morus notabilis
gb|KJB25882.1|  hypothetical protein B456_004G213300                    210   3e-61   Gossypium raimondii
ref|XP_011022670.1|  PREDICTED: cytochrome P450 86A7-like               209   3e-61   Populus euphratica
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                    209   4e-61   
gb|KJB41354.1|  hypothetical protein B456_007G100300                    209   5e-61   Gossypium raimondii
ref|XP_007051775.1|  Cytochrome P450, family 86, subfamily A, pol...    209   6e-61   
ref|XP_010676469.1|  PREDICTED: cytochrome P450 86A2-like               208   7e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                    209   9e-61   Vitis vinifera
emb|CAN80040.1|  hypothetical protein VITISV_037194                     209   1e-60   Vitis vinifera
ref|XP_006418437.1|  hypothetical protein EUTSA_v10007350mg             207   2e-60   Eutrema salsugineum [saltwater cress]
emb|CDY15167.1|  BnaC05g00460D                                          208   2e-60   Brassica napus [oilseed rape]
ref|XP_009119710.1|  PREDICTED: cytochrome P450 86A4                    208   2e-60   Brassica rapa
gb|EYU23445.1|  hypothetical protein MIMGU_mgv1a026937mg                206   4e-60   Erythranthe guttata [common monkey flower]
ref|XP_010053250.1|  PREDICTED: cytochrome P450 86A7                    207   5e-60   Eucalyptus grandis [rose gum]
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like               206   5e-60   Malus domestica [apple tree]
ref|XP_002892051.1|  CYP86A4                                            207   5e-60   Arabidopsis lyrata subsp. lyrata
ref|NP_171666.1|  cytochrome P450, family 86, subfamily A, polype...    207   6e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90044.1|  BnaA10g00380D                                          206   6e-60   
dbj|BAC42067.1|  unknown protein                                        206   7e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287404.1|  hypothetical protein CARUB_v10000610mg             206   7e-60   Capsella rubella
ref|XP_009118821.1|  PREDICTED: cytochrome P450 86A4                    205   2e-59   Brassica rapa
gb|KJB24757.1|  hypothetical protein B456_004G159000                    204   2e-59   Gossypium raimondii
ref|XP_006396237.1|  hypothetical protein EUTSA_v10028550mg             205   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_007160078.1|  hypothetical protein PHAVU_002G290700g             204   2e-59   Phaseolus vulgaris [French bean]
gb|KDO76250.1|  hypothetical protein CISIN_1g037522mg                   204   3e-59   Citrus sinensis [apfelsine]
ref|XP_006439526.1|  hypothetical protein CICLE_v10019616mg             204   3e-59   Citrus clementina [clementine]
emb|CDY38015.1|  BnaCnng08760D                                          204   6e-59   Brassica napus [oilseed rape]
ref|XP_002304502.2|  cytochrome P450 family protein                     204   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010426970.1|  PREDICTED: cytochrome P450 86A2                    204   6e-59   
gb|AJD25208.1|  cytochrome P450 CYP86A92                                203   7e-59   Salvia miltiorrhiza [Chinese salvia]
ref|NP_191946.1|  cytochrome P450 86A2                                  204   7e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAL75903.1|  AT4g00360/A_IG005I10_21                                 204   7e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875027.1|  CYP86A2                                            204   7e-59   Arabidopsis lyrata subsp. lyrata
gb|KDP25417.1|  hypothetical protein JCGZ_20573                         203   1e-58   Jatropha curcas
emb|CDP12038.1|  unnamed protein product                                203   2e-58   Coffea canephora [robusta coffee]
ref|XP_006343967.1|  PREDICTED: cytochrome P450 86A2-like               202   2e-58   Solanum tuberosum [potatoes]
gb|AIU99467.1|  P450                                                    202   2e-58   Citrus maxima [buntan]
ref|XP_006476545.1|  PREDICTED: cytochrome P450 86A8-like               202   2e-58   Citrus sinensis [apfelsine]
ref|XP_011072860.1|  PREDICTED: cytochrome P450 86A7                    202   2e-58   Sesamum indicum [beniseed]
ref|XP_010419577.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    202   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004245593.1|  PREDICTED: cytochrome P450 86A7                    201   5e-58   Solanum lycopersicum
ref|XP_010522971.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    201   7e-58   Tarenaya hassleriana [spider flower]
emb|CDY66201.1|  BnaA09g51710D                                          201   7e-58   Brassica napus [oilseed rape]
ref|XP_002509820.1|  cytochrome P450, putative                          201   1e-57   Ricinus communis
ref|XP_009128484.1|  PREDICTED: cytochrome P450 86A2                    200   1e-57   Brassica rapa
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg             200   2e-57   Prunus persica
ref|XP_009111490.1|  PREDICTED: cytochrome P450 86A2                    199   3e-57   Brassica rapa
ref|XP_009797448.1|  PREDICTED: cytochrome P450 86A7-like               199   3e-57   Nicotiana sylvestris
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                    199   4e-57   Prunus mume [ume]
gb|EPS61958.1|  hypothetical protein M569_12832                         198   5e-57   Genlisea aurea
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             197   1e-56   Eutrema salsugineum [saltwater cress]
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A7                    197   1e-56   Fragaria vesca subsp. vesca
ref|XP_009610115.1|  PREDICTED: cytochrome P450 86A7-like               197   2e-56   Nicotiana tomentosiformis
gb|AAZ39642.1|  cytochrome P450 fatty acid omega-hydroxylase            197   2e-56   Petunia x hybrida [garden petunia]
emb|CBI34653.3|  unnamed protein product                                202   4e-56   Vitis vinifera
gb|KFK30625.1|  hypothetical protein AALP_AA6G006200                    195   1e-55   Arabis alpina [alpine rockcress]
ref|XP_010918585.1|  PREDICTED: cytochrome P450 86A8-like               195   1e-55   Elaeis guineensis
emb|CDY07223.1|  BnaCnng02380D                                          195   1e-55   
ref|XP_010430476.1|  PREDICTED: cytochrome P450 86A7                    194   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010473620.1|  PREDICTED: cytochrome P450 86A7-like               194   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010907215.1|  PREDICTED: cytochrome P450 86A8-like               194   3e-55   Elaeis guineensis
ref|XP_009400252.1|  PREDICTED: cytochrome P450 86A2-like               193   6e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002886391.1|  predicted protein                                  193   6e-55   
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    191   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65207.1|  putative cytochrome P450                                191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556547.1|  PREDICTED: cytochrome P450 86A2-like               192   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_008804035.1|  PREDICTED: cytochrome P450 86A8-like               192   2e-54   Phoenix dactylifera
ref|XP_004143898.1|  PREDICTED: cytochrome P450 86A2-like               191   3e-54   Cucumis sativus [cucumbers]
ref|XP_006300436.1|  hypothetical protein CARUB_v10020100mg             191   3e-54   Capsella rubella
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                    191   4e-54   Cucumis melo [Oriental melon]
ref|XP_008804444.1|  PREDICTED: cytochrome P450 86A8-like               190   8e-54   Phoenix dactylifera
ref|XP_010418406.1|  PREDICTED: cytochrome P450 86A7-like               190   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    189   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_009397933.1|  PREDICTED: cytochrome P450 86A2-like               188   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009402078.1|  PREDICTED: cytochrome P450 86A8-like               185   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006827573.1|  hypothetical protein AMTR_s00009p00227030          184   1e-51   
emb|CBH32594.1|  cytochrome P450, expressed                             177   5e-49   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65497.1|  Cytochrome P450 86A1                                    173   2e-48   Triticum urartu
ref|XP_003564640.2|  PREDICTED: cytochrome P450 86A1                    175   3e-48   
ref|XP_008785405.1|  PREDICTED: cytochrome P450 86A1                    174   7e-48   Phoenix dactylifera
ref|XP_004976485.1|  PREDICTED: cytochrome P450 86A2-like               174   9e-48   Setaria italica
ref|XP_003544876.2|  PREDICTED: cytochrome P450 86A1-like               173   2e-47   Glycine max [soybeans]
ref|NP_001044838.1|  Os01g0854800                                       172   3e-47   
ref|XP_007051777.1|  Cytochrome P450 86A2 isoform 3                     172   4e-47   
gb|KJB19906.1|  hypothetical protein B456_003G123900                    171   4e-47   Gossypium raimondii
ref|XP_008667081.1|  PREDICTED: uncharacterized protein LOC100192...    172   5e-47   Zea mays [maize]
ref|XP_010033023.1|  PREDICTED: cytochrome P450 86A1-like               171   5e-47   Eucalyptus grandis [rose gum]
gb|ACN34158.1|  unknown                                                 172   6e-47   Zea mays [maize]
ref|XP_010923101.1|  PREDICTED: cytochrome P450 86A1-like               171   7e-47   Elaeis guineensis
gb|AHD25487.1|  cytochrome-P450 monooxygenase CYP86                     171   8e-47   Zea nicaraguensis
ref|XP_004970620.1|  PREDICTED: cytochrome P450 86A1-like               171   1e-46   Setaria italica
ref|NP_001141372.1|  uncharacterized protein LOC100273463               171   1e-46   Zea mays [maize]
gb|ACG34921.1|  cytochrome P450 CYP86A34                                171   1e-46   Zea mays [maize]
dbj|BAJ86471.1|  predicted protein                                      171   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC73748.1|  hypothetical protein OsI_08390                          170   1e-46   Oryza sativa Indica Group [Indian rice]
gb|AFW72704.1|  putative cytochrome P450 superfamily protein            170   2e-46   
gb|ACG33785.1|  cytochrome P450 CYP86A36                                170   2e-46   Zea mays [maize]
ref|XP_010043449.1|  PREDICTED: cytochrome P450 86A1                    170   2e-46   Eucalyptus grandis [rose gum]
gb|ACG38359.1|  cytochrome P450 CYP86A35                                170   2e-46   Zea mays [maize]
gb|AAG17470.1|AF123610_9  cytochrome P450                               170   2e-46   Triticum aestivum [Canadian hard winter wheat]
gb|KJB55751.1|  hypothetical protein B456_009G092900                    170   2e-46   Gossypium raimondii
gb|ACN27732.1|  unknown                                                 170   2e-46   Zea mays [maize]
ref|NP_001047674.1|  Os02g0666500                                       170   2e-46   
ref|XP_002299820.2|  Cytochrome P450 86A1 family protein                169   3e-46   
ref|XP_002456654.1|  hypothetical protein SORBIDRAFT_03g040250          169   3e-46   Sorghum bicolor [broomcorn]
ref|NP_001053543.1|  Os04g0560100                                       169   4e-46   
ref|XP_010104672.1|  Cytochrome P450 86A1                               169   5e-46   Morus notabilis
ref|XP_003570074.1|  PREDICTED: cytochrome P450 86A2-like               169   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_010443636.1|  PREDICTED: cytochrome P450 86A1                    168   6e-46   Camelina sativa [gold-of-pleasure]
gb|KFK27415.1|  hypothetical protein AALP_AA8G379800                    168   6e-46   Arabis alpina [alpine rockcress]
ref|XP_010483494.1|  PREDICTED: cytochrome P450 86A1-like               168   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010454344.1|  PREDICTED: cytochrome P450 86A1                    168   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002862636.1|  cytochrome P450                                    168   7e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_011032144.1|  PREDICTED: cytochrome P450 86A1                    168   7e-46   Populus euphratica
ref|XP_006647656.1|  PREDICTED: cytochrome P450 86A2-like               168   8e-46   Oryza brachyantha
ref|XP_006280320.1|  hypothetical protein CARUB_v10026242mg             168   8e-46   Capsella rubella
ref|NP_200694.1|  cytochrome P450 86A1                                  168   8e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAL91155.1|  cytochrome P450                                         168   8e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002448320.1|  hypothetical protein SORBIDRAFT_06g025170          168   8e-46   Sorghum bicolor [broomcorn]
ref|XP_010262795.1|  PREDICTED: cytochrome P450 86A1                    168   8e-46   Nelumbo nucifera [Indian lotus]
emb|CAA62082.1|  cytochrome p450                                        168   9e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955136.1|  PREDICTED: cytochrome P450 86A2-like               167   9e-46   
emb|CDY02846.1|  BnaC02g10430D                                          165   1e-45   
emb|CDY61020.1|  BnaAnng17300D                                          167   1e-45   Brassica napus [oilseed rape]
ref|XP_002452782.1|  hypothetical protein SORBIDRAFT_04g032410          168   1e-45   Sorghum bicolor [broomcorn]
gb|ABZ80831.1|  CYP86A32 fatty acid omega-hydroxylase                   167   1e-45   Quercus suber [cork oak]
ref|XP_008667082.1|  PREDICTED: uncharacterized protein LOC100192...    168   1e-45   
ref|XP_002525608.1|  cytochrome P450, putative                          167   1e-45   Ricinus communis
emb|CDY32676.1|  BnaA02g07380D                                          165   1e-45   Brassica napus [oilseed rape]
gb|EMT01938.1|  Cytochrome P450 86A2                                    167   2e-45   
dbj|BAJ88802.1|  predicted protein                                      167   2e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010520223.1|  PREDICTED: cytochrome P450 86A1                    167   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_009132026.1|  PREDICTED: cytochrome P450 86A1-like               167   3e-45   Brassica rapa
ref|XP_009407544.1|  PREDICTED: cytochrome P450 86A1                    167   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFN53663.1|  cytochrome P450                                         166   4e-45   Linum usitatissimum
ref|XP_008457385.1|  PREDICTED: cytochrome P450 86A1                    166   4e-45   Cucumis melo [Oriental melon]
gb|KJB08946.1|  hypothetical protein B456_001G115100                    166   4e-45   Gossypium raimondii
gb|EMT14997.1|  Cytochrome P450 86A2                                    166   4e-45   
ref|XP_004490585.1|  PREDICTED: cytochrome P450 86A1-like               166   4e-45   Cicer arietinum [garbanzo]
emb|CDX71150.1|  BnaC03g12340D                                          166   4e-45   
ref|XP_006645037.1|  PREDICTED: cytochrome P450 86A1-like               166   5e-45   Oryza brachyantha
ref|XP_004294257.2|  PREDICTED: cytochrome P450 86A1                    166   5e-45   Fragaria vesca subsp. vesca
ref|XP_004164591.1|  PREDICTED: cytochrome P450 86A1-like               166   6e-45   
ref|XP_004150627.1|  PREDICTED: cytochrome P450 86A1-like               166   6e-45   Cucumis sativus [cucumbers]
gb|EEE61483.1|  hypothetical protein OsJ_15764                          165   7e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007208647.1|  hypothetical protein PRUPE_ppa020227mg             165   9e-45   
gb|EAY95147.1|  hypothetical protein OsI_16965                          165   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006401031.1|  hypothetical protein EUTSA_v10013214mg             165   1e-44   
ref|XP_009126726.1|  PREDICTED: cytochrome P450 86A1                    165   1e-44   Brassica rapa
ref|NP_001183394.1|  uncharacterized protein LOC100501810               164   2e-44   
ref|XP_008358971.1|  PREDICTED: cytochrome P450 86A1-like               164   2e-44   Malus domestica [apple tree]
gb|ACL53124.1|  unknown                                                 164   2e-44   Zea mays [maize]
ref|NP_001130907.1|  putative cytochrome P450 superfamily protein...    164   3e-44   Zea mays [maize]
ref|XP_010650931.1|  PREDICTED: cytochrome P450 86A1                    164   4e-44   Vitis vinifera
ref|XP_009374269.1|  PREDICTED: cytochrome P450 86A1                    164   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_008355259.1|  PREDICTED: cytochrome P450 86A1                    163   5e-44   
ref|XP_010926207.1|  PREDICTED: cytochrome P450 86A1-like               164   5e-44   Elaeis guineensis
ref|XP_002314117.1|  Cytochrome P450 86A1 family protein                163   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008220520.1|  PREDICTED: cytochrome P450 86A1                    163   6e-44   Prunus mume [ume]
ref|XP_011082379.1|  PREDICTED: cytochrome P450 86A1                    163   7e-44   Sesamum indicum [beniseed]
ref|XP_007016155.1|  Cytochrome P450, family 86, subfamily A, pol...    162   9e-44   
ref|XP_003615606.1|  Cytochrome P450                                    162   1e-43   Medicago truncatula
ref|XP_011035187.1|  PREDICTED: cytochrome P450 86A1-like               161   2e-43   Populus euphratica
gb|KDP46522.1|  hypothetical protein JCGZ_08494                         161   3e-43   Jatropha curcas
ref|XP_010541445.1|  PREDICTED: cytochrome P450 86A1-like               161   4e-43   Tarenaya hassleriana [spider flower]
ref|XP_010685596.1|  PREDICTED: cytochrome P450 86A1                    160   5e-43   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO99497.1|  unnamed protein product                                160   5e-43   Coffea canephora [robusta coffee]
ref|NP_001130939.1|  uncharacterized protein LOC100192044               160   5e-43   
ref|XP_006652635.1|  PREDICTED: cytochrome P450 86A4-like               159   3e-42   Oryza brachyantha
ref|XP_006425039.1|  hypothetical protein CICLE_v10030097mg             158   4e-42   Citrus clementina [clementine]
ref|XP_007142224.1|  hypothetical protein PHAVU_008G262600g             157   6e-42   Phaseolus vulgaris [French bean]
ref|XP_006303436.1|  hypothetical protein CARUB_v10010662mg             147   9e-42   
ref|XP_007146731.1|  hypothetical protein PHAVU_006G065000g             157   9e-42   Phaseolus vulgaris [French bean]
gb|EYU38337.1|  hypothetical protein MIMGU_mgv1a005555mg                156   1e-41   Erythranthe guttata [common monkey flower]
gb|EYU45975.1|  hypothetical protein MIMGU_mgv1a025576mg                156   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_009630929.1|  PREDICTED: cytochrome P450 86A1                    156   2e-41   Nicotiana tomentosiformis
ref|XP_004241175.1|  PREDICTED: cytochrome P450 86A1                    156   3e-41   Solanum lycopersicum
ref|XP_009763725.1|  PREDICTED: cytochrome P450 86A1                    155   3e-41   Nicotiana sylvestris
ref|XP_002883546.1|  cytochrome P450                                    154   8e-41   
ref|XP_006848139.1|  hypothetical protein AMTR_s00029p00225720          152   2e-40   
ref|NP_001275219.1|  CYP86A33 fatty acid omega-hydroxylase              152   6e-40   Solanum tuberosum [potatoes]
gb|KHN47607.1|  Cytochrome P450 86A1                                    151   1e-39   Glycine soja [wild soybean]
ref|XP_003538284.1|  PREDICTED: cytochrome P450 86A1-like isoform 1     151   2e-39   Glycine max [soybeans]
ref|XP_004500237.1|  PREDICTED: cytochrome P450 86A1-like               149   5e-39   Cicer arietinum [garbanzo]
ref|XP_002511875.1|  cytochrome P450, putative                          148   2e-38   
gb|KEH34209.1|  cytochrome P450 family-dependent fatty acid hydro...    143   9e-37   Medicago truncatula
gb|KHN40058.1|  Cytochrome P450 86A1                                    114   7e-27   Glycine soja [wild soybean]
gb|ACO87292.1|  LACERATA                                                106   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001760399.1|  predicted protein                                97.4    3e-20   
ref|XP_001782495.1|  predicted protein                                94.7    3e-19   
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg              93.2    8e-19   Erythranthe guttata [common monkey flower]
ref|XP_006857146.1|  hypothetical protein AMTR_s00065p00159700        89.4    4e-18   
ref|XP_006828488.1|  hypothetical protein AMTR_s00060p00164420        88.2    9e-18   
ref|XP_008222001.1|  PREDICTED: cytochrome P450 86B1-like             88.6    4e-17   
gb|ADG34845.1|  cytochrome P450 protein                               87.0    1e-16   Vanda hybrid cultivar
ref|XP_010249432.1|  PREDICTED: cytochrome P450 86B1                  86.3    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_002988762.1|  hypothetical protein SELMODRAFT_128482           86.3    3e-16   
ref|XP_002986290.1|  fatty acid omega-hydroxylase                     85.9    3e-16   
emb|CDP22261.1|  unnamed protein product                              83.2    3e-16   Coffea canephora [robusta coffee]
ref|XP_006848958.1|  hypothetical protein AMTR_s00166p00062440        82.8    7e-16   
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg              84.7    7e-16   Erythranthe guttata [common monkey flower]
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like             83.2    3e-15   Nicotiana tomentosiformis
ref|XP_008778343.1|  PREDICTED: cytochrome P450 704B1                 83.2    3e-15   
gb|ACR38435.1|  unknown                                               82.4    6e-15   Zea mays [maize]
ref|XP_009393106.1|  PREDICTED: cytochrome P450 94A1-like             82.0    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010242506.1|  PREDICTED: cytochrome P450 86B1-like             82.0    8e-15   Nelumbo nucifera [Indian lotus]
gb|EMS66236.1|  Cytochrome P450 86B1                                  80.5    1e-14   Triticum urartu
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like             81.6    1e-14   Nicotiana sylvestris
ref|XP_007225033.1|  hypothetical protein PRUPE_ppa019933mg           81.3    1e-14   
emb|CEI88703.1|  hypothetical protein RMCBS344292_03083               80.1    2e-14   Rhizopus microsporus
ref|XP_011457419.1|  PREDICTED: cytochrome P450 86B1-like             80.5    2e-14   Fragaria vesca subsp. vesca
ref|XP_010250974.1|  PREDICTED: cytochrome P450 86B1-like             80.5    2e-14   Nelumbo nucifera [Indian lotus]
dbj|BAF46296.1|  cytochrome P450                                      80.5    3e-14   Ipomoea nil [qian niu]
ref|XP_010551418.1|  PREDICTED: cytochrome P450 704B1                 80.5    3e-14   
gb|EEE54005.1|  hypothetical protein OsJ_00650                        80.1    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like             80.1    3e-14   Nicotiana tomentosiformis
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like             80.1    3e-14   Camelina sativa [gold-of-pleasure]
ref|NP_001042228.1|  Os01g0183600                                     79.7    4e-14   
gb|EAY72807.1|  hypothetical protein OsI_00673                        79.7    4e-14   Oryza sativa Indica Group [Indian rice]
gb|KJB44293.1|  hypothetical protein B456_007G244800                  79.7    4e-14   Gossypium raimondii
ref|XP_004301072.2|  PREDICTED: cytochrome P450 94B3-like             77.0    5e-14   Fragaria vesca subsp. vesca
gb|KFK41374.1|  hypothetical protein AALP_AA2G122000                  79.3    6e-14   Arabis alpina [alpine rockcress]
ref|XP_008797199.1|  PREDICTED: cytochrome P450 86B1-like             79.7    6e-14   
emb|CAB93726.1|  cytochrome P450-like protein                         79.3    6e-14   
ref|XP_006391009.1|  hypothetical protein EUTSA_v10018405mg           79.3    6e-14   
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like             79.0    8e-14   
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like             79.0    8e-14   
ref|XP_006302101.1|  hypothetical protein CARUB_v10020091mg           79.0    8e-14   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like             79.0    8e-14   
dbj|BAK08270.1|  predicted protein                                    79.0    8e-14   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like             79.0    8e-14   
ref|XP_010423121.1|  PREDICTED: cytochrome P450 86B1-like             79.0    9e-14   
emb|CEG77553.1|  hypothetical protein RMATCC62417_12281               79.0    9e-14   
emb|CDY40931.1|  BnaC06g30690D                                        78.6    1e-13   
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like             78.6    1e-13   
gb|ADE75655.1|  unknown                                               78.6    1e-13   
emb|CEG64598.1|  hypothetical protein RMATCC62417_01541               78.6    1e-13   
ref|XP_002874114.1|  CYP86B1                                          78.6    1e-13   
emb|CEP10893.1|  hypothetical protein                                 78.6    1e-13   
ref|XP_002264277.2|  PREDICTED: cytochrome P450 86B1-like isoform X1  78.6    1e-13   
ref|NP_001049092.2|  Os03g0168600                                     75.5    1e-13   
emb|CAN63571.1|  hypothetical protein VITISV_008250                   78.6    1e-13   
ref|XP_010648167.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  78.6    1e-13   
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg              78.2    1e-13   
ref|XP_010102176.1|  Cytochrome P450 704C1                            78.6    1e-13   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein          78.6    1e-13   
ref|XP_003558727.1|  PREDICTED: cytochrome P450 704B1                 78.6    1e-13   
ref|XP_002522465.1|  cytochrome P450, putative                        78.2    1e-13   
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like             78.2    1e-13   
ref|XP_002873349.1|  predicted protein                                78.2    1e-13   
ref|XP_009105494.1|  PREDICTED: cytochrome P450 704B1                 78.2    1e-13   
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590        78.2    2e-13   
ref|XP_006286797.1|  hypothetical protein CARUB_v10003490mg           78.2    2e-13   
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like             78.2    2e-13   
gb|EIE89611.1|  hypothetical protein RO3G_14322                       78.2    2e-13   
ref|XP_006651077.1|  PREDICTED: cytochrome P450 704C1-like            76.6    2e-13   
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like             77.8    2e-13   
ref|XP_011070985.1|  PREDICTED: cytochrome P450 704B1                 77.8    2e-13   
ref|XP_010683141.1|  PREDICTED: cytochrome P450 704B1                 77.8    2e-13   
ref|XP_002523775.1|  cytochrome P450, putative                        77.8    2e-13   
dbj|BAK06748.1|  predicted protein                                    77.8    2e-13   
ref|XP_010258425.1|  PREDICTED: cytochrome P450 704B1                 77.8    2e-13   
ref|NP_197710.1|  cytochrome P450 86B1                                77.4    3e-13   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like             77.4    3e-13   
ref|XP_004298418.1|  PREDICTED: cytochrome P450 704B1                 77.4    3e-13   
ref|XP_006290052.1|  hypothetical protein CARUB_v10003687mg           77.4    3e-13   
dbj|BAK06287.1|  predicted protein                                    77.0    3e-13   
gb|KFK35660.1|  cytochrome p450                                       77.0    3e-13   
gb|KJB50631.1|  hypothetical protein B456_008G180000                  77.0    4e-13   
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like             77.0    4e-13   
ref|XP_007046038.1|  Cytochrome P450, family 704, subfamily B, po...  77.0    4e-13   
ref|XP_009412188.1|  PREDICTED: cytochrome P450 94A1-like             77.0    4e-13   
ref|XP_007046039.1|  Cytochrome P450, family 704, subfamily B, po...  77.0    4e-13   
ref|XP_010910908.1|  PREDICTED: cytochrome P450 86B1-like             77.0    4e-13   
ref|XP_003528679.1|  PREDICTED: cytochrome P450 704C1-like            77.0    4e-13   
emb|CDY38915.1|  BnaA03g12640D                                        74.3    4e-13   
ref|XP_008389448.1|  PREDICTED: cytochrome P450 704B1                 77.0    4e-13   
ref|XP_006399311.1|  hypothetical protein EUTSA_v10013132mg           77.0    5e-13   
ref|XP_006643843.1|  PREDICTED: cytochrome P450 86B1-like             76.6    5e-13   
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like             76.6    5e-13   
ref|XP_010452806.1|  PREDICTED: cytochrome P450 86B1 isoform X2       76.3    5e-13   
gb|KHN01450.1|  Cytochrome P450 704C1                                 76.6    5e-13   
emb|CDY61911.1|  BnaC07g49710D                                        76.6    5e-13   
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like             76.6    6e-13   
gb|EMS55452.1|  Cytochrome P450 86B1                                  76.3    6e-13   
ref|XP_010044484.1|  PREDICTED: cytochrome P450 704B1                 76.3    6e-13   
gb|EMT08626.1|  Cytochrome P450 704C1                                 76.6    6e-13   
ref|XP_010493430.1|  PREDICTED: cytochrome P450 86B1 isoform X1       76.3    6e-13   
gb|EAZ25728.1|  hypothetical protein OsJ_09563                        76.3    7e-13   
ref|XP_007135410.1|  hypothetical protein PHAVU_010G126900g           76.3    7e-13   
ref|XP_002468241.1|  hypothetical protein SORBIDRAFT_01g042310        76.3    7e-13   
tpg|DAA44138.1|  TPA: putative cytochrome P450 superfamily protein    76.3    7e-13   
gb|EAY88702.1|  hypothetical protein OsI_10177                        76.3    7e-13   
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like             76.3    8e-13   
ref|XP_001781706.1|  predicted protein                                75.9    8e-13   
ref|XP_010421118.1|  PREDICTED: cytochrome P450 86B1-like             76.3    8e-13   
ref|XP_010470937.1|  PREDICTED: cytochrome P450 704B1-like            75.9    8e-13   
ref|XP_004952982.1|  PREDICTED: cytochrome P450 86B1-like             75.9    8e-13   
gb|EYU28779.1|  hypothetical protein MIMGU_mgv1a004727mg              75.9    8e-13   
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like             75.9    8e-13   
ref|XP_003572681.2|  PREDICTED: cytochrome P450 86B1                  75.9    9e-13   
ref|XP_010452805.1|  PREDICTED: cytochrome P450 86B1 isoform X1       75.9    9e-13   
gb|KDO82148.1|  hypothetical protein CISIN_1g041858mg                 75.9    1e-12   
emb|CDX72120.1|  BnaC08g27540D                                        75.9    1e-12   
ref|XP_004510551.1|  PREDICTED: cytochrome P450 704C1-like            75.9    1e-12   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like             75.9    1e-12   
gb|KDO80235.1|  hypothetical protein CISIN_1g035880mg                 75.9    1e-12   
gb|KGN61391.1|  hypothetical protein Csa_2G108690                     75.9    1e-12   
ref|XP_002887239.1|  oxygen binding protein                           75.9    1e-12   
ref|XP_008810187.1|  PREDICTED: cytochrome P450 94A1-like             75.5    1e-12   
ref|NP_177109.3|  cytochrome P450, family 704, subfamily B, polyp...  75.5    1e-12   
ref|XP_010415594.1|  PREDICTED: cytochrome P450 704B1-like            75.5    1e-12   
ref|XP_009116365.1|  PREDICTED: cytochrome P450 94B3                  75.5    1e-12   
ref|XP_006450915.1|  hypothetical protein CICLE_v10010274mg           75.5    1e-12   
ref|XP_006475855.1|  PREDICTED: cytochrome P450 704C1-like            75.5    1e-12   
ref|XP_010511987.1|  PREDICTED: cytochrome P450 704B1                 75.5    1e-12   
ref|XP_010933285.1|  PREDICTED: cytochrome P450 86B1-like             75.5    1e-12   
ref|XP_006827309.1|  hypothetical protein AMTR_s00010p00266280        75.1    1e-12   
ref|XP_010454600.1|  PREDICTED: cytochrome P450 86B1-like             75.5    1e-12   
ref|XP_006438203.1|  hypothetical protein CICLE_v10033706mg           75.5    1e-12   
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...  75.5    2e-12   
gb|EPS60789.1|  hypothetical protein M569_14012                       75.1    2e-12   
ref|XP_008390106.1|  PREDICTED: cytochrome P450 86B1                  75.1    2e-12   
ref|XP_010682470.1|  PREDICTED: cytochrome P450 86B1-like             75.9    2e-12   
gb|EEC74485.1|  hypothetical protein OsI_09945                        75.1    2e-12   
ref|XP_010275501.1|  PREDICTED: cytochrome P450 86B1-like             75.1    2e-12   
dbj|BAJ87689.1|  predicted protein                                    75.1    2e-12   
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like             75.1    2e-12   
ref|XP_007225718.1|  hypothetical protein PRUPE_ppa004298mg           75.1    2e-12   
gb|AAL84318.1|AC073556_35  putative plant cytochrome P-450 protein    75.1    2e-12   
ref|XP_003609660.1|  Cytochrome P450                                  75.1    2e-12   
ref|XP_003624855.1|  Cytochrome P450                                  74.7    2e-12   
emb|CEI92088.1|  hypothetical protein RMCBS344292_06361               74.7    2e-12   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...  74.7    2e-12   
ref|XP_004985564.1|  PREDICTED: cytochrome P450 704C1-like isofor...  74.7    2e-12   
ref|XP_004985563.1|  PREDICTED: cytochrome P450 704C1-like isofor...  74.7    2e-12   
ref|XP_009130123.1|  PREDICTED: cytochrome P450 86B1-like             74.7    2e-12   
gb|EPB91278.1|  hypothetical protein HMPREF1544_01794                 74.7    2e-12   
ref|XP_002893825.1|  CYP94D1                                          74.7    2e-12   
emb|CBI32822.3|  unnamed protein product                              74.3    2e-12   
ref|XP_008652957.1|  PREDICTED: cytochrome P450 94B3-like             74.7    2e-12   
ref|XP_004138991.1|  PREDICTED: cytochrome P450 704C1-like            74.7    2e-12   
dbj|GAN05167.1|  cytochrome P450                                      74.7    2e-12   
ref|XP_002465796.1|  hypothetical protein SORBIDRAFT_01g045960        74.7    2e-12   
ref|XP_010109842.1|  Cytochrome P450                                  71.6    2e-12   
ref|XP_010651872.1|  PREDICTED: cytochrome P450 704B1                 74.7    3e-12   
ref|XP_008793701.1|  PREDICTED: cytochrome P450 86B1                  74.7    3e-12   
ref|XP_002278009.1|  PREDICTED: cytochrome P450 94A1                  74.3    3e-12   
ref|XP_011017522.1|  PREDICTED: cytochrome P450 704B1                 74.7    3e-12   
emb|CDY32582.1|  BnaC03g15500D                                        74.3    3e-12   
gb|ACG35470.1|  cytochrome P450 CYP704B12v2                           74.3    3e-12   
gb|EMT20488.1|  Cytochrome P450 86A2                                  74.3    3e-12   
ref|NP_001130648.1|  male sterile26                                   74.3    3e-12   
gb|KDP41226.1|  hypothetical protein JCGZ_15633                       74.3    3e-12   
emb|CBI24223.3|  unnamed protein product                              72.4    3e-12   
tpg|DAA49553.1|  TPA: putative cytochrome P450 superfamily protein    74.3    3e-12   
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like             74.3    3e-12   
emb|CDY46948.1|  BnaA02g32980D                                        74.3    3e-12   
ref|XP_008790365.1|  PREDICTED: cytochrome P450 94A1-like             74.3    3e-12   
emb|CDY56777.1|  BnaAnng14430D                                        73.9    3e-12   
ref|XP_009413465.1|  PREDICTED: cytochrome P450 704B1                 73.9    4e-12   
dbj|GAN03750.1|  cytochrome P450 704C1-like isoform X2                73.9    4e-12   
gb|KFK27637.1|  hypothetical protein AALP_AA8G409300                  74.3    4e-12   
ref|XP_007048137.1|  Cytochrome P450                                  73.9    4e-12   
ref|XP_008441698.1|  PREDICTED: cytochrome P450 704B1                 73.9    4e-12   
ref|XP_008221727.1|  PREDICTED: cytochrome P450 704B1                 73.9    4e-12   
ref|XP_003607255.1|  Cytochrome P450                                  73.9    4e-12   
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like             73.9    4e-12   
dbj|BAJ91452.1|  predicted protein                                    73.9    5e-12   
dbj|BAJ91842.1|  predicted protein                                    73.9    5e-12   
ref|XP_010673085.1|  PREDICTED: cytochrome P450 94A1-like             73.6    5e-12   
ref|NP_174713.1|  cytochrome P450, family 94, subfamily D, polype...  73.6    5e-12   
emb|CEG77978.1|  hypothetical protein RMATCC62417_12647               71.2    5e-12   
gb|ABK28430.1|  unknown                                               73.6    5e-12   
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like             73.6    6e-12   
ref|NP_196442.2|  cytochrome P450 superfamily protein                 73.6    6e-12   
ref|XP_003611900.1|  Cytochrome P450                                  73.6    6e-12   
gb|AJD25225.1|  cytochrome P450 CYP96A85                              73.6    6e-12   
ref|XP_010516270.1|  PREDICTED: cytochrome P450 94B3-like             73.6    6e-12   
ref|XP_002876375.1|  CYP94D2                                          73.6    6e-12   
gb|KDO53671.1|  hypothetical protein CISIN_1g038353mg                 70.9    6e-12   
gb|EYU18592.1|  hypothetical protein MIMGU_mgv1a0268912mg             70.5    7e-12   
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1       73.2    7e-12   
ref|XP_010905515.1|  PREDICTED: cytochrome P450 86B1-like             73.2    7e-12   
ref|XP_006394587.1|  hypothetical protein EUTSA_v10003923mg           73.2    7e-12   
ref|XP_008461842.1|  PREDICTED: cytochrome P450 86B1-like             73.2    7e-12   
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like             73.2    7e-12   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                 73.2    8e-12   
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                  73.2    8e-12   
ref|XP_008244020.1|  PREDICTED: cytochrome P450 94A1-like             73.2    8e-12   
emb|CDY53179.1|  BnaA06g40580D                                        73.2    8e-12   
ref|XP_007162039.1|  hypothetical protein PHAVU_001G118600g           73.2    8e-12   
ref|XP_007044873.1|  Cytochrome P450 86A2                             73.6    8e-12   
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg           73.2    8e-12   
ref|XP_004135954.1|  PREDICTED: cytochrome P450 86B1-like             73.2    8e-12   
ref|XP_004158225.1|  PREDICTED: cytochrome P450 86B1-like             73.2    8e-12   
gb|AFW89633.1|  putative cytochrome P450 superfamily protein          73.2    8e-12   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like             72.8    9e-12   
ref|XP_008461361.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  73.2    9e-12   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like             73.2    9e-12   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg           73.2    9e-12   
dbj|BAJ88840.1|  predicted protein                                    72.8    9e-12   
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein    72.8    9e-12   
ref|XP_008796515.1|  PREDICTED: cytochrome P450 86B1-like             72.8    1e-11   
ref|XP_008360918.1|  PREDICTED: cytochrome P450 94A2-like             72.8    1e-11   
ref|NP_001141467.1|  uncharacterized protein LOC100273577             72.8    1e-11   
ref|XP_008393293.1|  PREDICTED: cytochrome P450 94A2-like             72.8    1e-11   
emb|CDY53182.1|  BnaA06g40610D                                        72.4    1e-11   
dbj|BAJ87982.1|  predicted protein                                    72.8    1e-11   
ref|XP_008351912.1|  PREDICTED: cytochrome P450 94A2-like             72.8    1e-11   
ref|XP_002312255.2|  cytochrome P450 family protein                   72.4    1e-11   
gb|KHG09498.1|  Cytochrome P450 protein                               72.8    1e-11   
ref|XP_006661879.1|  PREDICTED: cytochrome P450 86B1-like             72.8    1e-11   
ref|XP_002310074.1|  hypothetical protein POPTR_0007s07700g           72.8    1e-11   
ref|XP_002866853.1|  CYP96A10                                         72.4    1e-11   
ref|XP_011006771.1|  PREDICTED: cytochrome P450 86B1-like             72.8    1e-11   
ref|XP_010094084.1|  Cytochrome P450                                  72.8    1e-11   
emb|CAN75428.1|  hypothetical protein VITISV_003302                   72.4    1e-11   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                       72.4    1e-11   
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                  72.4    1e-11   
ref|XP_006482377.1|  PREDICTED: cytochrome P450 94A1-like             72.4    1e-11   
emb|CDY32023.1|  BnaC06g16010D                                        72.4    1e-11   
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like             72.4    1e-11   
emb|CDY32024.1|  BnaC06g16020D                                        73.2    1e-11   
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like             72.4    1e-11   
ref|XP_002979701.1|  hypothetical protein SELMODRAFT_111270           72.4    1e-11   
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like             72.4    1e-11   
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like             72.4    2e-11   
emb|CDY40805.1|  BnaC02g41740D                                        72.0    2e-11   
emb|CDX67653.1|  BnaA07g16930D                                        72.0    2e-11   
gb|EAZ25521.1|  hypothetical protein OsJ_09345                        72.0    2e-11   
ref|XP_004985159.1|  PREDICTED: cytochrome P450 94A1-like             72.0    2e-11   
ref|XP_010100345.1|  Cytochrome P450                                  72.0    2e-11   
ref|XP_002988354.1|  hypothetical protein SELMODRAFT_127881           72.4    2e-11   
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like             72.0    2e-11   
gb|ABF93892.1|  Cytochrome P450 family protein                        72.0    2e-11   
gb|ABF93891.1|  Cytochrome P450 family protein                        72.0    2e-11   
gb|EAY88475.1|  hypothetical protein OsI_09946                        72.0    2e-11   
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...  72.0    2e-11   
ref|XP_010527733.1|  PREDICTED: cytochrome P450 86B1-like             70.1    2e-11   
ref|NP_001064901.2|  Os10g0486100                                     72.0    2e-11   
gb|AAL59025.1|AC087182_8  putative cytochrome P450 protein            72.0    2e-11   
ref|XP_009136378.1|  PREDICTED: cytochrome P450 86B1                  72.0    2e-11   



>gb|AJD25207.1| cytochrome P450 CYP86A91 [Salvia miltiorrhiza]
Length=555

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+++ALLLFS VTCYLLWFTFIS SLKGP VWP+LGSLPGLIENA+RMH+WIADNLRAC
Sbjct  1    MDMSMALLLFSAVTCYLLWFTFISKSLKGPRVWPVLGSLPGLIENADRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004229934.1| PREDICTED: cytochrome P450 86A8-like [Solanum lycopersicum]
Length=526

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+A+ALLLFS +TCYLLWFTFIS SLKGP VWPLLGSLPGLIEN+ERMHEWI DNLRAC
Sbjct  1    MDIAIALLLFSFITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHEWIVDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RF+NYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_011092582.1| PREDICTED: cytochrome P450 86A8-like [Sesamum indicum]
Length=521

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+++ALLLF+ VTCYLLWFTFIS SLKGP VWPLLGSLPGLIENA+RMH+WIADNLRAC
Sbjct  1    MDISLALLLFTAVTCYLLWFTFISKSLKGPRVWPLLGSLPGLIENADRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKARFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009629836.1| PREDICTED: cytochrome P450 86A8 [Nicotiana tomentosiformis]
Length=536

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+A+ALLLF+ +TCYLLWFTFIS SLKGP VWPLLGSLPGLIEN+ERMH+WI DNLRAC
Sbjct  1    MDIAIALLLFTAITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RF+NYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006339587.1| PREDICTED: cytochrome P450 86A2-like [Solanum tuberosum]
Length=535

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+A+AL LFS +TCYLLWFTFIS SLKGP VWPLLGSLPGLIEN+ERMH+WI DNLRAC
Sbjct  1    MDIAIALFLFSSITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RF+NYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFENYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009797232.1| PREDICTED: cytochrome P450 86A8-like [Nicotiana sylvestris]
Length=538

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+A+ALLLF+ +TCYLLWFTFIS SLKGP VWPLLGSLPGLIEN+ERMH+WI DNLRAC
Sbjct  1    MDIAIALLLFTAITCYLLWFTFISRSLKGPRVWPLLGSLPGLIENSERMHDWIVDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHIL+ RF+NYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILRTRFENYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|EYU32135.1| hypothetical protein MIMGU_mgv1a003916mg [Erythranthe guttata]
Length=555

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+++ALLLF+ VTCYLLWFTFIS SL+GP VWPLLGSLPGLIEN++R+HEWI+DNLRAC
Sbjct  1    MDVSLALLLFTAVTCYLLWFTFISKSLRGPRVWPLLGSLPGLIENSDRLHEWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010544737.1| PREDICTED: cytochrome P450 86A8 [Tarenaya hassleriana]
Length=531

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ S +T YLLWFTFI  SLKGP VWPLLGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MDISTALMILSAITAYLLWFTFICRSLKGPRVWPLLGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004306772.1| PREDICTED: cytochrome P450 86A8-like [Fragaria vesca subsp. vesca]
Length=553

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++  ALLLF+ VT YLLWFTFIS SLKGP VWPLLGSLPGLIEN +R+H+WI DNLRAC
Sbjct  1    MEIGTALLLFTAVTVYLLWFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKN+EHILK+RFDNYPKGP WQSVFH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNVEHILKSRFDNYPKGPTWQSVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDP08799.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MDLA+ALLLF+G+  YLLWFTFIS   KGP VW LLGSLPGLIENA+RMHEWIADNL AC
Sbjct  1    MDLAIALLLFTGIISYLLWFTFISRPFKGPRVWLLLGSLPGLIENADRMHEWIADNLSAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQT ICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTSICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CBI40391.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+  A L F  +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN+ERMHEWIA+NLRAC
Sbjct  1    MDVFWASLFFMAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENSERMHEWIAENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ VFH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQGVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010053722.1| PREDICTED: cytochrome P450 86A8-like [Eucalyptus grandis]
Length=548

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD A ALL+ + +T YL+WFTFIS SLKGP VWPLLGSLPGLIEN +RMH+WIADNL AC
Sbjct  1    MDAATALLVLTAITAYLIWFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWIADNLLAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPRNLEHILKARFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KDO86201.1| hypothetical protein CISIN_1g009235mg [Citrus sinensis]
Length=539

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD A A LLF+ VT YLLWFTFIS SLKGP VWPLLGSLPGLIEN +R+H+WI+DNLRAC
Sbjct  1    MDAATAFLLFTAVTAYLLWFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFL +KQGLVTVTCDPKN+EHILK+RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLTKKQGLVTVTCDPKNIEHILKHRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006445018.1| hypothetical protein CICLE_v10019633mg [Citrus clementina]
 ref|XP_006491128.1| PREDICTED: cytochrome P450 86A2-like [Citrus sinensis]
 gb|ESR58258.1| hypothetical protein CICLE_v10019633mg [Citrus clementina]
Length=539

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD A A LLF+ VT YLLWFTFIS SLKGP VWPLLGSLPGLIEN +R+H+WI+DNLRAC
Sbjct  1    MDAATAFLLFTAVTAYLLWFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFL +KQGLVTVTCDPKN+EHILK+RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLTKKQGLVTVTCDPKNIEHILKHRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KCW78083.1| hypothetical protein EUGRSUZ_D02303 [Eucalyptus grandis]
Length=571

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD A ALL+ + +T YL+WFTFIS SLKGP VWPLLGSLPGLIEN +RMH+WIADNL AC
Sbjct  1    MDAATALLVLTAITAYLIWFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWIADNLLAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPRNLEHILKARFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002275115.1| PREDICTED: cytochrome P450 86A8 [Vitis vinifera]
Length=558

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+  A L F  +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN+ERMHEWIA+NLRAC
Sbjct  1    MDVFWASLFFMAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENSERMHEWIAENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ VFH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQGVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_007218993.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica]
 gb|EMJ20192.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica]
Length=534

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++  ALL+ + +T YLLWFTFIS SLKGP VWPLLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIGTALLVLTAITAYLLWFTFISRSLKGPGVWPLLGSLPGLIENSDRLHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQSVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008244638.1| PREDICTED: cytochrome P450 86A8-like [Prunus mume]
Length=548

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++  ALL+ + +T YLLWFTFIS SLKGP VWPLLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIGTALLVLTAITAYLLWFTFISRSLKGPGVWPLLGSLPGLIENSDRLHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQSVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006293977.1| hypothetical protein CARUB_v10022968mg [Capsella rubella]
 gb|EOA26875.1| hypothetical protein CARUB_v10022968mg [Capsella rubella]
Length=535

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ S +T YLLW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MDISTALMILSAITAYLLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008338834.1| PREDICTED: cytochrome P450 86A8 [Malus domestica]
Length=525

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++  ALL+ + +T YLLWFTFIS SLKGP VWPLLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIGTALLVLTAITAYLLWFTFISRSLKGPRVWPLLGSLPGLIENSDRLHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP NLEHILK RFDNYPKGP WQSVFHELLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPNNLEHILKTRFDNYPKGPTWQSVFHELLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010506590.1| PREDICTED: cytochrome P450 86A8-like isoform X1 [Camelina sativa]
 ref|XP_010506591.1| PREDICTED: cytochrome P450 86A8-like isoform X2 [Camelina sativa]
Length=538

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ + +T YLLW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MDISTALMILTAITAYLLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010518254.1| PREDICTED: cytochrome P450 86A8-like [Camelina sativa]
Length=536

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ + +T YLLW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MDISTALMILTAITAYLLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010087951.1| Cytochrome P450 86A2 [Morus notabilis]
 gb|EXB30873.1| Cytochrome P450 86A2 [Morus notabilis]
Length=556

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ ALLL + +T YLLWFTFIS +LKGP VWPLLGSLPGLIEN +RMH+WI DNLRAC
Sbjct  1    MEISTALLLLTAITVYLLWFTFISRTLKGPRVWPLLGSLPGLIENCDRMHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKNLEHILK+RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPKNLEHILKSRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004510774.1| PREDICTED: cytochrome P450 86A2-like [Cicer arietinum]
Length=539

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+   ALLL + +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    METCTALLLLTAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010508082.1| PREDICTED: cytochrome P450 86A8 [Camelina sativa]
Length=539

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ + +T Y LW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MDISTALMILTAITAYFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010255320.1| PREDICTED: cytochrome P450 86A8 [Nelumbo nucifera]
Length=561

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ +  +LL +GV  YL WF FIS SL GP VWPLLGSLPGLIENA+RMHEWIA+NLRAC
Sbjct  1    METSTVMLLVAGVVAYLFWFRFISRSLNGPRVWPLLGSLPGLIENADRMHEWIAENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula]
 gb|AET02042.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=540

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+   ALLL + +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN ERMH+WI DNLRAC
Sbjct  1    METCTALLLLTAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008342161.1| PREDICTED: cytochrome P450 86A8 [Malus domestica]
Length=553

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++A ALL+ + +T YLLW TFIS SLKGP VW LLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIATALLVLTAITAYLLWLTFISRSLKGPRVWALLGSLPGLIENSDRLHDWIYDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFHELLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQSVFHELLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002882043.1| CYP86A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58302.1| CYP86A8 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009367816.1| PREDICTED: cytochrome P450 86A8 isoform X1 [Pyrus x bretschneideri]
Length=554

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++A ALL+ + +T YL+W TFIS SLKGP VW LLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIATALLVLTAITAYLIWLTFISRSLKGPRVWALLGSLPGLIENSDRLHDWIYDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFHELLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQSVFHELLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009367817.1| PREDICTED: cytochrome P450 86A8 isoform X2 [Pyrus x bretschneideri]
Length=550

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++A ALL+ + +T YL+W TFIS SLKGP VW LLGSLPGLIEN++R+H+WI DNLRAC
Sbjct  1    MEIATALLVLTAITAYLIWLTFISRSLKGPRVWALLGSLPGLIENSDRLHDWIYDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFHELLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQSVFHELLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|NP_182121.1| cytochrome P450, family 86, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 sp|O80823.1|C86A8_ARATH RecName: Full=Cytochrome P450 86A8; AltName: Full=Protein LACERATA 
[Arabidopsis thaliana]
 emb|CAC67445.1| CYP86A8 protein [Arabidopsis thaliana]
 gb|AAL38383.1| At2g45970/F4I18.5 [Arabidopsis thaliana]
 gb|AAM14972.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAN72250.1| At2g45970/F4I18.5 [Arabidopsis thaliana]
 gb|AEC10625.1| cytochrome P450, family 86, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=537

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_011036497.1| PREDICTED: cytochrome P450 86A8-like [Populus euphratica]
Length=565

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLLF+ VT YLLW TFIS SLKGP V+PLLGSLPGLIEN +R+H+WI DNLRAC
Sbjct  1    MDMSTALLLFAAVTTYLLWLTFISRSLKGPRVYPLLGSLPGLIENCDRLHDWIYDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+N+EH+LK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNIEHLLKTRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002320802.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE99117.1| cytochrome P450 family protein [Populus trichocarpa]
Length=565

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLLF+ VT YLLW TFIS SLKGP V+PLLGSLPGLIEN +R+H+WI DNLRAC
Sbjct  1    MDMSTALLLFAAVTTYLLWLTFISRSLKGPRVYPLLGSLPGLIENCDRLHDWIYDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+N+EH+LK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNIEHLLKTRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010670184.1| PREDICTED: cytochrome P450 86A8 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+ V LLL + VT YLLWFTF+S SL+GP VW LLGSLPGLIEN ERMH+W+ADNL AC
Sbjct  1    MDIFVGLLLLTAVTSYLLWFTFMSRSLRGPRVWVLLGSLPGLIENFERMHDWMADNLSAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGAGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KDP28614.1| hypothetical protein JCGZ_14385 [Jatropha curcas]
Length=562

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLL S VT YLLWFTFIS SLKGP V+PLLGSLP LIEN++R+H+WI DNLRAC
Sbjct  1    MDISTALLLLSAVTAYLLWFTFISRSLKGPRVYPLLGSLPDLIENSDRLHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKN+EHILK RFDNYPKGP WQ+VFH+ LG+GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPKNIEHILKTRFDNYPKGPTWQAVFHDFLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CAN80156.1| hypothetical protein VITISV_023926 [Vitis vinifera]
Length=547

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  208  GVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAV  387
             +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN+ERMHEWIA+NLRACGGTYQTCICAV
Sbjct  2    AITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENSERMHEWIAENLRACGGTYQTCICAV  61

Query  388  PFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ VFH+LLG+GIFNS
Sbjct  62   PFLARKQGLVTVTCDPKNLEHILKTRFDNYPKGPTWQXVFHDLLGEGIFNS  112



>gb|KFK37382.1| hypothetical protein AALP_AA4G249700 [Arabis alpina]
Length=532

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWPLLGSLPGLIEN ERMH+WI+DNLRA 
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPLLGSLPGLIENCERMHDWISDNLRAT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILKNRFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKNRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|EPS59487.1| hypothetical protein M569_15318, partial [Genlisea aurea]
Length=502

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MDL+ A L F+ V CYLLWFTFIS SLKGP VWPLLGSLPGLIENA+R+H+WIADNL AC
Sbjct  1    MDLSFAFLFFTAVICYLLWFTFISKSLKGPRVWPLLGSLPGLIENADRLHDWIADNLGAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLAR+QGLVTVT DP NLEHILK RF+NYPKG  WQ+VFH+ LG+GIF
Sbjct  61   GGTYQTCICAVPFLARRQGLVTVTADPGNLEHILKTRFENYPKGETWQAVFHDFLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006397782.1| hypothetical protein EUTSA_v10001389mg [Eutrema salsugineum]
 gb|ESQ39235.1| hypothetical protein EUTSA_v10001389mg [Eutrema salsugineum]
Length=541

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWPL+GSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPLVGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KHN16811.1| Cytochrome P450 86A2 [Glycine soja]
Length=464

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S +  YL+WFTF++ SLKGP VWPL GSLPGLI++A RMH+WIADNLRAC
Sbjct  1    MDASTALMILSAIAAYLIWFTFVTRSLKGPRVWPLFGSLPGLIQHANRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQS FH+LLG+GIF
Sbjct  61   GGTYQTCICALPFLARKQCLVTVTCDPKNLEHILKLRFDNYPKGPTWQSAFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 ref|XP_004159797.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 gb|KGN45664.1| hypothetical protein Csa_6G004550 [Cucumis sativus]
Length=547

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+  AL++ + VT YLLWFTFIS SLKGP +WPLLGSLPGLIEN +R+H+WI+DNLRAC
Sbjct  1    MDVGFALVIVTAVTAYLLWFTFISRSLKGPQMWPLLGSLPGLIENCDRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A PF A+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCIWAFPFFAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KEH21079.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=517

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ + +  YL+WF+FI+ SLKGP VWPLLGSLPGLI +A RMH+WIADNLRAC
Sbjct  1    MDASNALMILTAIAAYLIWFSFITRSLKGPRVWPLLGSLPGLIHHANRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQCLVTVTCDPKNLEHILKLRFDNYPKGPTWQSVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_003525390.1| PREDICTED: cytochrome P450 86A8 [Glycine max]
Length=528

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD A AL++ S +  YL+WFT ++ SLKGP VWPLLGSLPGLI++A RMH+WIADNLRAC
Sbjct  1    MDAATALMILSAIAAYLIWFTLVTRSLKGPRVWPLLGSLPGLIQHANRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQS FH+LLG+GIF
Sbjct  61   GGTYQTCICALPFLARKQCLVTVTCDPKNLEHILKLRFDNYPKGPTWQSAFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDY18885.1| BnaC04g04650D [Brassica napus]
Length=541

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWPL+GSLPGLIEN ERMH+WI+DNL AC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPLVGSLPGLIENCERMHDWISDNLLAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008458223.1| PREDICTED: cytochrome P450 86A8-like [Cucumis melo]
Length=551

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+  AL++ + VT YLLWFTFIS SLKGP +WPLLGSLPGLIEN +R+H+WI+DNLRAC
Sbjct  1    MDVGFALVIVTAVTAYLLWFTFISRSLKGPQMWPLLGSLPGLIENCDRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A PF A+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFHELLGQGIF
Sbjct  61   GGTYQTCIWAFPFFAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHELLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010275632.1| PREDICTED: cytochrome P450 86A8-like [Nelumbo nucifera]
Length=558

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +  LLL + +  YLLWF  IS SLKGP VWPLLGSLPGLI+NA+RMH+WIA+NLRAC
Sbjct  1    MDASTTLLLLAAIMAYLLWFRLISRSLKGPRVWPLLGSLPGLIDNADRMHDWIAENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+P LARKQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAIPSLARKQGLVTVTCDPQNLEHILKTRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|ABC68403.1| cytochrome P450 monooxygenase CYP86A24 [Glycine max]
Length=528

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S +  YL+WFTF++ SLKGP VWPL GSLPGLI++A RMH+WIADNLRAC
Sbjct  1    MDASTALMILSAIAAYLIWFTFVTRSLKGPRVWPLFGSLPGLIQHANRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQS FH+LLG+GIF
Sbjct  61   GGTYQTCICALPFLARKQCLVTVTCDPKNLEHILKLRFDNYPKGPTWQSAFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009143197.1| PREDICTED: cytochrome P450 86A8 [Brassica rapa]
Length=538

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWPL+GSLPGLIEN ERMH+WI+DNL AC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPLVGSLPGLIENCERMHDWISDNLLAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDX74778.1| BnaA05g05240D [Brassica napus]
Length=541

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWPL+GSLPGLIEN ERMH+WI+DNL AC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPLVGSLPGLIENCERMHDWISDNLLAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   SGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_007135090.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris]
 gb|ESW07084.1| hypothetical protein PHAVU_010G099900g [Phaseolus vulgaris]
Length=532

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ + ALL  + +T YL+WFTFIS SLKGP VW LLGSLPGLI+N +RMH+WI DNLRAC
Sbjct  1    METSTALLFLTAITAYLIWFTFISRSLKGPRVWALLGSLPGLIDNCDRMHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP W +VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004503701.1| PREDICTED: cytochrome P450 86A2-like [Cicer arietinum]
Length=516

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A ++ S +  YL+WF+FI+ SLKGP VWPLLGSLPGL+++A RMH+WIADNLRAC
Sbjct  1    MDASTAFMILSAIAAYLIWFSFITRSLKGPRVWPLLGSLPGLVQHANRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQ+ FH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQCLVTVTCDPKNLEHILKLRFDNYPKGPMWQAAFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_003521880.1| PREDICTED: cytochrome P450 86A8-like [Glycine max]
Length=533

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+   ALL  + +T YL+WFTFIS SLKGP VW LLGSLPGLI+N +RMH+WI DNLRAC
Sbjct  1    METCTALLFLTAITAYLIWFTFISRSLKGPRVWALLGSLPGLIDNCDRMHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP W +VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            N+
Sbjct  121  NT  122



>ref|XP_006583288.1| PREDICTED: cytochrome P450 86A8-like [Glycine max]
Length=532

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+   ALL  + +T YL+WFTFIS SLKGP VW LLGSLPGLI+N +RMH+WI DNLRAC
Sbjct  1    METCTALLFLTAITAYLIWFTFISRSLKGPRVWALLGSLPGLIDNCDRMHDWICDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP W +VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLAKKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            N+
Sbjct  121  NT  122



>gb|KJB52139.1| hypothetical protein B456_008G247600 [Gossypium raimondii]
Length=562

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +VAL++ S V  YL+WF FI+ SL GP VWPLLGSLPGLIEN+  MHEWIADNLRAC
Sbjct  1    MDASVALMILSAVVVYLVWFKFIARSLNGPRVWPLLGSLPGLIENSNCMHEWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+PFLARKQGLVTVTCDP NLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCIAAIPFLARKQGLVTVTCDPNNLEHILKGRFDNYPKGPFWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010457027.1| PREDICTED: cytochrome P450 86A2-like [Camelina sativa]
Length=172

 Score =   201 bits (512),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A+LL +  T Y LWF  IS  L GP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNAMLLVAVATAYWLWFKRISRWLNGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_007040281.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
 gb|EOY24782.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 [Theobroma 
cacao]
Length=541

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S +  YL+WF  I+ SL GP VWPLLGSLPGLI+N+  MHEWIA+NLRAC
Sbjct  1    MDASTALMILSAIAAYLVWFKLITRSLHGPRVWPLLGSLPGLIQNSNCMHEWIAENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGPNWQ+VFH+LLG GIF
Sbjct  61   GGTYQTCISAIPFLARKQGLVTVTCDPKNLEHILKGRFDNYPKGPNWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010089087.1| Cytochrome P450 86A2 [Morus notabilis]
 gb|EXB37334.1| Cytochrome P450 86A2 [Morus notabilis]
Length=547

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ + AL++ S V  Y++WF  IS S+KGP VWP+ GSLPGL+++++RMH+WIA+NLR C
Sbjct  1    MEASTALMILSAVAAYMIWFRLISGSMKGPRVWPIFGSLPGLVQHSQRMHDWIAENLRTC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KJB25882.1| hypothetical protein B456_004G213300 [Gossypium raimondii]
Length=534

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S +  YL+WF FIS SL GP VWPLLGSLPGLI+N+  MHEWIADNLRAC
Sbjct  1    MDGSTALMILSAMVAYLVWFKFISRSLNGPRVWPLLGSLPGLIQNSTCMHEWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+P LARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCIAAIPLLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_011022670.1| PREDICTED: cytochrome P450 86A7-like [Populus euphratica]
Length=541

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ AL++ + V  YL+W +FIS SLKGP VWPL GSLPGLI ++ RMH+WIADNLR C
Sbjct  1    MDISAALMILTAVVTYLIWLSFISRSLKGPRVWPLFGSLPGLIRHSSRMHDWIADNLRKC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC+ A+P +ARKQ LVTVTCDPKNLEHILK RFDNYPKGPNWQSVFH+LLG GIF
Sbjct  61   GGTYQTCLVAIPLVARKQSLVTVTCDPKNLEHILKARFDNYPKGPNWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009375001.1| PREDICTED: cytochrome P450 86A8 [Pyrus x bretschneideri]
Length=535

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ ++AL++ S +  YL WF  IS S+ GP VWP++GSLPGLI+N  RMH+WIADNLRAC
Sbjct  1    MEASMALMILSAIAAYLFWFKMISRSMYGPRVWPVVGSLPGLIQNVNRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC CA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCTCAIPFLARKQGLVTVTCDPKNLEHILKLRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KJB41354.1| hypothetical protein B456_007G100300 [Gossypium raimondii]
Length=528

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLL + +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN +RMH+WI+DNLRAC
Sbjct  1    MDISTALLLLAAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDP+NLEHILK+RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPRNLEHILKSRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_007051775.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 ref|XP_007051776.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 gb|EOX95932.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
 gb|EOX95933.1| Cytochrome P450, family 86, subfamily A, polypeptide 8 isoform 
1 [Theobroma cacao]
Length=535

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLL + +T YLLWFTFIS SL+GP VWPLLGSLPGLIEN +RMH+WI+DNLRAC
Sbjct  1    MDISTALLLLAAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLARKQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCICAIPFLARKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010676469.1| PREDICTED: cytochrome P450 86A2-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD  V L+L S +T YL+WF      L+GP VWPL+GSLPGLI+N  RMHEWIA+NLR+C
Sbjct  1    MDTFVVLILVSVITAYLIWFKSFIRPLRGPRVWPLVGSLPGLIDNGNRMHEWIAENLRSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002275806.1| PREDICTED: cytochrome P450 86A7 [Vitis vinifera]
Length=545

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +  LLL + +T YL+WF  I+ SLKGP VWP++GSLP LI+NA RMHEWIA+NLR+C
Sbjct  1    MDASTVLLLLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCIC +PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CAN80040.1| hypothetical protein VITISV_037194 [Vitis vinifera]
Length=580

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +  LLL + +T YL+WF  I+ SLKGP VWP++GSLP LI+NA RMHEWIA+NLR+C
Sbjct  1    MDASTVLLLLAIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCIC +PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCICPIPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006418437.1| hypothetical protein EUTSA_v10007350mg [Eutrema salsugineum]
 gb|ESQ36790.1| hypothetical protein EUTSA_v10007350mg [Eutrema salsugineum]
Length=528

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +L  + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNVMLFAAVVAAYWLWFKRISRFLKGPRVWPVLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDPKNLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDY15167.1| BnaC05g00460D [Brassica napus]
Length=555

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEMSNVMLLVAVVAAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDP+NLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPRNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009119710.1| PREDICTED: cytochrome P450 86A4 [Brassica rapa]
Length=555

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEMSNVMLLVALVVAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDP+NLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPRNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|EYU23445.1| hypothetical protein MIMGU_mgv1a026937mg [Erythranthe guttata]
Length=523

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A+++ + V  Y LWF  I+ SL GP +WP+LGSLPGLIEN  RMH+WIADNLRAC
Sbjct  1    MDISTAMIISAFVAAYFLWFRSITRSLNGPRLWPVLGSLPGLIENNGRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVPFLARKQG VTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQGIF
Sbjct  61   GGTYQTCILAVPFLARKQGHVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010053250.1| PREDICTED: cytochrome P450 86A7 [Eucalyptus grandis]
 gb|KCW77511.1| hypothetical protein EUGRSUZ_D01839 [Eucalyptus grandis]
Length=553

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +V L+  S V  YLLWF FIS SL GP VWPL+GSLP LI NA RMH+WIADNLRA 
Sbjct  1    MDPSVGLIFLSAVVAYLLWFKFISASLSGPRVWPLVGSLPTLIRNAARMHDWIADNLRAA  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLARKQGLVTVTCDPKNLEH+LK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   GGTYQTCIIPLPFLARKQGLVTVTCDPKNLEHVLKARFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008373994.1| PREDICTED: cytochrome P450 86A8-like [Malus domestica]
Length=535

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ ++AL++ S +  YL+WF  IS S+ GP VWP++GSLPGLI+N  RMH+WIADNLRAC
Sbjct  1    MEASMALMILSAIAAYLIWFKMISRSMYGPRVWPVVGSLPGLIQNVNRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTC CA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG GIF
Sbjct  61   CGTYQTCTCAIPFLARKQGLVTVTCDPKNLEHILKLRFDNYPKGPTWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002892051.1| CYP86A4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68310.1| CYP86A4 [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ A+LL + VT Y LWF  IS  LKGP VWPLLGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNAMLLVAVVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVPFLA+KQGLVTVTCDPKNLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|NP_171666.1| cytochrome P450, family 86, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9LMM1.1|C86A4_ARATH RecName: Full=Cytochrome P450 86A4 [Arabidopsis thaliana]
 gb|AAF81318.1|AC061957_14 Contains a strong similarity to a cytochrome P450 86A2 from Arabidopsis 
thaliana gi|5915846 and contains a cytochrome P450 
PF|00067 domain [Arabidopsis thaliana]
 gb|AEE27310.1| cytochrome P450, family 86, subfamily A, polypeptide 4 [Arabidopsis 
thaliana]
Length=554

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ A+LL + VT Y LWF  IS  LKGP VWPLLGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNAMLLVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVPFLA+KQGLVTVTCDPKNLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDX90044.1| BnaA10g00380D [Brassica napus]
Length=538

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMHEWI +NLR C
Sbjct  1    MEMSNVMLLVALVVAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHEWITENLRVC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLARKQGLVTVTCDP+NLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLARKQGLVTVTCDPRNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>dbj|BAC42067.1| unknown protein [Arabidopsis thaliana]
Length=554

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ A+LL + VT Y LWF  IS  LKGP VWPLLGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNAMLLVAIVTGYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVPFLA+KQGLVTVTCDPKNLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006287404.1| hypothetical protein CARUB_v10000610mg [Capsella rubella]
 gb|EOA20302.1| hypothetical protein CARUB_v10000610mg [Capsella rubella]
Length=556

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A+LL +  T Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSYAMLLVAVATAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009118821.1| PREDICTED: cytochrome P450 86A4 [Brassica rapa]
Length=536

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNVMLLVAIVAAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAMPFLAKKQGLVTVTCDPRNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KJB24757.1| hypothetical protein B456_004G159000 [Gossypium raimondii]
Length=527

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ ALLL + +T YLLWFTFIS SL+GP VWPLLGSLPGLI+N +R+H+WI+DNLRAC
Sbjct  1    MDISTALLLLAAITAYLLWFTFISRSLRGPRVWPLLGSLPGLIKNCDRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDP+NLEHILK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAIPFLAQKQGLVTVTCDPRNLEHILKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006396237.1| hypothetical protein EUTSA_v10028550mg [Eutrema salsugineum]
 gb|ESQ37690.1| hypothetical protein EUTSA_v10028550mg [Eutrema salsugineum]
Length=558

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A+LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNAMLLVAIVAAYWLWFKRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_007160078.1| hypothetical protein PHAVU_002G290700g [Phaseolus vulgaris]
 gb|ESW32072.1| hypothetical protein PHAVU_002G290700g [Phaseolus vulgaris]
Length=529

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ + AL+  S +  YL+WFTF++ SLKGP VWPLLGSLPGLI++A RMH+WIADNLRA 
Sbjct  1    MEASTALMFLSAIAAYLIWFTFVTRSLKGPRVWPLLGSLPGLIQHANRMHDWIADNLRAS  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+PFLA KQ L+TVTCDPKNLEHILK RFDNYPKGP WQS FH+LLGQGIF
Sbjct  61   GGTYQTCIAALPFLACKQCLITVTCDPKNLEHILKLRFDNYPKGPTWQSAFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KDO76250.1| hypothetical protein CISIN_1g037522mg [Citrus sinensis]
Length=541

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S    YLLWF F+S SL GP VWPLLGSLPGL +N++R+H+WI+DNLRAC
Sbjct  1    MDTSTALMILSATVAYLLWFRFMSGSLSGPRVWPLLGSLPGLFQNSKRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+P L RKQGLVTVTCDPKN+EHILK RFDNYPKGP WQ+ FH+LLG GIF
Sbjct  61   GGTYQTCIFAIPVLGRKQGLVTVTCDPKNVEHILKARFDNYPKGPTWQAAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006439526.1| hypothetical protein CICLE_v10019616mg [Citrus clementina]
 gb|ESR52766.1| hypothetical protein CICLE_v10019616mg [Citrus clementina]
Length=541

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S    YLLWF F+S SL GP VWPLLGSLPGL +N++R+H+WI+DNLRAC
Sbjct  1    MDTSTALMILSATVAYLLWFRFMSGSLSGPRVWPLLGSLPGLFQNSKRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI A+P L RKQGLVTVTCDPKN+EHILK RFDNYPKGP WQ+ FH+LLG GIF
Sbjct  61   GGTYQTCIFAIPVLGRKQGLVTVTCDPKNVEHILKARFDNYPKGPTWQAAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDY38015.1| BnaCnng08760D [Brassica napus]
Length=537

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL + V  Y LW+  IS  LKGP VWP+ GSLPGLIE  +RMHEWI +NLRAC
Sbjct  1    MEISNVMLLVAIVAAYWLWYKRISRWLKGPRVWPVFGSLPGLIEQRDRMHEWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDP+NLEH+LK RFDNYPKGP WQSVFH+LLGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPRNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002304502.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE79481.2| cytochrome P450 family protein [Populus trichocarpa]
Length=550

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A ++ + V  YL+W  FIS S+KGP VWPL GSLPGLI ++ RMH+WIADNLR C
Sbjct  10   MDISTASMILTAVVTYLIWLGFISRSMKGPRVWPLFGSLPGLIWHSSRMHDWIADNLRKC  69

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC+ A+P LAR+Q LVTVTCDPKNLEHILK RFDNYPKGPNWQSVFH+LLG GIF
Sbjct  70   GGTYQTCVVAIPLLARRQSLVTVTCDPKNLEHILKARFDNYPKGPNWQSVFHDLLGDGIF  129

Query  535  NS  540
            NS
Sbjct  130  NS  131



>ref|XP_010426970.1| PREDICTED: cytochrome P450 86A2 [Camelina sativa]
Length=556

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++ A+LL +  T Y LWF  IS  L GP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNAMLLVAVATAYWLWFKRISRWLNGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|AJD25208.1| cytochrome P450 CYP86A92 [Salvia miltiorrhiza]
Length=525

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MD++ A+++ + V+ YLLWF   + SLKGP    +WP+LGSLPGLI+N  RMHEWIADNL
Sbjct  1    MDMSTAVMILALVSAYLLWFRSTTRSLKGPKGPRLWPVLGSLPGLIQNNGRMHEWIADNL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            RACGGTYQTCI A+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG 
Sbjct  61   RACGGTYQTCIFAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGD  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>ref|NP_191946.1| cytochrome P450 86A2 [Arabidopsis thaliana]
 sp|O23066.1|C86A2_ARATH RecName: Full=Cytochrome P450 86A2; AltName: Full=Protein ABERRANT 
INDUCTION OF TYPE THREE 1 [Arabidopsis thaliana]
 gb|AAF02801.1|AF195115_21 belongs to the cytochrome p450 family [Arabidopsis thaliana]
 gb|AAB62843.1| belongs to the cytochrome p450 family [Arabidopsis thaliana]
 emb|CAB80794.1| probable cytochrome P450 [Arabidopsis thaliana]
 gb|AEE81869.1| cytochrome P450 86A2 [Arabidopsis thaliana]
Length=553

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|AAL75903.1| AT4g00360/A_IG005I10_21 [Arabidopsis thaliana]
 gb|AAM91369.1| At4g00360/A_IG005I10_21 [Arabidopsis thaliana]
Length=553

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVAVVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002875027.1| CYP86A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51286.1| CYP86A2 [Arabidopsis lyrata subsp. lyrata]
Length=554

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVALVAAYWLWFQRISRWLKGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|KDP25417.1| hypothetical protein JCGZ_20573 [Jatropha curcas]
Length=553

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            +++ L++ S    YLLW+   S SL GP VWPLLGSLPGLI+N+ RMH+WIADNLR+ GG
Sbjct  4    MSMVLMVVSAFVAYLLWWKIYSRSLNGPSVWPLLGSLPGLIKNSNRMHDWIADNLRSSGG  63

Query  361  TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            TYQTCICA+PFLARKQGLVTVTCDPKN+EHILK RFDNYPKGP WQS FH+LLG+GIFNS
Sbjct  64   TYQTCICAIPFLARKQGLVTVTCDPKNVEHILKARFDNYPKGPTWQSAFHDLLGEGIFNS  123



>emb|CDP12038.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD +  +++ S    Y +WF FI+ S +GP +WP+LGSLPGLI+N++RMH+WIADNLR+C
Sbjct  1    MDPSTVMMVLSLAAAYFVWFRFIARSWRGPRLWPILGSLPGLIQNSQRMHDWIADNLRSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVPFLARKQGLVTVTCDP+NLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   GGTYQTCIFAVPFLARKQGLVTVTCDPRNLEHILKVRFDNYPKGPTWQAVFHDLLGEGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006343967.1| PREDICTED: cytochrome P450 86A2-like [Solanum tuberosum]
Length=554

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MDL+  +++ + V  YLLWF  I+ S+KGP    +WP++GSLPGL+EN  RMHEWIA+NL
Sbjct  1    MDLSTGMMIVAIVAAYLLWFKSITKSMKGPKGPKIWPIVGSLPGLLENGNRMHEWIAENL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            R C GTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+
Sbjct  61   RVCTGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGE  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>gb|AIU99467.1| P450 [Citrus maxima]
Length=541

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S    YLLWF F+S SL GP VWPLLGSLPGL +N++R+H+WI+DNLRAC
Sbjct  1    MDTSTALMILSATVAYLLWFRFMSGSLSGPRVWPLLGSLPGLFQNSKRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC  A+P L RKQGLVTVTCDPKN+EHILK RFDNYPKGP WQ+ FH+LLG GIF
Sbjct  61   GGTYQTCTFAIPVLGRKQGLVTVTCDPKNVEHILKARFDNYPKGPTWQAAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006476545.1| PREDICTED: cytochrome P450 86A8-like [Citrus sinensis]
Length=541

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + AL++ S    YLLWF F+S SL GP VWPLLGSLPGL +N++R+H+WI+DNLRAC
Sbjct  1    MDTSTALMILSATVAYLLWFRFMSGSLSGPRVWPLLGSLPGLFQNSKRLHDWISDNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC  A+P L RKQGLVTVTCDPKN+EHILK RFDNYPKGP WQ+ FH+LLG GIF
Sbjct  61   GGTYQTCTFAIPVLGRKQGLVTVTCDPKNVEHILKARFDNYPKGPTWQAAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_011072860.1| PREDICTED: cytochrome P450 86A7 [Sesamum indicum]
Length=545

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MD++  +++ + V  Y +WF  I+ SLKGP    +WP+LGSLPGLIEN  RMHEWIA+NL
Sbjct  1    MDVSTVVMILAFVAAYFVWFRSITRSLKGPKGPRLWPVLGSLPGLIENNSRMHEWIAENL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            RACGGTYQTCI AVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLGQ
Sbjct  61   RACGGTYQTCIFAVPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGQ  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>ref|XP_010419577.1| PREDICTED: cytochrome P450 86A2-like isoform X1 [Camelina sativa]
 ref|XP_010419579.1| PREDICTED: cytochrome P450 86A2-like isoform X2 [Camelina sativa]
Length=556

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL +  T Y LWF  IS  L GP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNGMLLVAVATAYWLWFKRISRWLNGPRVWPVLGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004245593.1| PREDICTED: cytochrome P450 86A7 [Solanum lycopersicum]
Length=554

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MD++  +++ + V  YLLWF  I+ S+KGP    +WP++GSLPGL+EN  RMHEWIA+NL
Sbjct  1    MDISTGMMIVAIVVAYLLWFKSITKSMKGPKGPKIWPIVGSLPGLLENGNRMHEWIAENL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            R C GTYQTCICA+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+
Sbjct  61   RVCTGTYQTCICAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGE  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>ref|XP_010522971.1| PREDICTED: cytochrome P450 86A2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010522972.1| PREDICTED: cytochrome P450 86A2-like isoform X2 [Tarenaya hassleriana]
Length=536

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            YLLWF  IS SLKGP VWPLLGSLPGL +N ERMH+WI +NLRACGGTYQTCICA+PFLA
Sbjct  16   YLLWFKRISRSLKGPRVWPLLGSLPGLTQNRERMHDWITENLRACGGTYQTCICALPFLA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            RKQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+LLG GIFNS
Sbjct  76   RKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDLLGHGIFNS  122



>emb|CDY66201.1| BnaA09g51710D [Brassica napus]
Length=559

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL + V  Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVAIVAAYWLWFKRISRWLKGPRVWPILGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVT DPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTADPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002509820.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51207.1| cytochrome P450, putative [Ricinus communis]
Length=545

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+++A ++   +  Y LW+ FIS  L GP +WPL+GSLPGLIENA RMH+WIA NL++ 
Sbjct  4    MDVSMAPMILLAIVAYFLWWKFISRPLTGPRLWPLVGSLPGLIENANRMHDWIAHNLQSS  63

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG+GIF
Sbjct  64   GGTYQTCICAIPFLAQKQGLVTVTCDPKNLEHILKARFDNYPKGPTWQSVFHDLLGEGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_009128484.1| PREDICTED: cytochrome P450 86A2 [Brassica rapa]
Length=555

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +L+ +    Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLIVAIAAAYWLWFKRISRWLKGPRVWPILGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPAWQAVFHDFLGQGIF  120

Query  535  NS  540
            N+
Sbjct  121  NA  122



>ref|XP_007209896.1| hypothetical protein PRUPE_ppa004078mg [Prunus persica]
 gb|EMJ11095.1| hypothetical protein PRUPE_ppa004078mg [Prunus persica]
Length=531

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S    Y LWF  +  S+ GP VWPL+GSLPGLI+NA RMH+WIADNL +C
Sbjct  1    MEVSTALMILSAFAAYFLWFKILLRSMNGPRVWPLVGSLPGLIQNANRMHDWIADNLHSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC  A+PFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG GIF
Sbjct  61   GGTYQTCTSAIPFLARKQRLVTVTCDPKNLEHILKLRFDNYPKGPTWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009111490.1| PREDICTED: cytochrome P450 86A2 [Brassica rapa]
Length=559

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL +    Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVAIAAAYWLWFKRISRWLKGPRVWPILGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVT DPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTADPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009797448.1| PREDICTED: cytochrome P450 86A7-like [Nicotiana sylvestris]
Length=549

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MD +  +++ S V  YLLWF  I+ S+KGP    +WP++GSLPGL+EN  RMHEWIA+NL
Sbjct  1    MDASTGMMIVSIVAAYLLWFKSITKSMKGPKGPKMWPIVGSLPGLLENGTRMHEWIAENL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            RAC GTYQTCI A+PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+
Sbjct  61   RACAGTYQTCIFAIPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGE  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>ref|XP_008238919.1| PREDICTED: cytochrome P450 86A8 [Prunus mume]
Length=531

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S    YLLWF  +  S+ GP VWPL+GSLPGLI+NA RMH+WIADNL +C
Sbjct  1    MEVSTALMILSAFAAYLLWFKILLRSMNGPRVWPLVGSLPGLIQNANRMHDWIADNLHSC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC  A+PFLA KQ LVTVTCDPKNLEHILK RFDNYPKGP WQSVFH+LLG GIF
Sbjct  61   GGTYQTCTSAIPFLASKQRLVTVTCDPKNLEHILKLRFDNYPKGPTWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|EPS61958.1| hypothetical protein M569_12832, partial [Genlisea aurea]
Length=519

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A ++ + V  Y +WF  ++ SLKGP VWP++GSLPGLI+N  R+H+WIADNLR C
Sbjct  1    MDASTATIVLAFVAAYFMWFRLMTRSLKGPRVWPVVGSLPGLIQNNARLHDWIADNLRTC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCI A+P+LARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIF
Sbjct  61   AGTYQTCIFALPYLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGKGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006391721.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
 gb|ESQ29007.1| hypothetical protein EUTSA_v10023410mg [Eutrema salsugineum]
Length=525

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A+++ +GV  YL+WF  +  SLKGP VWPLLGSLP LI NA RMH++IA+NLR C
Sbjct  1    MDGSTAVIILTGVVVYLIWFVSLRRSLKGPRVWPLLGSLPALIANAHRMHDFIAENLRTC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+WQS FH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004298810.1| PREDICTED: cytochrome P450 86A7 [Fragaria vesca subsp. vesca]
Length=543

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+   AL + + +  YL+WF  ++ S++GP VWPL GSLPG+IEN+ RMH+WIADNLRAC
Sbjct  1    MEAFTALTVLTVLAAYLIWFKILTRSMRGPRVWPLFGSLPGVIENSCRMHDWIADNLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQT ICA+PFLA+KQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+ FH+LLG GIF
Sbjct  61   GGTYQTSICAIPFLAQKQGLVTVTCDPKNLEHILKLRFDNYPKGPTWQAAFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009610115.1| PREDICTED: cytochrome P450 86A7-like [Nicotiana tomentosiformis]
Length=552

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPX---VWPLLGSLPGLIENAERMHEWIADNL  345
            MD++  +++ + V  YLLWF  I+ S+KGP    +WP++GSLPGL+EN  RMHEWIA+NL
Sbjct  1    MDVSTGMMIIAIVAAYLLWFKSITKSMKGPKGPKMWPIVGSLPGLLENGTRMHEWIAENL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            RAC GTYQTCI A+PFLARKQGLVTVTCDPKNLEHILK +FDNYPKGP WQ+VFH+LLG+
Sbjct  61   RACTGTYQTCIFAIPFLARKQGLVTVTCDPKNLEHILKVKFDNYPKGPTWQAVFHDLLGE  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>gb|AAZ39642.1| cytochrome P450 fatty acid omega-hydroxylase [Petunia x hybrida]
Length=553

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGP---XVWPLLGSLPGLIENAERMHEWIADNL  345
            M+++  +++ + V  YLLWF  I+ S+KGP    +WP++GSLPGLIEN  RMHEWIADNL
Sbjct  1    MEVSTTMMIVAIVAAYLLWFKSITKSMKGPKGPTMWPVVGSLPGLIENGNRMHEWIADNL  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
            RAC GTYQTCICA+PFLARKQ LVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+
Sbjct  61   RACSGTYQTCICAIPFLARKQ-LVTVTCDPKNLEHILKVRFDNYPKGPTWQAVFHDLLGE  119

Query  526  GIFNS  540
            GIFNS
Sbjct  120  GIFNS  124



>emb|CBI34653.3| unnamed protein product [Vitis vinifera]
Length=1462

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            S +T YL+WF  I+ SLKGP VWP++GSLP LI+NA RMHEWIA+NLR+CGGTYQTCIC 
Sbjct  138  SIITAYLIWFRSITRSLKGPRVWPVVGSLPLLIQNANRMHEWIAENLRSCGGTYQTCICP  197

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ+VFH+LLG+GIFNS
Sbjct  198  IPFLARKQGLVTVTCDPKNLEHILKIRFDNYPKGPTWQAVFHDLLGEGIFNS  249



>gb|KFK30625.1| hypothetical protein AALP_AA6G006200 [Arabis alpina]
Length=557

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  +LL +    Y LWF  IS  LKGP VWP+LGSLPGLIEN +RMH+WI +NLRA 
Sbjct  1    MNVSNTMLLVAIAAAYWLWFKRISRWLKGPRVWPVLGSLPGLIENRDRMHDWITENLRAY  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICAVPFLA+KQGLVTVTCDPKN+EH+LK RFDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   SGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHMLKTRFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            N+
Sbjct  121  NT  122



>ref|XP_010918585.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis]
Length=548

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ +  L++ + +  Y +WF+ ++  L+GP VWPLLGS+PGLI+NAERMH+WIA+NLRA 
Sbjct  1    METSTVLVVLACIVAYAMWFSRLATGLRGPRVWPLLGSVPGLIQNAERMHDWIAENLRAT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC CA+P LAR+QGLVTVTCDP+NLEH+LK RFDNYPKGP W +VFH+LLG GIF
Sbjct  61   GGTYQTCTCAIPGLARRQGLVTVTCDPRNLEHVLKTRFDNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>emb|CDY07223.1| BnaCnng02380D [Brassica napus]
Length=559

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD++  +LL +    Y LWF  IS  LKGP VWP+LGSLPGLIE  +RMH+WI +NLRAC
Sbjct  1    MDVSNTMLLVAIAAAYWLWFKRISRWLKGPRVWPILGSLPGLIEQRDRMHDWITENLRAC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVPFLA+KQGLVTVT DPKN+EH+LK  FDNYPKGP WQ+VFH+ LGQGIF
Sbjct  61   GGTYQTCICAVPFLAKKQGLVTVTADPKNIEHMLKTCFDNYPKGPTWQAVFHDFLGQGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010430476.1| PREDICTED: cytochrome P450 86A7 [Camelina sativa]
Length=533

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD ++A+++ + +  YL+WF  I  S KGP VWPLLGSLP LI NA RMH++IADNLR C
Sbjct  1    MDGSMAVIILTVIVTYLIWFVSIRRSCKGPRVWPLLGSLPALITNAHRMHDFIADNLRKC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTC+PKNLEHILK RFDNYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCEPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010473620.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD ++A+++ + +  YL+WF  I  S KGP VWPLLGSLP LI NA RMH++IADNLR C
Sbjct  1    MDGSMAVIILTVIVTYLIWFVSIRRSCKGPRVWPLLGSLPALITNAHRMHDFIADNLRKC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+W SVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010907215.1| PREDICTED: cytochrome P450 86A8-like [Elaeis guineensis]
Length=540

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ +  L++ + +  Y++WF+ ++  L+GP VWPLLGSLPGLI+N ERMH+WIA+NLRA 
Sbjct  1    MESSTVLVVLACIAAYVIWFSRLAAGLRGPRVWPLLGSLPGLIQNGERMHDWIAENLRAT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC CAVP LAR+QGLVTVTCDP+NLE++LK RFDNYPKGP W +VFH+LLG GIF
Sbjct  61   GGTYQTCTCAVPGLARRQGLVTVTCDPRNLEYVLKTRFDNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009400252.1| PREDICTED: cytochrome P450 86A2-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++A  L++ + +  Y++WFT ++  L+GP VWP++GSLPGLI+++ERMHEWI+DNLR  
Sbjct  1    MEVATVLVVVACMVAYVVWFTRLASGLRGPRVWPVVGSLPGLIQHSERMHEWISDNLRGT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+P LAR+QGLVTVTCDP+NLEH+LKNRFDNYPKGP W +VF +LLG GIF
Sbjct  61   GGTYQTCICALPRLARRQGLVTVTCDPRNLEHVLKNRFDNYPKGPTWHAVFLDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_002886391.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=549

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A+++ + +  YL+WF  +  S KGP VWPL+GSLP LI NA RMH++IADNLR C
Sbjct  1    MDGSTAVIILTLIVTYLIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK+RFDNYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKSRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|NP_176558.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
 sp|Q9CAD6.1|C86A7_ARATH RecName: Full=Cytochrome P450 86A7 [Arabidopsis thaliana]
 gb|AAG52424.1|AC011622_12 putative cytochrome P450; 34849-36420 [Arabidopsis thaliana]
 gb|AEE34136.1| cytochrome P450, family 86, subfamily A, polypeptide 7 [Arabidopsis 
thaliana]
Length=523

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A ++ + +  Y++WF  +  S KGP VWPL+GSLP LI NA RMH++IADNLR C
Sbjct  1    MDGSTAAIILTLIVTYIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|AAM65207.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=523

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD + A ++ + +  Y++WF  +  S KGP VWPL+GSLP LI NA RMH++IADNLR C
Sbjct  1    MDGSTAAIILTLIVTYIIWFVSLRRSYKGPRVWPLVGSLPALITNAHRMHDFIADNLRMC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010556547.1| PREDICTED: cytochrome P450 86A2-like [Tarenaya hassleriana]
Length=530

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQ  408
            WF  IS +LKGP VWPLLGSL GLI+N ERMH+WI +NLRACGGTYQTCICA+PFLARKQ
Sbjct  20   WFMSISRNLKGPRVWPLLGSLSGLIQNRERMHDWITENLRACGGTYQTCICALPFLARKQ  79

Query  409  GLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            GLVTVTCDPKN+EHILK RF NYPKGP WQ+VFH+LLG GIFNS
Sbjct  80   GLVTVTCDPKNIEHILKTRFHNYPKGPTWQAVFHDLLGHGIFNS  123



>ref|XP_008804035.1| PREDICTED: cytochrome P450 86A8-like [Phoenix dactylifera]
Length=548

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ +  L++ + +  Y +WF+ ++  L+GP VWPLLGS+PGLI+N ERMH+WIA+NLRA 
Sbjct  1    METSTVLVVLACIAAYAMWFSRLASGLRGPRVWPLLGSVPGLIQNGERMHDWIAENLRAA  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVP LAR+QGLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIF
Sbjct  61   GGTYQTCICAVPGLARRQGLVTVTCDPRNLEHVLKTRFDNYPKGPTWHAVFCDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_004143898.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 ref|XP_004159940.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus]
 gb|KGN50086.1| hypothetical protein Csa_5G153010 [Cucumis sativus]
Length=524

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD  VA+ + + V  YL+WF  I  SL GP VWPLLGSLPGLI+N+ RMH+WI +NL++ 
Sbjct  1    MDATVAVAVAALVATYLIWFLNIKRSLNGPRVWPLLGSLPGLIKNSHRMHDWIVENLQST  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+PFL +KQGLVTVTCDPKNLEHILK RF+NYPKGPNWQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPFLTKKQGLVTVTCDPKNLEHILKTRFENYPKGPNWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006300436.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
 gb|EOA33334.1| hypothetical protein CARUB_v10020100mg [Capsella rubella]
Length=546

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD ++A+++ + +  YL+WF  +  S KGP VWPLLGSLP LI NA RMH++IADNLR  
Sbjct  1    MDGSMAVIILTVIVTYLIWFVSLRRSYKGPRVWPLLGSLPALITNAHRMHDFIADNLRMS  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            N+
Sbjct  121  NT  122



>ref|XP_008437294.1| PREDICTED: cytochrome P450 86A7 [Cucumis melo]
Length=524

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD  V   + + V  YL+WF  I  SL GP VWPLLGSLPGLI+N+ RMH+WI +NLR+ 
Sbjct  1    MDATVVFAVAALVATYLIWFLNIKRSLSGPRVWPLLGSLPGLIKNSHRMHDWIVENLRST  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+P L +KQGLVTVTCDPKNLEHILK RF+NYPKGPNWQ+VFH+LLG GIF
Sbjct  61   GGTYQTCICAIPLLTKKQGLVTVTCDPKNLEHILKTRFENYPKGPNWQAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_008804444.1| PREDICTED: cytochrome P450 86A8-like [Phoenix dactylifera]
Length=552

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ +  L++ + +  Y+LWF+ ++  L+GP VWPLLGSLPGLI+N ERMH+WIA+NLRA 
Sbjct  1    MESSTVLVVLACIAAYVLWFSRLAVGLRGPRVWPLLGSLPGLIQNGERMHDWIAENLRAT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
             GTYQTCICA+P LAR+QGLVTVTCDP+NLEH+LK +F NYPKGP W +VFH+LLG GIF
Sbjct  61   DGTYQTCICAIPGLARRQGLVTVTCDPRNLEHVLKTKFHNYPKGPTWHAVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010418406.1| PREDICTED: cytochrome P450 86A7-like [Camelina sativa]
Length=533

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ ++A+++ + +  YL+WF  +  S KGP VWPL GSLP LI NA RMH++IADNLR C
Sbjct  1    MEGSMAVIILTVIVTYLIWFVSLRRSCKGPRVWPLFGSLPALITNAHRMHDFIADNLRKC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI  +PFLA+KQG VTVTCDPKNLEHILK RFDNYPKGP+W SVFH+LLG GIF
Sbjct  61   GGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNYPKGPSWHSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_010533650.1| PREDICTED: cytochrome P450 86A7 [Tarenaya hassleriana]
Length=523

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+ + A ++   V  Y+LWF  IS SL+GP VWPLLGSLP LI+NA RMH++IADNLR C
Sbjct  1    MEGSTAAIILGVVAAYMLWFVLISRSLRGPRVWPLLGSLPALIKNAHRMHDFIADNLRTC  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTC  A+PFLA  Q  VTVTC PKNLEHILK RF+NYPKGP+WQSVFH+LLG GIF
Sbjct  61   GGTYQTCTLAIPFLATSQSHVTVTCSPKNLEHILKTRFENYPKGPSWQSVFHDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009397933.1| PREDICTED: cytochrome P450 86A2-like [Musa acuminata subsp. malaccensis]
Length=531

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            MD+A   ++ + +  Y++WF+ ++  L GP VWP+LGSLPGLI+++ERMHEWI+DNLR  
Sbjct  1    MDVATVAVVIACMAAYVVWFSRLAAGLCGPRVWPVLGSLPGLIQHSERMHEWISDNLRGT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICA+P LAR+QG+VTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIF
Sbjct  61   GGTYQTCICAIPGLARRQGMVTVTCDPRNLEHVLKTRFDNYPKGPTWHAVFLDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_009402078.1| PREDICTED: cytochrome P450 86A8-like [Musa acuminata subsp. malaccensis]
Length=532

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M++   L++ + +  Y+LWF+ ++  L GP VWP++GSLPGLI+++ERMHEWIADNLR  
Sbjct  1    MEVVTLLVVAACMAVYVLWFSRLASRLTGPRVWPVVGSLPGLIQHSERMHEWIADNLRVN  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCICAVP LAR+QGLVTVTCDP+NLEH+LK RFDNYPKGP + +VF +LLG GIF
Sbjct  61   GGTYQTCICAVPGLARRQGLVTVTCDPRNLEHVLKTRFDNYPKGPTYHAVFLDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>ref|XP_006827573.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
 gb|ERM94989.1| hypothetical protein AMTR_s00009p00227030 [Amborella trichopoda]
Length=510

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVP  390
            +  YL+WF  I  SL GP VWPLLGSLPGL +N  RMH+WIA+NL  C GTYQTCI AVP
Sbjct  1    MVAYLIWFARIRRSLTGPRVWPLLGSLPGLFQNKHRMHDWIAENLTMCKGTYQTCIAAVP  60

Query  391  FLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +LAR QGLVTVTCDP+NLEHILK RF+NYPKGP WQ+VFH+LLG GIFNS
Sbjct  61   YLARMQGLVTVTCDPRNLEHILKTRFENYPKGPTWQAVFHDLLGDGIFNS  110



>emb|CBH32594.1| cytochrome P450, expressed [Triticum aestivum]
Length=546

 Score =   177 bits (449),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  184  AVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--  357
            A+A+ + +  + Y++WF  +S  L GP +WPL+GSLP ++ N +R+H+WIADNLRA G  
Sbjct  14   AIAVTVVALASAYMVWFWALSRRLSGPPMWPLVGSLPSVVMNRKRVHDWIADNLRATGEA  73

Query  358  GTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFN  537
             TYQTCI  +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFN
Sbjct  74   ATYQTCILPLPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFN  133

Query  538  S  540
            S
Sbjct  134  S  134



>gb|EMS65497.1| Cytochrome P450 86A1 [Triticum urartu]
Length=398

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +1

Query  184  AVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--  357
            A+A+ + +  + Y++WF  +S  L GP +WPL+GSLP ++ N +R+H+WIADNLRA G  
Sbjct  12   AIAVTVVALASAYMVWFWALSRRLSGPPMWPLVGSLPSVVVNRKRVHDWIADNLRATGEA  71

Query  358  GTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFN  537
             TYQTCI  +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFN
Sbjct  72   ATYQTCILPLPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFN  131

Query  538  S  540
            S
Sbjct  132  S  132



>ref|XP_003564640.2| PREDICTED: cytochrome P450 86A1 [Brachypodium distachyon]
Length=545

 Score =   175 bits (444),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 75/109 (69%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y+LWF  +S  L GP +WPL+GSLP ++ N  R+H+WIADNLRA G   TYQTCI  +PF
Sbjct  22   YMLWFWALSRRLSGPRMWPLVGSLPSVVANRTRVHDWIADNLRATGDAATYQTCILPLPF  81

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  82   LARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  130



>ref|XP_008785405.1| PREDICTED: cytochrome P450 86A1 [Phoenix dactylifera]
Length=553

 Score =   174 bits (441),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +1

Query  172  TMDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            ++   V  L+ + V+ YL+WF  ++  L GP VWPL GSLPGLI N  R+H+WIA NLRA
Sbjct  16   SIHFLVMALVAALVSAYLMWFLVLTRRLTGPRVWPLFGSLPGLISNRSRLHDWIAGNLRA  75

Query  352  CGG--TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             G   TYQTC+  +P +AR+QGLVTVTC+P+NLEH+L+ RFDNYPKGP WQS FH+LLG+
Sbjct  76   TGAAATYQTCVLPLPGVARRQGLVTVTCNPRNLEHVLRTRFDNYPKGPIWQSNFHDLLGR  135

Query  526  GIFNS  540
            GIFNS
Sbjct  136  GIFNS  140



>ref|XP_004976485.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=542

 Score =   174 bits (440),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            YL WF  +S  L GP VWPL+GSLPGL+ +AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YLAWFWRMSRGLSGPRVWPLVGSLPGLVRHAEDMHEWIAANLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFRDLLGDGIFNS  122



>ref|XP_003544876.2| PREDICTED: cytochrome P450 86A1-like [Glycine max]
Length=540

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 93/122 (76%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L + L L + ++ Y LWF  ++ +L GP  WPL+GSLPGL  N +R+H+WIADNLR  GG
Sbjct  24   LPLLLTLVATLSAYFLWFHLLARTLTGPKPWPLVGSLPGLFRNRDRVHDWIADNLRGRGG  83

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTCI   PFLARK+G  TVTC PKNLEHILK RFDNYPKGP WQ+ FH+LLGQGIF
Sbjct  84   SATYQTCIIPFPFLARKKGFYTVTCHPKNLEHILKTRFDNYPKGPKWQTAFHDLLGQGIF  143

Query  535  NS  540
            NS
Sbjct  144  NS  145



>ref|NP_001044838.1| Os01g0854800 [Oryza sativa Japonica Group]
 dbj|BAD82458.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF06752.1| Os01g0854800 [Oryza sativa Japonica Group]
 gb|EAY76534.1| hypothetical protein OsI_04477 [Oryza sativa Indica Group]
 gb|EAZ14187.1| hypothetical protein OsJ_04113 [Oryza sativa Japonica Group]
 dbj|BAG98848.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   172 bits (436),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y++WF  +S  L GP +WPL+GSLP ++ N  R+H+WIADNLRA G   TYQTCI  +PF
Sbjct  26   YMVWFWALSRRLSGPRMWPLVGSLPSVVLNRARVHDWIADNLRATGDAATYQTCILPLPF  85

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  86   LARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQASFHDLLGQGIFNS  134



>ref|XP_007051777.1| Cytochrome P450 86A2 isoform 3, partial [Theobroma cacao]
 gb|EOX95934.1| Cytochrome P450 86A2 isoform 3, partial [Theobroma cacao]
Length=590

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = +1

Query  286  SLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNR  465
            SLPGLIEN +RMH+WI+DNLRACGGTYQTCICA+PFLARKQGLVTVTCDP+NLEHILK R
Sbjct  93   SLPGLIENCDRMHDWISDNLRACGGTYQTCICAIPFLARKQGLVTVTCDPRNLEHILKTR  152

Query  466  FDNYPKGPNWQSVFHELLGQGIFNS  540
            FDNYPKGP WQ+VFH+LLGQGIFNS
Sbjct  153  FDNYPKGPTWQAVFHDLLGQGIFNS  177



>gb|KJB19906.1| hypothetical protein B456_003G123900 [Gossypium raimondii]
Length=511

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            L + +  Y LWF  ++  L GP VWPL+GSLP L EN  R+H+W+A NLRA GG  TYQT
Sbjct  10   LAAAIFAYALWFHILARRLTGPRVWPLVGSLPSLFENRRRIHDWMASNLRATGGLATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PFLA KQGL TVTC PKN+EHILK RFDNYPKGPNWQ+ FH+LLGQGIFNS
Sbjct  70   CTIALPFLAWKQGLYTVTCHPKNIEHILKTRFDNYPKGPNWQAAFHDLLGQGIFNS  125



>ref|XP_008667081.1| PREDICTED: uncharacterized protein LOC100192011 isoform X1 [Zea 
mays]
Length=618

 Score =   172 bits (437),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQ  408
            WF  +S  L GP VWPLLGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +AR+ 
Sbjct  102  WFWRMSRGLSGPRVWPLLGSLPGLVQHAEDMHEWIAANLRRAGGTYQTCIFAVPGVARRG  161

Query  409  GLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  162  GLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  205



>ref|XP_010033023.1| PREDICTED: cytochrome P450 86A1-like [Eucalyptus grandis]
 gb|KCW52554.1| hypothetical protein EUGRSUZ_J01934 [Eucalyptus grandis]
Length=521

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            + + V+ YLLWF+F++ +L GP VWPL+GSLP L  N  R+H+W+A NLRA GG  TYQT
Sbjct  10   VVAAVSAYLLWFSFLARTLTGPKVWPLVGSLPALFANRWRIHDWMAGNLRATGGAATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PF+AR++G  TVTC PKN+EH+L+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  70   CTIALPFVARREGFYTVTCHPKNIEHVLRTRFDNYPKGPEWQAAFHDLLGQGIFNS  125



>gb|ACN34158.1| unknown [Zea mays]
 tpg|DAA36467.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=646

 Score =   172 bits (437),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQ  408
            WF  +S  L GP VWPLLGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +AR+ 
Sbjct  130  WFWRMSRGLSGPRVWPLLGSLPGLVQHAEDMHEWIAANLRRAGGTYQTCIFAVPGVARRG  189

Query  409  GLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  190  GLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  233



>ref|XP_010923101.1| PREDICTED: cytochrome P450 86A1-like [Elaeis guineensis]
Length=556

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  187  VALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--  360
            V  L+ S V+ YL WF  ++  L GP VWP+ GSLPGLI N  R+H+WIADNLRA G   
Sbjct  21   VMALVVSLVSAYLTWFWVLARRLTGPRVWPIFGSLPGLIANRSRLHDWIADNLRATGAAT  80

Query  361  TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            TYQTC+  +P +AR+QGLVTVTC+P+NLEH+L+ RFDNYPKGP WQS FH+LLGQGIFNS
Sbjct  81   TYQTCVLPLPGVARRQGLVTVTCNPRNLEHVLRTRFDNYPKGPMWQSNFHDLLGQGIFNS  140



>gb|AHD25487.1| cytochrome-P450 monooxygenase CYP86 [Zea nicaraguensis]
Length=548

 Score =   171 bits (434),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICA  384
            V+ Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  
Sbjct  26   VSMYMVWFWALTRGLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSTGEAATYQTCILP  85

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  86   MPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  137



>ref|XP_004970620.1| PREDICTED: cytochrome P450 86A1-like [Setaria italica]
Length=547

 Score =   171 bits (433),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/109 (66%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y++WF  ++  L GP VWPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  +PF
Sbjct  28   YMVWFWALTRRLSGPRVWPLVGSLPSVVLNRARVHDWIVDNLRSTGEAATYQTCILPLPF  87

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  88   LARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  136



>ref|NP_001141372.1| uncharacterized protein LOC100273463 [Zea mays]
 gb|ACF86194.1| unknown [Zea mays]
 gb|AFW84525.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=548

 Score =   171 bits (433),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICA  384
            V+ Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  
Sbjct  26   VSMYMVWFWALTRGLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSTGEAATYQTCILP  85

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  86   MPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  137



>gb|ACG34921.1| cytochrome P450 CYP86A34 [Zea mays]
Length=548

 Score =   171 bits (432),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICA  384
            V+ Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  
Sbjct  26   VSMYMVWFWALTRGLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSTGEAATYQTCILP  85

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  86   MPFLARRQGLVTVTCNPRNLEHILRVRFDNYPKGPMWQAAFHDLLGQGIFNS  137



>dbj|BAJ86471.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95804.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L+GP VWP+LGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLRGPRVWPVLGSLPGLVQHAEDMHEWIAGNLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHGVFQDLLGDGIFNS  122



>gb|EEC73748.1| hypothetical protein OsI_08390 [Oryza sativa Indica Group]
Length=501

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLSGPRVWPVVGSLPGLVQHAENMHEWIAANLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHAVFRDLLGDGIFNS  122



>gb|AFW72704.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=534

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  ++L +    Y+ WF  +S  L GP VWP+LGSLPGL+++AE MHEWI  NLR  
Sbjct  1    MEVSTWVMLVAAAAAYMAWFWRLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVP +AR+ GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIF
Sbjct  61   GGTYQTCIFAVPGVARRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|ACG33785.1| cytochrome P450 CYP86A36 [Zea mays]
Length=547

 Score =   170 bits (431),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICA  384
            ++ Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  
Sbjct  25   ISAYMVWFWALTRRLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSKGEAATYQTCILP  84

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  85   LPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  136



>ref|XP_010043449.1| PREDICTED: cytochrome P450 86A1 [Eucalyptus grandis]
 gb|KCW85461.1| hypothetical protein EUGRSUZ_B02269 [Eucalyptus grandis]
Length=515

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVTC-YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            M+ +V L   S + C YL+WF  ++  L GP VWP++GSLP L  N  R+H+WIA +LRA
Sbjct  1    METSVLLFNLSALACAYLIWFYLLARKLTGPKVWPVVGSLPSLFMNRRRLHDWIAGHLRA  60

Query  352  CGG--TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             GG  TYQTC  A+PFLARKQG  TVTC PKN+EH+L+ RFDNYPKGP WQ+ FH+LLGQ
Sbjct  61   TGGAATYQTCTIALPFLARKQGFYTVTCHPKNIEHVLRTRFDNYPKGPTWQTAFHDLLGQ  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>gb|ACG38359.1| cytochrome P450 CYP86A35 [Zea mays]
Length=534

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++  ++L +    Y+ WF  +S  L GP VWP+LGSLPGL+++AE MHEWI  NLR  
Sbjct  1    MEVSTWVMLVAAAAAYMAWFWRLSRGLXGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRT  60

Query  355  GGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
            GGTYQTCI AVP +AR+ GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIF
Sbjct  61   GGTYQTCIFAVPGVARRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIF  120

Query  535  NS  540
            NS
Sbjct  121  NS  122



>gb|AAG17470.1|AF123610_9 cytochrome P450 [Triticum aestivum]
Length=541

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L+GP VWP+LGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLRGPRVWPVLGSLPGLVQHAEDMHEWIAGNLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFRDLLGDGIFNS  122



>gb|KJB55751.1| hypothetical protein B456_009G092900 [Gossypium raimondii]
Length=511

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L +   L + +  Y +WF F++  L GP VWPL+GSLP L  N  R+H+WIA NLRA GG
Sbjct  4    LQLVFSLAAAIFAYSIWFHFLARKLTGPRVWPLVGSLPLLFMNRRRIHDWIASNLRATGG  63

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC  A+PFLARKQG  TVTC PKN+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIF
Sbjct  64   SATYQTCTIALPFLARKQGFYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>gb|ACN27732.1| unknown [Zea mays]
 tpg|DAA56780.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=547

 Score =   170 bits (431),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICA  384
            ++ Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  
Sbjct  25   ISAYMVWFWALTRRLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSKGEAATYQTCILP  84

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PFLAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  85   LPFLARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  136



>ref|NP_001047674.1| Os02g0666500 [Oryza sativa Japonica Group]
 dbj|BAD28400.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAD27777.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF09588.1| Os02g0666500 [Oryza sativa Japonica Group]
 dbj|BAG91222.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57534.1| hypothetical protein OsJ_07852 [Oryza sativa Japonica Group]
Length=532

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMTWFWRMSRGLSGPRVWPVVGSLPGLVQHAENMHEWIAANLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHAVFRDLLGDGIFNS  122



>ref|XP_002299820.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
 gb|EEE84625.2| Cytochrome P450 86A1 family protein [Populus trichocarpa]
Length=511

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            L +    YLLWF  +S  L GP VWPL+GSLP L  N  R+H+WIA NLRA GG  TYQT
Sbjct  10   LTAATLAYLLWFYLLSRKLTGPRVWPLVGSLPYLFMNRRRIHDWIAGNLRATGGAGTYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PF ARKQG  TVTC PKNLEHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFN+
Sbjct  70   CTIALPFFARKQGFYTVTCHPKNLEHILRTRFDNYPKGPDWQTAFHDLLGQGIFNT  125



>ref|XP_002456654.1| hypothetical protein SORBIDRAFT_03g040250 [Sorghum bicolor]
 gb|EES01774.1| hypothetical protein SORBIDRAFT_03g040250 [Sorghum bicolor]
Length=547

 Score =   169 bits (429),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 71/109 (65%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y++WF  ++  L GP +WPL+GSLPG++ N  R+H+WI DNLR+ G   TYQTCI  +PF
Sbjct  28   YMVWFWALTRRLSGPRMWPLVGSLPGVVLNRARVHDWIVDNLRSTGESATYQTCILPLPF  87

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LA++QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  88   LAQRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  136



>ref|NP_001053543.1| Os04g0560100 [Oryza sativa Japonica Group]
 emb|CAE01843.2| OSJNBa0084K11.4 [Oryza sativa Japonica Group]
 dbj|BAF15457.1| Os04g0560100 [Oryza sativa Japonica Group]
 emb|CAH68054.1| B0103C08-B0602B01.11 [Oryza sativa Indica Group]
 dbj|BAG97496.1| unnamed protein product [Oryza sativa Japonica Group]
Length=545

 Score =   169 bits (428),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+ +AE MHEWIA NLR   GTYQTCI AVP LA
Sbjct  16   YMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMHEWIAANLRRTRGTYQTCIFAVPGLA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNS  122



>ref|XP_010104672.1| Cytochrome P450 86A1 [Morus notabilis]
 gb|EXC01478.1| Cytochrome P450 86A1 [Morus notabilis]
Length=520

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICA  384
            ++ YL WF F++  L GP VWP++GSLP LI N  R+H+W+++NLRA GG  TYQTC  A
Sbjct  14   ISAYLFWFHFLARKLTGPKVWPVIGSLPALIVNRARIHDWMSNNLRATGGLCTYQTCTIA  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF A KQG  TVTC PKN+EHIL+ RFDNYPKGPNWQ+ FH+LLGQGIFNS
Sbjct  74   LPFFAHKQGYFTVTCHPKNIEHILRTRFDNYPKGPNWQAAFHDLLGQGIFNS  125



>ref|XP_003570074.1| PREDICTED: cytochrome P450 86A2-like [Brachypodium distachyon]
Length=537

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L+GP VWP+LGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLRGPRVWPVLGSLPGLVQHAEDMHEWIAGNLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFLDLLGDGIFNS  122



>ref|XP_010443636.1| PREDICTED: cytochrome P450 86A1 [Camelina sativa]
Length=513

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLISNRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>gb|KFK27415.1| hypothetical protein AALP_AA8G379800 [Arabis alpina]
Length=513

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  202  FSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCIC  381
            F+ +T Y +WF F+S  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT   
Sbjct  13   FAALTVYAIWFYFLSRRLTGPKVLPIVGSLPYLIANRSRVHDWIADNLRATGGTYQTSTM  72

Query  382  AVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
             +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  73   VIPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_010483494.1| PREDICTED: cytochrome P450 86A1-like [Camelina sativa]
Length=513

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_010454344.1| PREDICTED: cytochrome P450 86A1 [Camelina sativa]
Length=513

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_002862636.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38894.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_011032144.1| PREDICTED: cytochrome P450 86A1 [Populus euphratica]
Length=511

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L+  L L +  + YLLWF  ++  L GP VWP++GSLP L  N  ++H+WIA NLRA GG
Sbjct  4    LSFLLTLAAATSVYLLWFYLLARRLTGPKVWPIVGSLPSLFVNRRKIHDWIAANLRATGG  63

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC  A+PF ARKQG  TVTC PKN+EHIL+ +FDNYPKGP WQ+ FH+LLGQGIF
Sbjct  64   VGTYQTCTIALPFFARKQGFYTVTCHPKNMEHILRTKFDNYPKGPEWQTAFHDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_006647656.1| PREDICTED: cytochrome P450 86A2-like [Oryza brachyantha]
Length=532

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+++AE MH+WIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLSGPRVWPVVGSLPGLVQHAENMHDWIAANLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHAVFRDLLGDGIFNS  122



>ref|XP_006280320.1| hypothetical protein CARUB_v10026242mg [Capsella rubella]
 gb|EOA13218.1| hypothetical protein CARUB_v10026242mg [Capsella rubella]
Length=513

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|NP_200694.1| cytochrome P450 86A1 [Arabidopsis thaliana]
 sp|P48422.2|C86A1_ARATH RecName: Full=Cytochrome P450 86A1; AltName: Full=CYPLXXXVI; 
AltName: Full=P450-dependent fatty acid omega-hydroxylase; AltName: 
Full=Protein HYDROXYLASE OF ROOT SUBERIZED TISSUE [Arabidopsis 
thaliana]
 dbj|BAB09631.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AED97111.1| cytochrome P450 86A1 [Arabidopsis thaliana]
Length=513

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>gb|AAL91155.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAO29963.1| cytochrome P450 [Arabidopsis thaliana]
Length=513

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_002448320.1| hypothetical protein SORBIDRAFT_06g025170 [Sorghum bicolor]
 gb|EES12648.1| hypothetical protein SORBIDRAFT_06g025170 [Sorghum bicolor]
Length=538

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWPL GSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRMSRGLSGPRVWPLAGSLPGLVQHAEDMHEWIAANLRRAGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFRDLLGDGIFNS  122



>ref|XP_010262795.1| PREDICTED: cytochrome P450 86A1 [Nelumbo nucifera]
Length=512

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVT-CYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            M+  +A  L + +T  Y LWF  ++  L GP VWP++GSLP LI N  R+H+WIA NLR 
Sbjct  1    METLLAFFLAAAITSAYFLWFNVLARKLTGPKVWPIVGSLPYLIANRSRVHDWIAQNLRQ  60

Query  352  CGGT--YQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             GGT  YQTC  A+PF+ARKQG  TVTC PKN+E++LK RFDNYPKGP WQ  FH+LLGQ
Sbjct  61   TGGTATYQTCTLALPFVARKQGFFTVTCHPKNIEYVLKTRFDNYPKGPTWQEAFHDLLGQ  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>emb|CAA62082.1| cytochrome p450 [Arabidopsis thaliana]
Length=513

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKAQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_004955136.1| PREDICTED: cytochrome P450 86A2-like [Setaria italica]
Length=455

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP+LGSLPGL+++AE MHEWI  NLR  GGTYQTCI AVP +A
Sbjct  16   YMAWFWRLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  122



>emb|CDY02846.1| BnaC02g10430D [Brassica napus]
Length=385

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT    
Sbjct  14   AALSLYALWFYFLSRRLTGPKVLPIVGSLPFLIANRNRVHDWIADNLRATGGTYQTSTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>emb|CDY61020.1| BnaAnng17300D [Brassica napus]
Length=492

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCI  378
            + + ++ Y +WF F+S  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT  
Sbjct  12   VVAALSIYAIWFYFLSRKLTGPKVLPIVGSLPYLIANRNRVHDWIADNLRATGGTYQTST  71

Query  379  CAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
              +PF+A+KQG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  72   MVIPFVAKKQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_002452782.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
 gb|EES05758.1| hypothetical protein SORBIDRAFT_04g032410 [Sorghum bicolor]
Length=542

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            YL WF  +S  L GP VWP+LGSLPGL+++AE MHEWI  NLR  GGTYQTCI AVP +A
Sbjct  16   YLAWFWRLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  122



>gb|ABZ80831.1| CYP86A32 fatty acid omega-hydroxylase [Quercus suber]
Length=520

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L++   +   +  YL WF  ++  L GP VWP++GSLP LI N  R+H+W+A+NLRA GG
Sbjct  4    LSILFGIAGAIALYLFWFNLLAQKLTGPKVWPVVGSLPALISNRSRIHDWMANNLRATGG  63

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC    PFLARKQG  TVTC PKN+EHIL+ +FDNYPKGP+WQ+ FH+LLGQGIF
Sbjct  64   SATYQTCTIPFPFLARKQGFFTVTCHPKNIEHILRTKFDNYPKGPDWQAAFHDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_008667082.1| PREDICTED: uncharacterized protein LOC100192011 isoform X2 [Zea 
mays]
 gb|ACN28568.1| unknown [Zea mays]
 tpg|DAA36468.1| TPA: putative cytochrome P450 superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA36469.1| TPA: putative cytochrome P450 superfamily protein isoform 2 [Zea 
mays]
Length=536

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQ  408
            WF  +S  L GP VWPLLGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +AR+ 
Sbjct  20   WFWRMSRGLSGPRVWPLLGSLPGLVQHAEDMHEWIAANLRRAGGTYQTCIFAVPGVARRG  79

Query  409  GLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  80   GLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  123



>ref|XP_002525608.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF36726.1| cytochrome P450, putative [Ricinus communis]
Length=511

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            L + V+ YL WF  ++  L GP VWPL+GSLP L +N  ++H+WIA NLRA GG  TYQT
Sbjct  10   LAASVSAYLFWFYLLARKLTGPRVWPLVGSLPVLFKNRRQIHDWIAGNLRATGGASTYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PFLAR+QG  TVTC PKNLEHIL+ RF+NYPKGP+WQ  FH+LLGQGIFNS
Sbjct  70   CTIALPFLARRQGFYTVTCHPKNLEHILRTRFENYPKGPHWQKAFHDLLGQGIFNS  125



>emb|CDY32676.1| BnaA02g07380D [Brassica napus]
Length=398

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT    
Sbjct  14   AALSLYALWFYFLSRRLTGPKVLPIVGSLPFLIANRNRVHDWIADNLRATGGTYQTSTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>gb|EMT01938.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=489

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            YL WF  +S  L GP VWPL+GSLPGL+++AE MHEWI  NLR  GGTYQTCI AVP +A
Sbjct  16   YLAWFWRMSRGLSGPRVWPLVGSLPGLLQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFSDLLGDGIFNS  122



>dbj|BAJ88802.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89180.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            YL WF  +S  L GP VWPL+GSLPGL+++AE MHEWI  NLR  GGTYQTCI AVP +A
Sbjct  16   YLAWFWRMSRGLSGPRVWPLVGSLPGLLQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFRDLLGDGIFNS  122



>ref|XP_010520223.1| PREDICTED: cytochrome P450 86A1 [Tarenaya hassleriana]
Length=514

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  172  TMDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            T+ L VA ++   ++ Y LWF  +S  L GP V PL+GSLP LI N  R+H+W+ADNLR+
Sbjct  5    TVYLGVATVV---ISVYALWFYLLSRRLTGPRVLPLVGSLPFLIANRSRIHDWMADNLRS  61

Query  352  CGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGI  531
             GGTYQTC   +PF+A+KQG  TVTC PKNLEHIL+ RFDNYPKGP W++ FH+LLGQGI
Sbjct  62   SGGTYQTCTIMIPFVAKKQGFYTVTCHPKNLEHILRTRFDNYPKGPMWRTAFHDLLGQGI  121

Query  532  FNS  540
            FNS
Sbjct  122  FNS  124



>ref|XP_009132026.1| PREDICTED: cytochrome P450 86A1-like [Brassica rapa]
Length=514

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y +WF FIS  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT    
Sbjct  14   AAISIYAIWFYFISRRLTGPKVLPIVGSLPYLIANRNRVHDWIADNLRATGGTYQTSTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_009407544.1| PREDICTED: cytochrome P450 86A1 [Musa acuminata subsp. malaccensis]
Length=557

 Score =   167 bits (423),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  214  TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAV  387
            + YL WF  ++  L GP VWP  GSLPGL+ N  RMH+WI+DNLRA G   TYQTCI  +
Sbjct  35   STYLTWFWALTRRLNGPKVWPFFGSLPGLVANRARMHDWISDNLRATGEAATYQTCILPL  94

Query  388  PFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            P LAR+QGLVTVTC P+NLEH+L++RF+NYPKGP  Q+ FH+LLG+GIFNS
Sbjct  95   PLLARRQGLVTVTCHPRNLEHVLRSRFENYPKGPQMQAAFHDLLGRGIFNS  145



>gb|AFN53663.1| cytochrome P450 [Linum usitatissimum]
Length=516

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 88/120 (73%), Gaps = 5/120 (4%)
 Frame = +1

Query  196  LLFSGV---TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--G  360
             LF+ V   + YL+WF F++  L GP VWPL GSLP +  N  R H+WIADNLRA G   
Sbjct  6    FLFTAVAISSAYLVWFYFLARRLTGPKVWPLFGSLPHVFMNRARFHDWIADNLRATGRAS  65

Query  361  TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            TYQTC   +PFLAR QG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  66   TYQTCTLPLPFLARTQGFYTVTCHPKNIEHILRTRFDNYPKGPQWQAAFHDLLGQGIFNS  125



>ref|XP_008457385.1| PREDICTED: cytochrome P450 86A1 [Cucumis melo]
Length=514

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +1

Query  217  CYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAVP  390
             Y +WF F++  L GP VWPL+GSLP LI N  R+H+WIA NLRA GG  TYQTC  A+P
Sbjct  20   TYFIWFHFLARKLTGPPVWPLIGSLPALISNRRRLHDWIAGNLRATGGAATYQTCTVALP  79

Query  391  FLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            F+A++QG  TVTC P+N+EH+L+ RF+NYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  80   FIAKRQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNS  129



>gb|KJB08946.1| hypothetical protein B456_001G115100 [Gossypium raimondii]
Length=514

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  226  LWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAVPFLA  399
            +WF  ++  L GP VWPL+GSLP L  N  RMH+WIA NLRA GG  TYQTC  AVPFLA
Sbjct  22   IWFYLLAKRLSGPRVWPLVGSLPFLFMNRRRMHDWIASNLRATGGSATYQTCTIAVPFLA  81

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            RKQG  TVTC PKN+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  82   RKQGFYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNS  128



>gb|EMT14997.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=541

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L+GP VWP+LGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP  A
Sbjct  16   YMAWFWRMSRGLRGPRVWPVLGSLPGLVQHAEDMHEWIAGNLRRAGGTYQTCIFAVPGAA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ G VTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGPVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFRDLLGDGIFNS  122



>ref|XP_004490585.1| PREDICTED: cytochrome P450 86A1-like [Cicer arietinum]
Length=510

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 85/109 (78%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAVPF  393
            Y LWF  ++ +L GP  WP +GSLP L +N  R+H+WIA NLRA GG  TYQTCI  +PF
Sbjct  17   YFLWFHLLTRTLTGPKPWPFVGSLPALFKNRNRVHDWIAGNLRATGGSATYQTCIIPIPF  76

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LARKQG  TVTC PKNLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  77   LARKQGFYTVTCHPKNLEHILRTRFDNYPKGPKWQTAFHDLLGQGIFNS  125



>emb|CDX71150.1| BnaC03g12340D [Brassica napus]
Length=491

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y +WF FIS  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT    
Sbjct  14   AALSIYAIWFYFISRRLTGPKVLPIVGSLPYLIANRNRVHDWIADNLRATGGTYQTSTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|XP_006645037.1| PREDICTED: cytochrome P450 86A1-like [Oryza brachyantha]
Length=545

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y++WF  +S  L GP +WPL+GSLP ++ N  R+H+WIADNLRA G   TYQTCI  +PF
Sbjct  26   YMVWFWALSRRLSGPRMWPLVGSLPSVVLNRARVHDWIADNLRATGDAATYQTCILPLPF  85

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  86   LARRQGLVTVTCNPRNLEHILRVRFDNYPKGPMWQASFHDLLGQGIFNS  134



>ref|XP_004294257.2| PREDICTED: cytochrome P450 86A1 [Fragaria vesca subsp. vesca]
Length=553

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L +   L +  + Y  WF  ++  L GP VWP++GSLP L  N  R+H+WIA NLRA GG
Sbjct  37   LTLFFTLAAATSVYCFWFYLLARKLTGPKVWPVVGSLPVLFTNRNRIHDWIASNLRATGG  96

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC  A+PFLARKQG+ TVTC PKN+EHIL+ RFDNYPKGP+WQ+ FH+LLG+GIF
Sbjct  97   SSTYQTCTIALPFLARKQGMFTVTCHPKNIEHILRTRFDNYPKGPSWQAAFHDLLGEGIF  156

Query  535  NS  540
            NS
Sbjct  157  NS  158



>ref|XP_004164591.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
Length=513

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICA  384
            +  Y +WF F++  L GP VWPL+GSLP LI N   +H+WIA NLRA GG  TYQTC  A
Sbjct  17   ILTYFIWFHFLARKLTGPTVWPLIGSLPALISNRRSLHDWIAGNLRATGGAATYQTCTVA  76

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+KQG  TVTC P+N+EH+L+ RF+NYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  77   LPFIAKKQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNS  128



>ref|XP_004150627.1| PREDICTED: cytochrome P450 86A1-like [Cucumis sativus]
 gb|KGN65795.1| hypothetical protein Csa_1G528600 [Cucumis sativus]
Length=513

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICA  384
            +  Y +WF F++  L GP VWPL+GSLP LI N   +H+WIA NLRA GG  TYQTC  A
Sbjct  17   ILTYFIWFHFLARKLTGPTVWPLIGSLPALISNRRSLHDWIAGNLRATGGAATYQTCTVA  76

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+KQG  TVTC P+N+EH+L+ RF+NYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  77   LPFIAKKQGFYTVTCHPRNIEHVLRTRFENYPKGPDWQAAFHDLLGQGIFNS  128



>gb|EEE61483.1| hypothetical protein OsJ_15764 [Oryza sativa Japonica Group]
Length=508

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+ +AE MHEWIA NLR   GTYQTCI AVP LA
Sbjct  16   YMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMHEWIAANLRRTRGTYQTCIFAVPGLA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNS  122



>ref|XP_007208647.1| hypothetical protein PRUPE_ppa020227mg, partial [Prunus persica]
 gb|EMJ09846.1| hypothetical protein PRUPE_ppa020227mg, partial [Prunus persica]
Length=525

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L +   LF     YL WF  ++  L GP VWP +GSLP L  N   +H+WI  NLRA GG
Sbjct  7    LPILFTLFGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGG  66

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC  A+PFLARKQGL TVTC+PKN+EHIL+ RFDNYPKGP WQ+ FH+LLG+GIF
Sbjct  67   SSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIF  126

Query  535  NS  540
            NS
Sbjct  127  NS  128



>gb|EAY95147.1| hypothetical protein OsI_16965 [Oryza sativa Indica Group]
Length=526

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLA  399
            Y+ WF  +S  L GP VWP++GSLPGL+ +AE MHEWIA NLR   GTYQTCI AVP LA
Sbjct  16   YMAWFWRMSRGLSGPRVWPVVGSLPGLVRHAEDMHEWIAANLRRTRGTYQTCIFAVPGLA  75

Query  400  RKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            R+ GLVTVTCDP+NLEH+LK+RFDNYPKGP W  VF +LLG GIFNS
Sbjct  76   RRGGLVTVTCDPRNLEHVLKSRFDNYPKGPFWHGVFGDLLGDGIFNS  122



>ref|XP_006401031.1| hypothetical protein EUTSA_v10013214mg [Eutrema salsugineum]
 gb|ESQ42484.1| hypothetical protein EUTSA_v10013214mg [Eutrema salsugineum]
Length=533

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P++GS+P LI N  R+H+WIADNLRA GGTYQT    
Sbjct  34   AALSVYALWFYFLSRRLTGPKVLPIVGSMPFLIANRNRVHDWIADNLRATGGTYQTSTMV  93

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  94   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  145



>ref|XP_009126726.1| PREDICTED: cytochrome P450 86A1 [Brassica rapa]
Length=513

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P++GSLP LI N  R+H+WIADNLRA GGTYQT    
Sbjct  14   AALSLYALWFYFLSRRLTGPKVLPIVGSLPFLIANRNRVHDWIADNLRATGGTYQTSTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF+A+ QG  TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPFVAKTQGFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  125



>ref|NP_001183394.1| uncharacterized protein LOC100501810 [Zea mays]
 gb|ACR36635.1| unknown [Zea mays]
Length=518

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  223  LLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLAR  402
            + WF  +S  L GP VWP+LGSLPGL+++AE MHEWI  NLR  GGTYQTCI AVP +AR
Sbjct  1    MAWFWRLSRGLSGPRVWPVLGSLPGLVQHAEDMHEWIVGNLRRTGGTYQTCIFAVPGVAR  60

Query  403  KQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            + GLVTVTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  61   RGGLVTVTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  106



>ref|XP_008358971.1| PREDICTED: cytochrome P450 86A1-like [Malus domestica]
Length=522

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            LF+  + YL WF  ++  L GP VWP++GSLP L  N +++H+WI  NLRA GG  TYQT
Sbjct  10   LFAATSVYLFWFYLLARKLTGPSVWPVVGSLPLLYSNRKQIHDWITSNLRATGGSATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PF+ARKQGL TVT +PKN+EHIL+ RFDNYPKGP WQ+ FH+LLG+GIFNS
Sbjct  70   CTLALPFVARKQGLYTVTSNPKNIEHILRARFDNYPKGPTWQAAFHDLLGEGIFNS  125



>gb|ACL53124.1| unknown [Zea mays]
Length=521

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  +PF
Sbjct  2    YMVWFWALTRGLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSTGEAATYQTCILPMPF  61

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LAR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  62   LARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  110



>ref|NP_001130907.1| putative cytochrome P450 superfamily protein isoform 1 [Zea mays]
 gb|ACF79291.1| unknown [Zea mays]
Length=513

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +1

Query  241  ISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQGLVT  420
            +S  L GP VWPLLGSLPGL+++AE MHEWIA NLR  GGTYQTCI AVP +AR+ GLVT
Sbjct  1    MSRGLSGPRVWPLLGSLPGLVQHAEDMHEWIAANLRRAGGTYQTCIFAVPGVARRGGLVT  60

Query  421  VTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            VTCDP+NLEH+LK RFDNYPKGP W +VF +LLG GIFNS
Sbjct  61   VTCDPRNLEHVLKARFDNYPKGPFWHAVFRDLLGDGIFNS  100



>ref|XP_010650931.1| PREDICTED: cytochrome P450 86A1 [Vitis vinifera]
 emb|CBI15990.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = +1

Query  184  AVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG-  360
            ++   + +  + Y+LWF  ++  L GP +WP++GSLP L  N  R+H+WI+ NLR  GG 
Sbjct  5    SIVFFVVAAASAYVLWFYLLARKLTGPKMWPVVGSLPALFMNRRRIHDWISGNLRETGGA  64

Query  361  -TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFN  537
             TYQTC  A+PFLA KQG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFN
Sbjct  65   ATYQTCTLALPFLAYKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFN  124

Query  538  S  540
            S
Sbjct  125  S  125



>ref|XP_009374269.1| PREDICTED: cytochrome P450 86A1 [Pyrus x bretschneideri]
Length=524

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            LF+    YL WF  ++  L GP VWP++GS+P L  N +++H+WI  NLRA GG  TYQT
Sbjct  10   LFAAAFVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRKQIHDWITSNLRATGGSATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PF+ARKQGL TVTC+PKN+EHIL+ RFDNYPKGP +Q+ FH+LLG+GIFNS
Sbjct  70   CTLALPFVARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNS  125



>ref|XP_008355259.1| PREDICTED: cytochrome P450 86A1 [Malus domestica]
Length=524

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 90/116 (78%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQT  372
            LF+  + YL WF  ++  L GP VWP++GS+P L  N  ++H+WI +NLRA G   TYQT
Sbjct  10   LFAAASVYLFWFYLLARKLTGPSVWPVVGSIPFLFSNRXQIHDWITNNLRATGXSATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PFLAR+QGL TVTC+PKN+EHIL+ RFDNYPKGP +Q+ FH+LLG+GIFNS
Sbjct  70   CTLALPFLARRQGLFTVTCNPKNIEHILRTRFDNYPKGPTYQAAFHDLLGEGIFNS  125



>ref|XP_010926207.1| PREDICTED: cytochrome P450 86A1-like [Elaeis guineensis]
Length=554

 Score =   164 bits (414),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 74/122 (61%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            LA AL++ + ++ Y  WF  ++  L GP VWPL GSLPG++ N  R+H+WIADNLRA G 
Sbjct  20   LATALVV-AMLSAYFTWFWVLARRLTGPRVWPLFGSLPGVVANRSRLHDWIADNLRATGA  78

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC+  +P +AR+QGLVTVTC P+NLEH+L+ RFDNYPKGP  QS FH+LLG GIF
Sbjct  79   AATYQTCVLPLPGVARRQGLVTVTCHPRNLEHVLRTRFDNYPKGPLSQSNFHDLLGHGIF  138

Query  535  NS  540
            NS
Sbjct  139  NS  140



>ref|XP_002314117.1| Cytochrome P450 86A1 family protein [Populus trichocarpa]
 gb|ABK95030.1| unknown [Populus trichocarpa]
 gb|EEE88072.1| Cytochrome P450 86A1 family protein [Populus trichocarpa]
Length=511

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +1

Query  193  LLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TY  366
            L L +  + YLLWF  ++  L GP VWP++GSLP L  N    H+W+A NLRA GG  TY
Sbjct  8    LTLAAATSVYLLWFYLLARKLTGPKVWPIVGSLPLLFVNRRNFHDWLAANLRATGGAGTY  67

Query  367  QTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            QTC  A+PF ARKQG  TVTC PKN+EHIL+ +FDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  68   QTCTIALPFFARKQGFYTVTCHPKNMEHILRTKFDNYPKGPEWQTAFHDLLGQGIFNS  125



>ref|XP_008220520.1| PREDICTED: cytochrome P450 86A1 [Prunus mume]
Length=522

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            L +   L      YL WF  ++  L GP VWP +GSLP L  N   +H+WI  NLRA GG
Sbjct  4    LPILFTLLGATFLYLFWFYLLARKLTGPTVWPFVGSLPVLFMNRNSIHDWITSNLRATGG  63

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC  A+PFLARKQGL TVTC+PKN+EHIL+ RFDNYPKGP WQ+ FH+LLG+GIF
Sbjct  64   SSTYQTCTLALPFLARKQGLFTVTCNPKNIEHILRTRFDNYPKGPTWQAAFHDLLGEGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_011082379.1| PREDICTED: cytochrome P450 86A1 [Sesamum indicum]
Length=520

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQT  372
            L +  + YLLWF  ++ +L GP  WPL+GSLP L  N  R+H+WIA NLRA G   TYQT
Sbjct  10   LAAATSAYLLWFWLLARTLNGPKAWPLVGSLPHLFMNRRRIHDWIASNLRATGPAATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+PF A KQG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  70   CTIAIPFFACKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFNS  125



>ref|XP_007016155.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
 gb|EOY33774.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma 
cacao]
Length=511

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQT  372
            L + +  Y LWF  +   L GP VWP++GSLP L+ N  R+H+WIA NLRA GG  TYQT
Sbjct  10   LAAAIFAYALWFHLLVRRLTGPRVWPIVGSLPYLVMNRGRIHDWIASNLRATGGSATYQT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C  A+P LARKQG  TVTC PKN+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  70   CTIALPCLARKQGFYTVTCHPKNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNS  125



>ref|XP_003615606.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98564.1| cytochrome P450 family-dependent fatty acid hydroxylase [Medicago 
truncatula]
Length=510

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  220  YLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPF  393
            Y LWF  ++ +L GP  WP +GSLPGL +N  R+H+WIA+NLRA G   TYQT I   PF
Sbjct  17   YFLWFHLLARTLTGPKAWPFIGSLPGLFKNRNRVHDWIAENLRATGVSATYQTSIMPFPF  76

Query  394  LARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LA KQG  TVTC PKNLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  77   LAHKQGFYTVTCHPKNLEHILRTRFDNYPKGPKWQTAFHDLLGQGIFNS  125



>ref|XP_011035187.1| PREDICTED: cytochrome P450 86A1-like [Populus euphratica]
Length=511

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 2/106 (2%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAVPFLAR  402
            WF  +S  L GP VWPL+GSLP L  N  R+H+WIA NLRA GG  TYQTC  A+PF AR
Sbjct  20   WFYLLSRKLTGPRVWPLVGSLPYLFMNRRRIHDWIAGNLRATGGAGTYQTCTIALPFFAR  79

Query  403  KQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            KQG  TVTC PKN+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFN+
Sbjct  80   KQGFYTVTCHPKNMEHILRTRFDNYPKGPDWQTAFHDLLGQGIFNT  125



>gb|KDP46522.1| hypothetical protein JCGZ_08494 [Jatropha curcas]
Length=511

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +1

Query  175  MDLAVALLLFSGVT-CYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            M+++      + VT  YL WF  ++  L GP VWP++GSLP L +N  ++H+WIA NLR+
Sbjct  1    MEISPFFFTLATVTFAYLFWFHLLARKLTGPKVWPIVGSLPFLFKNRRQIHDWIASNLRS  60

Query  352  CGG--TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             GG  TYQTC  A+PF A +QG  TVTC PKNLEHIL+ RFDNYPKGP+WQ+ FH+LLGQ
Sbjct  61   TGGASTYQTCTIALPFFAHRQGFYTVTCHPKNLEHILRTRFDNYPKGPHWQTAFHDLLGQ  120

Query  526  GIFNS  540
            GIFNS
Sbjct  121  GIFNS  125



>ref|XP_010541445.1| PREDICTED: cytochrome P450 86A1-like [Tarenaya hassleriana]
Length=514

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVP  390
            ++ Y +WF  +S  L GP V+PL+GSLP L+ N  R+H+WIA+NL A GGTYQTC   +P
Sbjct  15   ISAYAIWFYLLSRRLTGPKVFPLVGSLPFLMANRGRIHDWIAENLHAAGGTYQTCTIMIP  74

Query  391  FLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
             +A+KQG  TVTC PKNLEHIL+ RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  75   IVAKKQGFYTVTCHPKNLEHILRTRFDNYPKGPMWRTAFHDLLGQGIFNS  124



>ref|XP_010685596.1| PREDICTED: cytochrome P450 86A1 [Beta vulgaris subsp. vulgaris]
Length=529

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLK-GPXVWPLLGSLPGLIENAERMHEWIADNLRACGGT--YQTCIC  381
            +T Y+LWF+ +S  L  GP +WP++GSLP L  N  R+H+WIA NLR  GGT  YQTC  
Sbjct  14   ITAYMLWFSHLSRRLSTGPNLWPVVGSLPYLFNNQHRIHDWIAGNLRRTGGTATYQTCTI  73

Query  382  AVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            A+PFLA KQG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  74   AIPFLAFKQGFYTVTCHPKNIEHILRTRFDNYPKGPQWQAAFHDLLGQGIFNS  126



>emb|CDO99497.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 87/121 (72%), Gaps = 5/121 (4%)
 Frame = +1

Query  193  LLLFS---GVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG-  360
            +LLF+   G + YLLWF  ++  L GP VWP  GSLP L  N  R H+WIA NLR+ G  
Sbjct  4    VLLFTIAIGTSTYLLWFYLLARKLTGPKVWPFFGSLPFLFLNRRRFHDWIAGNLRSTGAA  63

Query  361  -TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFN  537
             TYQT    +PFLAR+QG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFN
Sbjct  64   ATYQTSTICIPFLARRQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFN  123

Query  538  S  540
            S
Sbjct  124  S  124



>ref|NP_001130939.1| uncharacterized protein LOC100192044 [Zea mays]
 gb|ACF79330.1| unknown [Zea mays]
 gb|ACN28337.1| unknown [Zea mays]
Length=519

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  223  LLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG--GTYQTCICAVPFL  396
            ++WF  ++  L GP +WPL+GSLP ++ N  R+H+WI DNLR+ G   TYQTCI  +PFL
Sbjct  1    MVWFWALTRRLSGPRMWPLVGSLPSVVLNRARVHDWIVDNLRSKGEAATYQTCILPLPFL  60

Query  397  ARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            AR+QGLVTVTC+P+NLEHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  61   ARRQGLVTVTCNPRNLEHILRARFDNYPKGPMWQAAFHDLLGQGIFNS  108



>ref|XP_006652635.1| PREDICTED: cytochrome P450 86A4-like [Oryza brachyantha]
Length=540

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  232  FTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQG  411
            F  +S  L GP VWPL+GSLPGL+ +AE MHEWIA NLR   GTYQTCI AVP LAR+ G
Sbjct  20   FWRMSRGLSGPRVWPLVGSLPGLVRHAEDMHEWIAGNLRRTRGTYQTCIFAVPGLARRGG  79

Query  412  LVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            LVTVTCDP+NLEH+LK RFDNYPKGP W  VF +LLG GIFNS
Sbjct  80   LVTVTCDPRNLEHVLKARFDNYPKGPFWHGVFGDLLGDGIFNS  122



>ref|XP_006425039.1| hypothetical protein CICLE_v10030097mg [Citrus clementina]
 ref|XP_006488493.1| PREDICTED: cytochrome P450 86A1-like [Citrus sinensis]
 gb|ESR38279.1| hypothetical protein CICLE_v10030097mg [Citrus clementina]
 gb|KDO66831.1| hypothetical protein CISIN_1g010337mg [Citrus sinensis]
Length=513

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG  360
            LA+   L + ++ Y  WF  +S  L G  V+P +GSLP LI+N +R+H+WIA NLRA GG
Sbjct  4    LAIFFSLTAAISTYAFWFYLLSRKLTGLKVYPFVGSLPILIKNRKRLHDWIASNLRATGG  63

Query  361  --TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQT   A+P+LA KQG  TVTC PKN+EHIL+ RF+NYPKGP WQ  FH+LLGQGIF
Sbjct  64   SATYQTTTVALPYLATKQGFYTVTCHPKNIEHILRTRFENYPKGPTWQKAFHDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_007142224.1| hypothetical protein PHAVU_008G262600g [Phaseolus vulgaris]
 gb|ESW14218.1| hypothetical protein PHAVU_008G262600g [Phaseolus vulgaris]
Length=519

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +1

Query  181  LAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG-  357
            L++  +L   ++ YLLWF  ++ +L GP  +P LG+LP L  N  R+H+WIA NLRA G 
Sbjct  6    LSLFFILTPILSAYLLWFLLLAGTLTGPKPFPFLGTLPQLFHNRHRVHDWIAANLRAAGS  65

Query  358  -GTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTCI  +PFLAR+QG  TVTC+PKNLEH+L+ RFDNYPKGP W + FH+LLG GIF
Sbjct  66   SATYQTCIIPIPFLARRQGFYTVTCNPKNLEHVLRTRFDNYPKGPRWHAAFHDLLGNGIF  125

Query  535  NS  540
            NS
Sbjct  126  NS  127



>ref|XP_006303436.1| hypothetical protein CARUB_v10010662mg [Capsella rubella]
 gb|EOA36334.1| hypothetical protein CARUB_v10010662mg [Capsella rubella]
Length=122

 Score =   147 bits (372),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +1

Query  319  MHEWIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQ  498
            MHEWI +NLRACGGTYQTCI AVPFLA+KQGLVTVTCDPKNLEH+LK RFDNYPKGP WQ
Sbjct  1    MHEWITENLRACGGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQ  60

Query  499  SVFHELLGQGIFNS  540
            SVFH+LLGQGIFNS
Sbjct  61   SVFHDLLGQGIFNS  74



>ref|XP_007146731.1| hypothetical protein PHAVU_006G065000g [Phaseolus vulgaris]
 gb|ESW18725.1| hypothetical protein PHAVU_006G065000g [Phaseolus vulgaris]
Length=522

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +1

Query  214  TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAV  387
            + Y LWF F++ +L GP VWP++GS+P L+ N  R H+W+A NLR  G   TYQTC   +
Sbjct  19   SSYFLWFYFLARTLTGPKVWPMIGSVPELVVNRNRFHDWMASNLRQTGASPTYQTCTLTL  78

Query  388  PFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            PF ARKQG  TVT  P+N+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  79   PFFARKQGFFTVTSCPRNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNS  129



>gb|EYU38337.1| hypothetical protein MIMGU_mgv1a005555mg [Erythranthe guttata]
Length=479

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  319  MHEWIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQ  498
            MH+WIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILK RFDNYPKGP WQ
Sbjct  1    MHDWIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKVRFDNYPKGPTWQ  60

Query  499  SVFHELLGQGIFNS  540
            +VFH+LLGQGIFNS
Sbjct  61   AVFHDLLGQGIFNS  74



>gb|EYU45975.1| hypothetical protein MIMGU_mgv1a025576mg [Erythranthe guttata]
Length=521

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  199  LFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA-CGGTYQTC  375
            L +  + YLLWF  ++  L GP  WPL+GSLP L  N  R+H+WI+ NL++    TYQT 
Sbjct  10   LAAATSTYLLWFWLLARKLTGPKAWPLVGSLPYLYMNRRRIHDWISGNLQSSAAATYQTT  69

Query  376  ICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
              AVP+ ARKQG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ FH+LLGQGIFNS
Sbjct  70   TIAVPYFARKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGQGIFNS  124



>ref|XP_009630929.1| PREDICTED: cytochrome P450 86A1 [Nicotiana tomentosiformis]
Length=521

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCI  378
            +  T YLLWF  ++  L GP VWPL+GSLP    N  R H+WI++NLR+ GG  TYQT  
Sbjct  12   AATTVYLLWFWLLAQRLTGPKVWPLVGSLPYTFMNRRRFHDWISENLRSTGGAATYQTST  71

Query  379  CAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
              +PFLA KQG  TVTC PKN+EHIL+ RFDNYPKGP WQS F +LLGQGIFNS
Sbjct  72   ICIPFLAWKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQSAFDDLLGQGIFNS  125



>ref|XP_004241175.1| PREDICTED: cytochrome P450 86A1 [Solanum lycopersicum]
Length=521

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +1

Query  193  LLLFSGV----TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG-  357
            +L++SG+    T Y LWF  ++  L GP VWPL+GSLP    N  R H+WI+ NLR+ G 
Sbjct  4    ILVYSGIIASITAYFLWFYLLAQRLSGPKVWPLVGSLPYTFLNRRRFHDWISQNLRSTGV  63

Query  358  -GTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC   +PFLA KQG  TVTC PKN+EHIL+ RFDNYPKGP WQ+ F +LLGQGIF
Sbjct  64   SATYQTCTICIPFLAWKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQNAFDDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>ref|XP_009763725.1| PREDICTED: cytochrome P450 86A1 [Nicotiana sylvestris]
Length=521

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCI  378
            +  T YLLWF  ++  L GP VWPL+GSLP    N  R H+WI++NLR+ GG  TYQT  
Sbjct  12   AATTVYLLWFWLLAQRLTGPKVWPLVGSLPYTFMNRRRFHDWISENLRSTGGAATYQTST  71

Query  379  CAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
              +PFLA KQG  TVTC PKN+EHIL+ RFDNYPKGP WQS F +LLGQGIFNS
Sbjct  72   ICIPFLAWKQGFYTVTCHPKNIEHILRTRFDNYPKGPTWQSAFDDLLGQGIFNS  125



>ref|XP_002883546.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59805.1| cytochrome P450 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = +1

Query  205  SGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICA  384
            + ++ Y LWF F+S  L GP V P +GSLP LI N  R+H+WIADNLRA GGTYQTC   
Sbjct  14   AALSVYALWFYFLSRRLTGPKVLPFVGSLPYLIANRSRIHDWIADNLRATGGTYQTCTMV  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF +  +   TVTC PKN+EHILK RFDNYPKGP W++ FH+LLGQGIFNS
Sbjct  74   IPF-SWPRRFYTVTCHPKNVEHILKTRFDNYPKGPMWRAAFHDLLGQGIFNS  124



>ref|XP_006848139.1| hypothetical protein AMTR_s00029p00225720 [Amborella trichopoda]
 gb|ERN09720.1| hypothetical protein AMTR_s00029p00225720 [Amborella trichopoda]
Length=392

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG-TYQTCICAVPFLARK  405
            WF  +S  L GP VWP LGSLP L  N  R+H+WIA NL+     TYQTCIC +PFL+ K
Sbjct  22   WFLSLSARLSGPRVWPFLGSLPSLFLNRRRLHDWIASNLKNSPTLTYQTCICPLPFLSLK  81

Query  406  QGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            QGLVTVT +PKNLEHILK RF+NYPKGP+WQ+ FH+LLG GIFNS
Sbjct  82   QGLVTVTANPKNLEHILKTRFENYPKGPHWQAAFHDLLGSGIFNS  126



>ref|NP_001275219.1| CYP86A33 fatty acid omega-hydroxylase [Solanum tuberosum]
 gb|ABZ80830.1| CYP86A33 fatty acid omega-hydroxylase [Solanum tuberosum]
Length=521

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 86/122 (70%), Gaps = 6/122 (5%)
 Frame = +1

Query  193  LLLFSGV----TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACG-  357
            +L++SG+    T Y LWF  ++  L GP VWPL+GSLP    N  R H+WI+ NLR+ G 
Sbjct  4    ILVYSGIIAAITVYFLWFYLLAQRLSGPKVWPLVGSLPYTFLNRRRFHDWISQNLRSTGV  63

Query  358  -GTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIF  534
              TYQTC   +PFLA KQG  TVT  PKN+EHIL+ RFDNYPKGP WQ+ F +LLGQGIF
Sbjct  64   SATYQTCTICIPFLAWKQGFYTVTRHPKNIEHILRTRFDNYPKGPTWQNAFDDLLGQGIF  123

Query  535  NS  540
            NS
Sbjct  124  NS  125



>gb|KHN47607.1| Cytochrome P450 86A1 [Glycine soja]
Length=518

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICA  384
            ++ Y +WF  ++ +L GP VWPL+GSLP +I N  R+H+W+A NLR   G  TYQTC   
Sbjct  14   LSAYFVWFHLLARTLTGPKVWPLVGSLPSMIVNRNRVHDWMAANLRQIEGSATYQTCTLT  73

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF A KQ   TVT +P+N+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  74   LPFFACKQAFFTVTSNPRNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNS  125



>ref|XP_003538284.1| PREDICTED: cytochrome P450 86A1-like isoform 1 [Glycine max]
Length=521

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICA  384
            ++ Y +WF  ++ +L GP VWPL+GSLP +I N  R+H+W+A NLR   G  TYQTC   
Sbjct  17   LSAYFVWFHLLARTLTGPKVWPLVGSLPSMIVNRNRVHDWMAANLRQIEGSATYQTCTLT  76

Query  385  VPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +PF A KQ   TVT +P+N+EHIL+ RFDNYPKGP+WQ+ FH+LLGQGIFNS
Sbjct  77   LPFFACKQAFFTVTSNPRNIEHILRTRFDNYPKGPHWQAAFHDLLGQGIFNS  128



>ref|XP_004500237.1| PREDICTED: cytochrome P450 86A1-like [Cicer arietinum]
Length=529

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 2/125 (2%)
 Frame = +1

Query  172  TMDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            T  L +   L + +  YL WF  ++ +L GP V+P  GSLP L  N  R H+W+  NL  
Sbjct  16   TNTLPIIFTLAATLCAYLFWFHLLARNLTGPKVYPFFGSLPVLFMNRNRFHDWMTSNLNQ  75

Query  352  CGG--TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             GG  TYQTCI   PFLARKQG  TVT  PKN+EHIL+ RFDNYPKGP WQ+ FH+LLG 
Sbjct  76   TGGSSTYQTCILPFPFLARKQGFYTVTSHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGH  135

Query  526  GIFNS  540
            GIFNS
Sbjct  136  GIFNS  140



>ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50544.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +1

Query  172  TMDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRA  351
            TMD++ AL+LFS VT YLLWFTFIS SLKGP VWPLLGSLPGLIEN +RMH+WI DNLRA
Sbjct  7    TMDVSTALMLFSAVTAYLLWFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWICDNLRA  66

Query  352  CGGTYQTCICAVPFLARKQG  411
            CGGTYQTCICA+PFLA+KQG
Sbjct  67   CGGTYQTCICAIPFLAKKQG  86



>gb|KEH34209.1| cytochrome P450 family-dependent fatty acid hydroxylase [Medicago 
truncatula]
Length=510

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +1

Query  229  WFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGG--TYQTCICAVPFLAR  402
            WF  ++ +L GP V+P  GSLP L  N  R+H+W+  NL   GG  TYQTCI   PFLAR
Sbjct  25   WFHLLARTLTGPKVFPFFGSLPVLFMNRNRVHDWMTSNLNRTGGSNTYQTCILPFPFLAR  84

Query  403  KQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            KQG  TVT  PKN+EHIL+ RFDNYPKGP WQ+ FH+LLG GIFNS
Sbjct  85   KQGFYTVTSHPKNIEHILRTRFDNYPKGPTWQTAFHDLLGHGIFNS  130



>gb|KHN40058.1| Cytochrome P450 86A1 [Glycine soja]
Length=326

 Score =   114 bits (285),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 56/69 (81%), Gaps = 2/69 (3%)
 Frame = +1

Query  340  NLRACGG--TYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHE  513
            NLR  GG  TYQTCI   PFLARK+G  TVTC PKNLEHILK RFDNYPKGP WQ+ FH+
Sbjct  79   NLRGRGGSATYQTCIIPFPFLARKKGFYTVTCHPKNLEHILKTRFDNYPKGPKWQTAFHD  138

Query  514  LLGQGIFNS  540
            LLGQGIFNS
Sbjct  139  LLGQGIFNS  147



>gb|ACO87292.1| LACERATA [Arabidopsis thaliana]
Length=66

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  175  MDLAVALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRAC  354
            M+++ AL++ S +T Y LW TFIS  LKGP VWP+LGSLPGLIEN ERMH+WI+DNLRAC
Sbjct  1    MEISTALMILSAITAYFLWLTFISRCLKGPRVWPILGSLPGLIENCERMHDWISDNLRAC  60

Query  355  GGTYQT  372
             GTYQT
Sbjct  61   SGTYQT  66



>ref|XP_001760399.1| predicted protein [Physcomitrella patens]
 gb|EDQ74790.1| predicted protein [Physcomitrella patens]
Length=519

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 67/121 (55%), Gaps = 17/121 (14%)
 Frame = +1

Query  196  LLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQ--  369
            ++ +GV  +L+W       +KGP VWP+ G+ P  + N  RMH+W  D L    GTY   
Sbjct  5    VMLAGVVTFLVWHVIKYSRIKGPIVWPVFGTTPQFLWNLPRMHDWTTDMLVKHDGTYTSI  64

Query  370  ----TCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFN  537
                TC+ AV            TC P+NLE++LK  F NYPKG ++    H+LLGQGIFN
Sbjct  65   APKCTCLTAV-----------ATCRPENLEYVLKTNFANYPKGRSFTYPSHDLLGQGIFN  113

Query  538  S  540
            +
Sbjct  114  T  114



>ref|XP_001782495.1| predicted protein [Physcomitrella patens]
 gb|EDQ52714.1| predicted protein [Physcomitrella patens]
Length=528

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 9/116 (8%)
 Frame = +1

Query  211  VTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTYQ------T  372
            V  +L+W       +KGP VWP+ G+ P  + N  RMH+W  D L    GTY       T
Sbjct  10   VVAFLVWHVLKYSRIKGPIVWPVFGTTPQFLWNLPRMHDWTTDMLVKFDGTYTSIAPKCT  69

Query  373  CICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            C+ AV   A   G   + C P+NLE++LK  F NYPKG ++    H+LLGQGIFN+
Sbjct  70   CLTAV---ATCSGEFGMNCRPENLEYVLKTNFANYPKGRSFTYPSHDLLGQGIFNT  122



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 6/118 (5%)
 Frame = +1

Query  187  VALLLFSGVTCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNLRACGGTY  366
            + L L   +  +L+W T        P  WPL+G LPG+++N+ R+H++  D L   GGT+
Sbjct  9    IFLFLLPAMILFLVWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDYATDILSESGGTF  68

Query  367  QTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            Q     V  +      + VTCDP N+ HI    F NYPKGP ++ +F E+LG GIFN+
Sbjct  69   QFKFPGVFNMD-----MLVTCDPANIHHIFSRNFSNYPKGPEFRKIF-EILGDGIFNA  120



>ref|XP_006857146.1| hypothetical protein AMTR_s00065p00159700 [Amborella trichopoda]
 gb|ERN18613.1| hypothetical protein AMTR_s00065p00159700 [Amborella trichopoda]
Length=293

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 5/90 (6%)
 Frame = +1

Query  271  WPLLGSLPGLIENAERMHEWIADNLRACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEH  450
            WPLL  LP ++ N   +H W AD LRA GGT+       P L   +  +  TCDP N+E+
Sbjct  41   WPLLRDLPAVLINLPHIHNWSADVLRALGGTFTV---RGPILTGMR--IVATCDPSNMEY  95

Query  451  ILKNRFDNYPKGPNWQSVFHELLGQGIFNS  540
            +LK RF N+PKGP++  +F EL+G GIFN+
Sbjct  96   VLKTRFSNFPKGPDFHDIFRELMGAGIFNT  125



>ref|XP_006828488.1| hypothetical protein AMTR_s00060p00164420 [Amborella trichopoda]
 gb|ERM95904.1| hypothetical protein AMTR_s00060p00164420 [Amborella trichopoda]
Length=299

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 69/125 (55%), Gaps = 8/125 (6%)
 Frame = +1

Query  175  MDLAVALLLFSGV---TCYLLWFTFISXSLKGPXVWPLLGSLPGLIENAERMHEWIADNL  345
            MD    L++  GV      L    F+    K    WPLL  LP L+ N  R+ +W AD  
Sbjct  1    MDHGGRLVVLCGVGWAEVLLAVLCFLVLHYKPFITWPLLRDLPALLINLPRIQDWTADVH  60

Query  346  RACGGTYQTCICAVPFLARKQGLVTVTCDPKNLEHILKNRFDNYPKGPNWQSVFHELLGQ  525
             A GGT+       P L   +  + +TCDP N+E+ILK RF N+PKGP++Q +F EL+G 
Sbjct  61   GAVGGTFT---ARGPILTGMR--LVLTCDPCNVEYILKTRFSNFPKGPDFQDIFRELMGD  115

Query  526  GIFNS  540
            GIFN+
Sbjct  116  GIFNT  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645