BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031D19

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   1e-68   Nicotiana tomentosiformis
ref|XP_009618667.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   1e-68   
ref|XP_009783532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    233   3e-68   Nicotiana sylvestris
ref|XP_009783537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    233   4e-68   Nicotiana sylvestris
ref|XP_011084184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    232   5e-68   
ref|XP_006364269.1|  PREDICTED: serine/arginine repetitive matrix...    230   4e-67   Solanum tuberosum [potatoes]
ref|XP_004245196.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   1e-66   Solanum lycopersicum
gb|EYU29231.1|  hypothetical protein MIMGU_mgv1a002140mg                223   6e-65   Erythranthe guttata [common monkey flower]
emb|CBI21007.3|  unnamed protein product                                216   2e-64   Vitis vinifera
emb|CDP04788.1|  unnamed protein product                                221   5e-64   Coffea canephora [robusta coffee]
ref|XP_004164532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    208   5e-63   
ref|XP_011019778.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-63   Populus euphratica
ref|XP_011019781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-63   Populus euphratica
ref|XP_011019777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-63   Populus euphratica
ref|XP_011019776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-63   Populus euphratica
ref|XP_011019775.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-63   Populus euphratica
gb|EYU29230.1|  hypothetical protein MIMGU_mgv1a002072mg                217   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_002285000.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   2e-62   Vitis vinifera
ref|XP_011026475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   2e-62   Populus euphratica
ref|XP_011026473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   2e-62   Populus euphratica
ref|XP_010648638.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    217   2e-62   Vitis vinifera
ref|XP_002324283.2|  hypothetical protein POPTR_0018s01460g             217   2e-62   
emb|CAN80313.1|  hypothetical protein VITISV_020758                     214   9e-62   Vitis vinifera
gb|KGN62922.1|  hypothetical protein Csa_2G380020                       213   5e-61   Cucumis sativus [cucumbers]
ref|XP_004138866.1|  PREDICTED: uncharacterized protein LOC101210345    213   6e-61   
ref|XP_011081940.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    212   8e-61   
ref|XP_008445168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   9e-61   Cucumis melo [Oriental melon]
gb|KHG19968.1|  Peptidyl-prolyl cis-trans isomerase cyp5                209   7e-60   Gossypium arboreum [tree cotton]
ref|XP_006382072.1|  hypothetical protein POPTR_0006s26710g             210   7e-60   
ref|XP_007013817.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    209   1e-59   
ref|XP_007013820.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    209   1e-59   
ref|XP_002515550.1|  peptidyl-prolyl cis-trans isomerase, putative      208   2e-59   
gb|KJB07784.1|  hypothetical protein B456_001G045000                    208   2e-59   Gossypium raimondii
gb|KJB07776.1|  hypothetical protein B456_001G045000                    207   6e-59   Gossypium raimondii
gb|KJB07775.1|  hypothetical protein B456_001G045000                    207   6e-59   Gossypium raimondii
ref|XP_006450486.1|  hypothetical protein CICLE_v10007495mg             207   7e-59   Citrus clementina [clementine]
ref|XP_006450487.1|  hypothetical protein CICLE_v10007495mg             207   8e-59   Citrus clementina [clementine]
ref|XP_006483322.1|  PREDICTED: serine/arginine repetitive matrix...    207   1e-58   Citrus sinensis [apfelsine]
ref|XP_006483320.1|  PREDICTED: serine/arginine repetitive matrix...    206   1e-58   Citrus sinensis [apfelsine]
ref|XP_003523694.1|  PREDICTED: serine/arginine repetitive matrix...    206   2e-58   
gb|KHN08115.1|  Peptidyl-prolyl cis-trans isomerase D                   205   3e-58   Glycine soja [wild soybean]
gb|KDP33623.1|  hypothetical protein JCGZ_07194                         205   4e-58   Jatropha curcas
ref|XP_010670673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    205   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    205   5e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003526420.1|  PREDICTED: serine/arginine repetitive matrix...    205   5e-58   
gb|KHG30308.1|  Peptidyl-prolyl cis-trans isomerase cyp5                192   6e-58   Gossypium arboreum [tree cotton]
ref|XP_006581365.1|  PREDICTED: serine/arginine repetitive matrix...    204   7e-58   
gb|KHN07093.1|  Peptidyl-prolyl cis-trans isomerase D                   204   8e-58   Glycine soja [wild soybean]
gb|KCW80439.1|  hypothetical protein EUGRSUZ_C01785                     202   1e-57   Eucalyptus grandis [rose gum]
gb|KCW80440.1|  hypothetical protein EUGRSUZ_C01785                     202   2e-57   Eucalyptus grandis [rose gum]
ref|XP_004501305.1|  PREDICTED: serine/arginine repetitive matrix...    203   2e-57   Cicer arietinum [garbanzo]
gb|KJB07770.1|  hypothetical protein B456_001G044900                    203   3e-57   Gossypium raimondii
gb|EPS68763.1|  hypothetical protein M569_06004                         201   8e-57   Genlisea aurea
ref|XP_007161230.1|  hypothetical protein PHAVU_001G052800g             202   1e-56   Phaseolus vulgaris [French bean]
gb|KJB07786.1|  hypothetical protein B456_001G045000                    201   1e-56   Gossypium raimondii
ref|XP_007161232.1|  hypothetical protein PHAVU_001G053000g             201   2e-56   Phaseolus vulgaris [French bean]
ref|XP_010048238.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010048237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   2e-56   Eucalyptus grandis [rose gum]
ref|XP_010048236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   3e-56   Eucalyptus grandis [rose gum]
ref|XP_010048233.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   3e-56   Eucalyptus grandis [rose gum]
ref|XP_007161231.1|  hypothetical protein PHAVU_001G052900g             198   3e-55   Phaseolus vulgaris [French bean]
gb|AES58972.2|  peptidyl-prolyl cis-trans isomerase                     197   3e-55   Medicago truncatula
gb|AES73684.2|  peptidyl-prolyl cis-trans isomerase                     196   1e-54   Medicago truncatula
ref|XP_004498656.1|  PREDICTED: serine/arginine repetitive matrix...    190   7e-53   Cicer arietinum [garbanzo]
ref|XP_008394052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   8e-53   
ref|XP_008394051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   9e-53   
ref|XP_008219899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   1e-52   Prunus mume [ume]
ref|XP_007225294.1|  hypothetical protein PRUPE_ppa001326mg             190   1e-52   Prunus persica
ref|XP_009345297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   2e-52   Pyrus x bretschneideri [bai li]
emb|CDX75243.1|  BnaA01g04590D                                          187   8e-52   
ref|XP_010110347.1|  Peptidyl-prolyl cis-trans isomerase 1              187   1e-51   
ref|XP_008378303.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    184   1e-51   
emb|CDX68845.1|  BnaC01g06080D                                          186   2e-51   
ref|XP_009334770.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009334769.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_009126010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   2e-51   
ref|XP_010447392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010447391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002867244.1|  hypothetical protein ARALYDRAFT_491484             185   7e-51   
ref|XP_010546569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    184   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_006412476.1|  hypothetical protein EUTSA_v10024440mg             184   1e-50   
ref|XP_008378304.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    183   2e-50   
ref|NP_194968.2|  cyclophilin-like peptidyl-prolyl cis-trans isom...    183   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190888.1|  cyclophilin-like peptidyl-prolyl cis-trans i...    182   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   1e-49   Fragaria vesca subsp. vesca
ref|XP_010432722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010432723.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006283087.1|  hypothetical protein CARUB_v10004106mg             181   4e-49   
ref|XP_010437912.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    180   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010437913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    180   4e-49   Camelina sativa [gold-of-pleasure]
gb|AAM13845.1|  unknown protein                                         179   6e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    177   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    177   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    176   2e-47   Phoenix dactylifera
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    175   2e-47   Phoenix dactylifera
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    174   5e-47   Elaeis guineensis
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    174   8e-47   Elaeis guineensis
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760          171   5e-46   
ref|XP_010432719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010432721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    169   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004498655.1|  PREDICTED: serine/arginine repetitive matrix...    168   7e-45   
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    166   9e-45   
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO68605.1|  hypothetical protein CISIN_1g006162mg                   165   3e-44   Citrus sinensis [apfelsine]
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    167   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg             165   3e-44   Citrus clementina [clementine]
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg             165   3e-44   
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                   165   3e-44   Citrus sinensis [apfelsine]
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   3e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    165   4e-44   Nelumbo nucifera [Indian lotus]
gb|KDP21391.1|  hypothetical protein JCGZ_21862                         164   7e-44   Jatropha curcas
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    164   8e-44   
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904    164   9e-44   Cucumis sativus [cucumbers]
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904            164   1e-43   
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    164   1e-43   Cucumis melo [Oriental melon]
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   2e-43   Vitis vinifera
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   2e-43   Vitis vinifera
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    163   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   5e-43   Phoenix dactylifera
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   5e-43   Phoenix dactylifera
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   5e-43   Phoenix dactylifera
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   5e-43   Phoenix dactylifera
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   5e-43   
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB25951.1|  hypothetical protein B456_004G217800                    161   6e-43   Gossypium raimondii
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    162   7e-43   
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   8e-43   Prunus mume [ume]
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   8e-43   Prunus mume [ume]
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   9e-43   
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   9e-43   
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   1e-42   Cicer arietinum [garbanzo]
gb|KJB25952.1|  hypothetical protein B456_004G217800                    160   1e-42   Gossypium raimondii
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    161   1e-42   Eucalyptus grandis [rose gum]
gb|KJB25950.1|  hypothetical protein B456_004G217800                    160   1e-42   Gossypium raimondii
gb|KJB25949.1|  hypothetical protein B456_004G217800                    160   1e-42   Gossypium raimondii
gb|KJB25953.1|  hypothetical protein B456_004G217800                    160   2e-42   Gossypium raimondii
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    160   2e-42   Eucalyptus grandis [rose gum]
emb|CDP03680.1|  unnamed protein product                                160   2e-42   Coffea canephora [robusta coffee]
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                     160   3e-42   Medicago truncatula
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    159   3e-42   
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    159   3e-42   
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg             159   4e-42   Prunus persica
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                     159   4e-42   Betula luminifera [liang ye hua]
gb|KHG26228.1|  Peptidyl-prolyl cis-trans isomerase D                   150   5e-42   Gossypium arboreum [tree cotton]
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g             159   5e-42   Phaseolus vulgaris [French bean]
ref|XP_002520955.1|  cyclophilin, putative                              159   9e-42   Ricinus communis
gb|AAP44536.1|  cyclophilin-like protein                                158   1e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    158   1e-41   Elaeis guineensis
ref|XP_011458604.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    157   2e-41   Fragaria vesca subsp. vesca
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   4e-41   Tarenaya hassleriana [spider flower]
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   4e-41   Nicotiana sylvestris
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   4e-41   Glycine max [soybeans]
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   4e-41   Glycine max [soybeans]
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   5e-41   Glycine max [soybeans]
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    156   5e-41   Glycine max [soybeans]
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Tarenaya hassleriana [spider flower]
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g             156   8e-41   
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   8e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                     155   2e-40   Glycine soja [wild soybean]
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    155   2e-40   Nicotiana tomentosiformis
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   2e-40   Nicotiana tomentosiformis
ref|XP_003557489.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_010228289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   4e-40   Oryza brachyantha
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    154   4e-40   
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    153   6e-40   
dbj|BAJ87064.1|  predicted protein                                      153   7e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA42557.1|  TPA: hypothetical protein ZEAMMB73_596682              145   9e-40   
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    153   9e-40   Solanum lycopersicum
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    152   1e-39   Solanum tuberosum [potatoes]
tpg|DAA59762.1|  TPA: hypothetical protein ZEAMMB73_415877              148   1e-39   
ref|XP_002459423.1|  hypothetical protein SORBIDRAFT_02g004430          152   2e-39   Sorghum bicolor [broomcorn]
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g             152   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    151   4e-39   Sesamum indicum [beniseed]
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg                150   6e-39   Erythranthe guttata [common monkey flower]
tpg|DAA42555.1|  TPA: hypothetical protein ZEAMMB73_596682              145   1e-38   
dbj|BAJ98045.1|  predicted protein                                      148   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   2e-38   Populus euphratica
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    149   2e-38   Populus euphratica
ref|XP_004955639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   6e-38   Setaria italica
ref|XP_004955636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    147   6e-38   Setaria italica
ref|XP_008651151.1|  PREDICTED: uncharacterized protein LOC100274...    147   8e-38   
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...    147   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008651150.1|  PREDICTED: uncharacterized protein LOC100274...    147   1e-37   
ref|XP_008651149.1|  PREDICTED: uncharacterized protein LOC100274...    147   1e-37   Zea mays [maize]
emb|CDX93909.1|  BnaC04g20680D                                          147   1e-37   
dbj|BAH57223.1|  AT3G63400                                              146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    146   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg             144   1e-37   
emb|CAN75764.1|  hypothetical protein VITISV_034442                     148   1e-37   Vitis vinifera
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   1e-37   Oryza brachyantha
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    148   1e-37   Oryza brachyantha
ref|XP_001651471.1|  AAEL005799-PA                                      140   2e-37   
ref|XP_001780456.1|  predicted protein                                  139   2e-37   
gb|EEC72707.1|  hypothetical protein OsI_06299                          147   3e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764             145   3e-37   
gb|EEE66674.1|  hypothetical protein OsJ_23316                          145   4e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56526.1|  hypothetical protein OsJ_05815                          145   4e-37   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA42558.1|  TPA: hypothetical protein ZEAMMB73_596682              145   5e-37   
gb|EEC81610.1|  hypothetical protein OsI_25113                          145   5e-37   Oryza sativa Indica Group [Indian rice]
gb|AIZ68177.1|  peptidyl-prolyl cis-trans isomerase CYP40-like pr...    142   5e-37   Ornithogalum longebracteatum [sea-onion]
ref|NP_001232291.1|  putative peptidylprolyl isomerase D                138   6e-37   
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg             144   6e-37   
ref|NP_001170592.1|  uncharacterized protein LOC100384625               145   6e-37   Zea mays [maize]
ref|XP_008668501.1|  PREDICTED: uncharacterized protein LOC100384...    145   6e-37   Zea mays [maize]
emb|CDK25020.1|  unnamed protein product                                142   8e-37   Kuraishia capsulata CBS 1993
ref|XP_004926608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   1e-36   
ref|XP_007184203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    141   2e-36   Balaenoptera acutorostrata scammoni
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    143   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010999957.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   2e-36   Populus euphratica
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    142   3e-36   Brassica rapa
emb|CDY53714.1|  BnaAnng12550D                                          142   3e-36   Brassica napus [oilseed rape]
ref|XP_010584392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   3e-36   Haliaeetus leucocephalus
gb|EPS61145.1|  hypothetical protein M569_13654                         142   3e-36   Genlisea aurea
gb|ELU12765.1|  hypothetical protein CAPTEDRAFT_170435                  140   3e-36   Capitella teleta
ref|XP_010685556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   3e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_005148983.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   4e-36   Melopsittacus undulatus
ref|XP_010584391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   5e-36   Haliaeetus leucocephalus
gb|KIZ04415.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    135   6e-36   Monoraphidium neglectum
ref|XP_010262860.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   6e-36   Nelumbo nucifera [Indian lotus]
gb|EYU44370.1|  hypothetical protein MIMGU_mgv1a0089282mg               137   7e-36   Erythranthe guttata [common monkey flower]
ref|XP_010028504.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   9e-36   Eucalyptus grandis [rose gum]
gb|KFP78820.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Acanthisitta chloris
gb|KFP14006.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Egretta garzetta
ref|XP_008236639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   1e-35   Prunus mume [ume]
gb|KFQ46673.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Nestor notabilis
gb|KFO07741.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Balearica regulorum gibbericeps
ref|XP_010530877.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    139   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_002601271.1|  hypothetical protein BRAFLDRAFT_229322             134   1e-35   Branchiostoma floridae
ref|XP_008681079.1|  PREDICTED: uncharacterized protein LOC100192...    142   1e-35   
ref|XP_008681078.1|  PREDICTED: uncharacterized protein LOC100192...    142   1e-35   Zea mays [maize]
gb|KFP00867.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Calypte anna
gb|KFP46157.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Cathartes aura
gb|KFO88271.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Buceros rhinoceros silvestris
gb|KFP32657.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Colius striatus
gb|KFV98604.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Fulmarus glacialis
gb|KFQ13013.1|  Peptidyl-prolyl cis-trans isomerase D                   133   1e-35   Leptosomus discolor
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase                134   1e-35   Morus notabilis
emb|CEP18822.1|  hypothetical protein                                   134   1e-35   Parasitella parasitica
ref|XP_010548031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_003524582.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   1e-35   
ref|XP_001760224.1|  predicted protein                                  134   1e-35   
ref|XP_456922.1|  DEHA2A13640p                                          138   2e-35   Debaryomyces hansenii CBS767
gb|KFU96890.1|  Peptidyl-prolyl cis-trans isomerase D                   133   2e-35   Pterocles gutturalis
ref|XP_010268554.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006579808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   2e-35   Glycine max [soybeans]
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase     133   2e-35   Heterostelium album PN500
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   2e-35   
gb|EWM22369.1|  Cyclophilin-like peptidyl-prolyl cis-trans isomer...    140   2e-35   Nannochloropsis gaditana
ref|XP_001862300.1|  peptidyl-prolyl cis-trans isomerase g              136   2e-35   Culex quinquefasciatus
ref|XP_011007671.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-35   Populus euphratica
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    140   2e-35   Camelina sativa [gold-of-pleasure]
gb|KFR12601.1|  Peptidyl-prolyl cis-trans isomerase D                   132   2e-35   Opisthocomus hoazin [hoatzin]
gb|ACH45652.1|  putative peptidylprolyl isomerase D                     138   2e-35   Taeniopygia guttata
ref|XP_010234011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    142   2e-35   Brachypodium distachyon [annual false brome]
gb|KFV40440.1|  Peptidyl-prolyl cis-trans isomerase D                   132   2e-35   Gavia stellata
ref|WP_030697934.1|  peptidylprolyl isomerase                           133   2e-35   Streptomyces
ref|XP_008454916.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   2e-35   
gb|KFO74350.1|  Peptidyl-prolyl cis-trans isomerase D                   133   2e-35   Cuculus canorus
gb|KFW75627.1|  Peptidyl-prolyl cis-trans isomerase D                   132   2e-35   Manacus vitellinus
gb|KFQ22621.1|  Peptidyl-prolyl cis-trans isomerase D                   132   2e-35   Mesitornis unicolor
ref|XP_009781931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   2e-35   Nicotiana sylvestris
emb|CAA22569.1|  putative protein                                       142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005486377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    138   2e-35   Zonotrichia albicollis
gb|KFW96185.1|  Peptidyl-prolyl cis-trans isomerase D                   132   2e-35   Phalacrocorax carbo [common cormorant]
ref|XP_002521846.1|  peptidyl-prolyl cis-trans isomerase d, ppid,...    137   3e-35   Ricinus communis
gb|ACH45651.1|  putative peptidylprolyl isomerase D                     138   3e-35   
ref|XP_009350556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   3e-35   
ref|XP_011007670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   3e-35   
ref|XP_011464347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   3e-35   
ref|XP_011001198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   3e-35   
ref|XP_005517649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   3e-35   
gb|KGL84249.1|  Peptidyl-prolyl cis-trans isomerase D                   131   3e-35   
ref|XP_007609920.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    137   3e-35   
ref|XP_009409921.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   4e-35   
ref|XP_007446681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-35   
emb|CEG74671.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp6      132   4e-35   
ref|XP_003578523.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   4e-35   
ref|XP_010726006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   4e-35   
ref|XP_007117530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-35   
ref|XP_007117529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-35   
ref|XP_005112767.1|  PREDICTED: NK-tumor recognition protein-like...    142   4e-35   
ref|XP_005112766.1|  PREDICTED: NK-tumor recognition protein-like...    142   4e-35   
gb|EGW00520.1|  40 kDa peptidyl-prolyl cis-trans isomerase              134   4e-35   
ref|XP_004266204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   4e-35   
ref|XP_001328636.1|  cytosolic cyclophilin                              132   4e-35   
ref|XP_002982010.1|  hypothetical protein SELMODRAFT_115473             132   5e-35   
emb|CEG68783.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp6      132   5e-35   
emb|CDS03415.1|  Putative Peptidyl-prolyl cis-trans isomerasecyp5       132   5e-35   
ref|XP_002310739.2|  hypothetical protein POPTR_0007s11390g             135   5e-35   
gb|KHG25547.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...    137   6e-35   
ref|XP_009589624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   6e-35   
gb|EAZ38239.1|  hypothetical protein OsJ_22614                          133   6e-35   
gb|KFO65363.1|  Peptidyl-prolyl cis-trans isomerase D                   131   7e-35   
ref|XP_010381484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   7e-35   
ref|XP_007201325.1|  hypothetical protein PRUPE_ppa007583mg             136   7e-35   
gb|KFQ59651.1|  Peptidyl-prolyl cis-trans isomerase D                   131   7e-35   
gb|KFZ53446.1|  Peptidyl-prolyl cis-trans isomerase D                   131   7e-35   
ref|XP_010104628.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4        133   7e-35   
ref|XP_007998311.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   7e-35   
ref|XP_006384447.1|  SQUINT family protein                              137   7e-35   
ref|WP_010872470.1|  peptidylprolyl isomerase                           132   7e-35   
ref|XP_426283.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    136   8e-35   
ref|XP_003550075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   8e-35   
ref|XP_008454915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   9e-35   
ref|XP_003504914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   9e-35   
sp|P0C1I7.1|CYP5_RHIO9  RecName: Full=Peptidyl-prolyl cis-trans i...    132   9e-35   
ref|XP_011007669.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   9e-35   
ref|WP_023418050.1|  Peptidyl-prolyl cis-trans isomerase                131   1e-34   
emb|CEI93837.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp11     135   1e-34   
ref|XP_002313093.1|  SQUINT family protein                              136   1e-34   
gb|EAZ02313.1|  hypothetical protein OsI_24414                          133   1e-34   
ref|NP_001058535.1|  Os06g0708500                                       132   1e-34   
ref|XP_004288060.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
ref|XP_009593827.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
ref|XP_010253899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   1e-34   
ref|XP_001633810.1|  predicted protein                                  136   1e-34   
gb|KFQ23708.1|  Peptidyl-prolyl cis-trans isomerase D                   130   1e-34   
ref|XP_007042358.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...    136   1e-34   
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase                131   1e-34   
dbj|BAD53621.1|  putative cyclophilin                                   133   1e-34   
ref|XP_004136993.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
ref|XP_006892841.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    136   1e-34   
gb|KFP45178.1|  Peptidyl-prolyl cis-trans isomerase D                   130   1e-34   
gb|EMS48237.1|  Peptidyl-prolyl cis-trans isomerase CYP19-4             132   1e-34   
ref|XP_004966389.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   1e-34   
ref|WP_028948841.1|  peptidylprolyl isomerase                           131   1e-34   
ref|WP_023422139.1|  Peptidyl-prolyl cis-trans isomerase                131   1e-34   
gb|EHH30637.1|  hypothetical protein EGK_20384                          136   1e-34   
gb|AAH14893.1|  PPID protein                                            130   1e-34   
dbj|BAJ85310.1|  predicted protein                                      132   2e-34   
ref|XP_004966388.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   2e-34   
ref|XP_004165805.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    135   2e-34   
ref|XP_001761081.1|  predicted protein                                  135   2e-34   
ref|XP_009759456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_003221776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
gb|KIW43118.1|  peptidyl-prolyl cis-trans isomerase D                   135   2e-34   
ref|XP_006121931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_004290309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_007998309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_007624483.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    135   2e-34   
ref|XP_001500384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_005854554.1|  myosin light chain kinase                          139   2e-34   
ref|WP_033950859.1|  peptidylprolyl isomerase                           130   2e-34   
gb|EMF14722.1|  peptidyl-prolyl cis-trans isomerase 1                   135   2e-34   
ref|XP_010772716.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   2e-34   
ref|XP_006656475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   2e-34   
ref|XP_005076198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_006409501.1|  hypothetical protein EUTSA_v10022753mg             135   2e-34   
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                  130   2e-34   
ref|XP_006000743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   2e-34   
ref|XP_002745353.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|XP_008464041.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    131   3e-34   
ref|XP_003899367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
gb|EHH54044.1|  hypothetical protein EGM_14781                          135   3e-34   
ref|NP_001271664.1|  uncharacterized protein LOC101867179               135   3e-34   
ref|NP_001252763.1|  peptidylprolyl isomerase D                         135   3e-34   
ref|XP_007998308.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
gb|EHH26276.1|  hypothetical protein EGK_16197                          135   3e-34   
ref|NP_001004279.1|  peptidyl-prolyl cis-trans isomerase D              135   3e-34   
ref|XP_007436535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
ref|XP_003391208.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   3e-34   
ref|XP_008775239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   3e-34   
gb|KJB48523.1|  hypothetical protein B456_008G073900                    135   3e-34   
ref|XP_003436324.1|  AGAP002952-PB                                      130   3e-34   
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320              130   3e-34   
ref|XP_010227456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    131   3e-34   
gb|KFV82477.1|  Peptidyl-prolyl cis-trans isomerase D                   129   3e-34   
gb|KJB32424.1|  hypothetical protein B456_005G240200                    132   3e-34   
dbj|BAE92296.1|  putative peptidyl-prolyl cis-trans isomerase           130   3e-34   
ref|XP_002306460.1|  hypothetical protein POPTR_0005s14210g             134   4e-34   
ref|XP_010322200.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   4e-34   
ref|XP_007373249.1|  rotamase D                                         135   4e-34   
emb|CDH48646.1|  cyclophilin                                            130   4e-34   
ref|XP_010107982.1|  Peptidyl-prolyl cis-trans isomerase CYP40          134   4e-34   
ref|XP_008775240.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   4e-34   
gb|EPB84551.1|  peptidyl-prolyl cis-trans isomerase cyp5                130   4e-34   
gb|EFA84025.1|  Cyclophilin                                             136   4e-34   
gb|ERE90429.1|  peptidyl-prolyl cis-trans isomerase D-like protein      134   4e-34   
ref|XP_010182057.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   4e-34   
gb|ACH70718.1|  peptidylprolyl isomerase D (cyclophilin D)              134   4e-34   
ref|XP_005299363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   4e-34   
ref|XP_007611328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   4e-34   
ref|XP_002437567.1|  hypothetical protein SORBIDRAFT_10g029480          131   4e-34   
emb|CDW88516.1|  cyclophilin b                                          130   4e-34   
ref|XP_008359381.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    134   4e-34   
ref|XP_010223091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    132   4e-34   
emb|CDX71247.1|  BnaC07g05260D                                          134   5e-34   
dbj|GAN03649.1|  peptidyl-prolyl cis-trans isomerase CYP19-4-like       130   5e-34   
ref|XP_007008975.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    131   5e-34   
ref|XP_005401022.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_009556757.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_004509164.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_010295803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   5e-34   
ref|XP_009625080.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    131   5e-34   
ref|XP_003970715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   5e-34   
ref|XP_009605568.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   5e-34   
ref|NP_001149847.1|  peptidyl-prolyl cis-trans isomerase CYP19-4 ...    130   6e-34   
ref|XP_010310553.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904                 129   6e-34   
gb|AFW69420.1|  putative peptidyl-prolyl cis-trans isomerase fami...    131   6e-34   
ref|XP_003418541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_001774773.1|  predicted protein                                  134   6e-34   
ref|XP_007071343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_007393240.1|  hypothetical protein PHACADRAFT_251820             133   6e-34   
ref|XP_010517185.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
gb|KIY53846.1|  peptidyl-prolyl cis-trans isomerase                     134   6e-34   
ref|XP_010132032.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_006694995.1|  putative cis-trans protein                         134   6e-34   
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     129   6e-34   
ref|XP_010489178.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_009981916.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_006346442.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_009585486.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_011407702.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   6e-34   
ref|XP_005593336.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_009473178.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   6e-34   
ref|XP_009281639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
ref|XP_004989528.1|  peptidyl-prolyl cis-trans isomerase                129   7e-34   
ref|XP_009409920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   7e-34   
gb|KIX79265.1|  peptidylprolyl isomerase                                129   7e-34   
ref|XP_009921882.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
gb|EMP24944.1|  Peptidyl-prolyl cis-trans isomerase D                   134   7e-34   
gb|EMC84766.1|  40 kDa peptidyl-prolyl cis-trans isomerase              134   7e-34   
ref|XP_010467327.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
ref|XP_009323466.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232              129   7e-34   
ref|XP_011092737.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   7e-34   
gb|AGM32232.1|  cytosolic cyclophilin                                   129   7e-34   
ref|XP_011092738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   8e-34   
emb|CDQ63777.1|  unnamed protein product                                134   8e-34   
ref|XP_009964979.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   8e-34   
ref|XP_004230798.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   8e-34   
ref|XP_009071351.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   8e-34   
ref|XP_001903954.1|  hypothetical protein                               134   8e-34   
emb|CBW52773.1|  peptidyl-prolyl cis-trans isomerase                    130   8e-34   
ref|XP_010009142.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   8e-34   
ref|NP_001048194.1|  Os02g0761100                                       134   8e-34   
gb|ACO07673.1|  40 kDa peptidyl-prolyl cis-trans isomerase              134   8e-34   
ref|XP_010154743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   8e-34   
ref|XP_007155953.1|  hypothetical protein PHAVU_003G246400g             134   9e-34   
ref|XP_003664466.1|  hypothetical protein MYCTH_2307319                 134   9e-34   
ref|XP_006297983.1|  hypothetical protein CARUB_v10014032mg             134   9e-34   
ref|XP_010074193.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   9e-34   
ref|XP_001322019.1|  cytosolic cyclophilin                              129   9e-34   
ref|XP_009994295.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   9e-34   
emb|CDP09190.1|  unnamed protein product                                130   9e-34   
ref|XP_003139210.1|  cyclophilin Ovcyp-2                                129   9e-34   
ref|XP_001083759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   1e-33   
ref|XP_010202535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_003650848.1|  hypothetical protein THITE_2094562                 134   1e-33   
ref|XP_009951742.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_009819727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_003295671.1|  hypothetical protein PTT_02276                     129   1e-33   
gb|KDO66887.1|  hypothetical protein CISIN_1g028574mg                   130   1e-33   
ref|XP_006488528.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   1e-33   
ref|XP_006338848.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   1e-33   
ref|XP_005845180.1|  hypothetical protein CHLNCDRAFT_26227              129   1e-33   
ref|XP_004240942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   1e-33   
gb|KDP38235.1|  hypothetical protein JCGZ_04878                         133   1e-33   
gb|EJK61387.1|  hypothetical protein THAOC_18140                        127   1e-33   
ref|XP_002054499.1|  GJ22774                                            137   1e-33   
ref|XP_009049213.1|  hypothetical protein LOTGIDRAFT_112989             133   1e-33   
gb|KJB17878.1|  hypothetical protein B456_003G021400                    133   1e-33   
ref|XP_002734227.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_007845898.1|  peptidyl-prolyl cis-trans isomerase                133   1e-33   
gb|KIW08816.1|  hypothetical protein PV09_00747                         133   1e-33   
ref|XP_006425067.1|  hypothetical protein CICLE_v10029291mg             129   1e-33   
ref|XP_005507918.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_009698128.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   1e-33   
gb|KDO49144.1|  hypothetical protein CISIN_1g018089mg                   132   1e-33   
ref|XP_011427426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   1e-33   
gb|KJB32423.1|  hypothetical protein B456_005G240200                    133   1e-33   
ref|NP_565381.1|  peptidyl-prolyl cis-trans isomerase CYP40             133   1e-33   
ref|XP_009892075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_004606206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_007229920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
gb|KJB32427.1|  hypothetical protein B456_005G240200                    133   1e-33   
ref|XP_009499704.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   1e-33   
ref|XP_532704.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    133   1e-33   
ref|XP_005985804.1|  PREDICTED: LOW QUALITY PROTEIN: peptidylprol...    133   1e-33   
ref|XP_007047186.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...    131   1e-33   
ref|XP_004337098.1|  cyclophylin, putative                              128   1e-33   
gb|EPS66571.1|  peptidyl-prolyl cis-trans isomerase                     129   1e-33   
ref|XP_006423069.1|  hypothetical protein CICLE_v10028706mg             133   1e-33   
gb|EWM25247.1|  hypothetical protein Naga_100571g1                      131   2e-33   
ref|XP_005438706.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    133   2e-33   



>ref|XP_009618666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana tomentosiformis]
Length=799

 Score =   234 bits (597),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH IVKGS+AQAGDLLR+DGN+GESIYGGKFPDE+PKLKHD+ GLLSMAIADRD RGS
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDGNYGESIYGGKFPDEVPKLKHDAQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>ref|XP_009618667.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana tomentosiformis]
Length=797

 Score =   234 bits (597),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH IVKGS+AQAGDLLR+DGN+GESIYGGKFPDE+PKLKHD+ GLLSMAIADRD RGS
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDGNYGESIYGGKFPDEVPKLKHDAQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>ref|XP_009783532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana sylvestris]
Length=799

 Score =   233 bits (594),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH IVKGS+AQAGDLLR+DGN+GESIYGGKFPDE+PKLKHD+ GLLSMAIADRD RGS
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDGNYGESIYGGKFPDEVPKLKHDAQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>ref|XP_009783537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana sylvestris]
Length=797

 Score =   233 bits (593),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH IVKGS+AQAGDLLR+DGN+GESIYGGKFPDE+PKLKHD+ GLLSMAIADRD RGS
Sbjct  61   TFFHRIVKGSVAQAGDLLRQDGNYGESIYGGKFPDEVPKLKHDAQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>ref|XP_011084184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084337.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
Length=784

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            K++KKKVLVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KINKKKVLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSLKTGKPLHYK  62

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG +AQ GD LR+DGN+GESIYGGKFPDE PKLKHD  GLLSMAIADRD RG
Sbjct  63   GTFFHRIIKGYVAQGGDFLRQDGNYGESIYGGKFPDESPKLKHDGAGLLSMAIADRDERG  122

Query  529  SLFMVTFNALHHL  567
            SLF +TF A HHL
Sbjct  123  SLFNITFKADHHL  135



>ref|XP_006364269.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Solanum tuberosum]
Length=807

 Score =   230 bits (587),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK  VFLDV IDGDP ER+ FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERLAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFHHI+KGS+AQAGDLLR+DGN+GESIYGGKFPDE PK+KHDS GLLSMAIADRD RGS
Sbjct  61   TFFHHIIKGSVAQAGDLLRQDGNYGESIYGGKFPDESPKIKHDSQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>ref|XP_004245196.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Solanum lycopersicum]
Length=807

 Score =   229 bits (583),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 109/132 (83%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSKKK  VFLDV IDGDP ERM FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERMAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH IVKGS+AQAGD+LR+DGN+GESIYGGKFPDE PK+KHDS GLLSMAIADRD RGS
Sbjct  61   TFFHRIVKGSVAQAGDMLRQDGNYGESIYGGKFPDESPKIKHDSQGLLSMAIADRDARGS  120

Query  532  LFMVTFNALHHL  567
            +F +TF A HHL
Sbjct  121  IFSITFQADHHL  132



>gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Erythranthe guttata]
Length=709

 Score =   223 bits (568),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            K++K+K+LVFLDV +DGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KVNKRKLLVFLDVSVDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSVKTGKPLHYK  62

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG +AQ GD LR+DG  GE+IYGGKFPDE PKL+H+ PGLLSMAIADRD RG
Sbjct  63   GTFFHRIIKGYLAQGGDFLRQDGTCGENIYGGKFPDEYPKLRHNGPGLLSMAIADRDQRG  122

Query  529  SLFMVTFNALHHL  567
            SLF +TF+A HHL
Sbjct  123  SLFSITFDAEHHL  135



>emb|CBI21007.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGSM Q GD LR DG+ GESIYGGKFPDE P+LKHD PGLLSM++ADRD  GS F
Sbjct  64   FHRIIKGSMVQGGDFLRRDGSGGESIYGGKFPDESPRLKHDGPGLLSMSVADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            +VTF+A HHL
Sbjct  124  IVTFSANHHL  133



>emb|CDP04788.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   221 bits (564),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 105/132 (80%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MSK+K LVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGE+G S +    LHYKG
Sbjct  1    MSKQKPLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEEGESSRAKRPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            TFFH I+KGS A+AGDLLR DGN+GESIYG KFPDE PKLKHD PGLLSMAIADRD RGS
Sbjct  61   TFFHRIIKGSWAKAGDLLRRDGNYGESIYGDKFPDEPPKLKHDGPGLLSMAIADRDERGS  120

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  121  QFILTFKADHHL  132



>ref|XP_004164532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like, partial 
[Cucumis sativus]
Length=296

 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+ GSMAQ GD ++ DG  GESIYGGKFPDELP+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRIIGGSMAQGGDFVKRDGTVGESIYGGKFPDELPRLKHDGPGLLSMAIADRDTLGSHF  123

Query  538  MVTFNALHHL  567
            ++TF A +HL
Sbjct  124  LITFKANNHL  133



>ref|XP_011019778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Populus euphratica]
Length=805

 Score =   219 bits (558),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKHD PGLLSM+IADRD  G
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKHDEPGLLSMSIADRDALG  123

Query  529  SLFMVTFNALHHL  567
            S F++TF A HHL
Sbjct  124  SQFIITFRANHHL  136



>ref|XP_011019781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X6 [Populus euphratica]
Length=810

 Score =   219 bits (557),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKHD PGLLSM+IADRD  G
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKHDEPGLLSMSIADRDALG  123

Query  529  SLFMVTFNALHHL  567
            S F++TF A HHL
Sbjct  124  SQFIITFRANHHL  136



>ref|XP_011019777.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Populus euphratica]
Length=811

 Score =   219 bits (557),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKHD PGLLSM+IADRD  G
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKHDEPGLLSMSIADRDALG  123

Query  529  SLFMVTFNALHHL  567
            S F++TF A HHL
Sbjct  124  SQFIITFRANHHL  136



>ref|XP_011019776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=815

 Score =   219 bits (557),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKHD PGLLSM+IADRD  G
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKHDEPGLLSMSIADRDALG  123

Query  529  SLFMVTFNALHHL  567
            S F++TF A HHL
Sbjct  124  SQFIITFRANHHL  136



>ref|XP_011019775.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=816

 Score =   219 bits (557),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKHD PGLLSM+IADRD  G
Sbjct  64   GSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKHDEPGLLSMSIADRDALG  123

Query  529  SLFMVTFNALHHL  567
            S F++TF A HHL
Sbjct  124  SQFIITFRANHHL  136



>gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=719

 Score =   217 bits (553),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 104/133 (78%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            KMSK+K LVF DV +DGDP ERMVFELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  4    KMSKRKPLVFFDVSVDGDPLERMVFELFTDVAPRTAENFRALCTGEKGASLKTGRPLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG +AQ GD LR DG  GESIYGGKFP+E PKLKHDSPGLLSMAIADR  RG
Sbjct  64   GTFFHRIIKGYVAQGGDFLRRDGKHGESIYGGKFPEESPKLKHDSPGLLSMAIADRGERG  123

Query  529  SLFMVTFNALHHL  567
            SLF +TF A H+L
Sbjct  124  SLFSITFEADHNL  136



>ref|XP_002285000.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
 ref|XP_010648637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
Length=796

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSM Q GD LR DG+ GESIYGGKFPDE P+LKHD PGLLSM++ADRD  G
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDGSGGESIYGGKFPDESPRLKHDGPGLLSMSVADRDTVG  120

Query  529  SLFMVTFNALHHL  567
            S F+VTF+A HHL
Sbjct  121  SQFIVTFSANHHL  133



>ref|XP_011026475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=794

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 100/130 (77%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGSMAQ GD+L+ DG FGESIYG KFPDE PKLKHD PGLLSM+IADRD  GS F
Sbjct  68   FHRIVKGSMAQGGDILKRDGTFGESIYGDKFPDESPKLKHDGPGLLSMSIADRDTLGSQF  127

Query  538  MVTFNALHHL  567
            +VTF A HHL
Sbjct  128  IVTFRANHHL  137



>ref|XP_011026473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
 ref|XP_011026474.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=795

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 100/130 (77%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGSMAQ GD+L+ DG FGESIYG KFPDE PKLKHD PGLLSM+IADRD  GS F
Sbjct  68   FHRIVKGSMAQGGDILKRDGTFGESIYGDKFPDESPKLKHDGPGLLSMSIADRDTLGSQF  127

Query  538  MVTFNALHHL  567
            +VTF A HHL
Sbjct  128  IVTFRANHHL  137



>ref|XP_010648638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Vitis vinifera]
Length=795

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSM Q GD LR DG+ GESIYGGKFPDE P+LKHD PGLLSM++ADRD  G
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDGSGGESIYGGKFPDESPRLKHDGPGLLSMSVADRDTVG  120

Query  529  SLFMVTFNALHHL  567
            S F+VTF+A HHL
Sbjct  121  SQFIVTFSANHHL  133



>ref|XP_002324283.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
 gb|EEF02848.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
Length=819

 Score =   217 bits (553),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 101/130 (78%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DVCIDGDP ERMVFELF+D+APKTAENFRALCTGEKG  PK+   LHYKG+F
Sbjct  8    KKNPLVFMDVCIDGDPKERMVFELFSDIAPKTAENFRALCTGEKGIGPKSERPLHYKGSF  67

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGSMAQ GD+L+ DG FGESIYG KFPDE PKLKHD PGLLSM+IADRD  GS F
Sbjct  68   FHRIVKGSMAQGGDILKRDGTFGESIYGDKFPDESPKLKHDGPGLLSMSIADRDALGSQF  127

Query  538  MVTFNALHHL  567
            +VTF A HHL
Sbjct  128  IVTFRANHHL  137



>emb|CAN80313.1| hypothetical protein VITISV_020758 [Vitis vinifera]
Length=728

 Score =   214 bits (546),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 102/133 (77%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGSM Q GD LR DG+ GESIYGGKFPDE P+LKHD PGLLSM++ADRD  G
Sbjct  61   GSFFHRIIKGSMVQGGDFLRRDGSGGESIYGGKFPDESPRLKHDGPGLLSMSVADRDTVG  120

Query  529  SLFMVTFNALHHL  567
            S F+VTF+A HHL
Sbjct  121  SQFIVTFSANHHL  133



>gb|KGN62922.1| hypothetical protein Csa_2G380020 [Cucumis sativus]
Length=784

 Score =   213 bits (542),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 101/133 (76%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+ GSMAQ GD ++ DG  GESIYGGKFPDELP+LKHD PGLLSMAIADRD  G
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTVGESIYGGKFPDELPRLKHDGPGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF A +HL
Sbjct  121  SHFLITFKANNHL  133



>ref|XP_004138866.1| PREDICTED: uncharacterized protein LOC101210345 [Cucumis sativus]
Length=774

 Score =   213 bits (542),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 101/133 (76%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+ GSMAQ GD ++ DG  GESIYGGKFPDELP+LKHD PGLLSMAIADRD  G
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTVGESIYGGKFPDELPRLKHDGPGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF A +HL
Sbjct  121  SHFLITFKANNHL  133



>ref|XP_011081940.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP95-like [Sesamum indicum]
Length=754

 Score =   212 bits (540),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 103/129 (80%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            K   KK LVFLDV IDGDP ERM+FELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KTKGKKQLVFLDVSIDGDPVERMIFELFTDVAPRTAENFRALCTGEKGVSAKTGKPLHYK  62

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I KG +AQ GD LR+DGN+GESIY GKFPDE PKLKHD PGLLSMAIADRD RG
Sbjct  63   GTFFHRIEKGHLAQGGDFLRQDGNYGESIYDGKFPDESPKLKHDGPGLLSMAIADRDERG  122

Query  529  SLFMVTFNA  555
            SLF VTF A
Sbjct  123  SLFSVTFKA  131



>ref|XP_008445168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
 ref|XP_008445170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
Length=779

 Score =   213 bits (541),  Expect = 9e-61, Method: Composition-based stats.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPRERMVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+ GSMAQ GD ++ DG  GESIYGGKFPDELP+LKHD PGLLSMAIADRD  G
Sbjct  61   GSFFHRIIGGSMAQGGDFVKRDGTVGESIYGGKFPDELPRLKHDGPGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF A +HL
Sbjct  121  SHFLITFKANNHL  133



>gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=702

 Score =   209 bits (532),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  VITFKANHDL  133



>ref|XP_006382072.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
 gb|ERP59869.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
Length=842

 Score =   210 bits (535),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 101/150 (67%), Positives = 112/150 (75%), Gaps = 17/150 (11%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFE-----------------LFTDVAPKTAENFRALC  297
            KM+KK  LVF+DVCIDGDP ERMVFE                 LF D+APKT ENFRALC
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFEVSSCFKFQPCRMDDEIPLFLDIAPKTVENFRALC  63

Query  298  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKH  477
            TGEKG  PK+   LHYKG+FFH I+KGSMAQ GD+L+ DG FGESIYGGKFPDE PKLKH
Sbjct  64   TGEKGIGPKSQRPLHYKGSFFHRIIKGSMAQGGDILKRDGTFGESIYGGKFPDESPKLKH  123

Query  478  DSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            D PGLLSM+IADRD  GS F++TF A HHL
Sbjct  124  DEPGLLSMSIADRDALGSQFIITFRANHHL  153



>ref|XP_007013817.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 ref|XP_007013819.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
Length=843

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMAQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVIKGSMAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H+L
Sbjct  124  IITFKANHNL  133



>ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
Length=858

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/130 (73%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  19   KKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  78

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMAQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  79   FHRVIKGSMAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  138

Query  538  MVTFNALHHL  567
            ++TF A H+L
Sbjct  139  IITFKANHNL  148



>ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=729

 Score =   208 bits (529),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 1/134 (1%)
 Frame = +1

Query  169  KMSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  345
            +M+K+K  +VF+DV IDGDPFERMVFELF + APKT ENFRALCTGEKG  PKTG  LHY
Sbjct  4    EMAKRKNPMVFMDVSIDGDPFERMVFELFPEFAPKTVENFRALCTGEKGIGPKTGRPLHY  63

Query  346  KGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIR  525
            KG+FFH I+KGSMAQ GD ++ DG  GESIYGGKFPDE P+LKHDSPGLL+MA+ADRD  
Sbjct  64   KGSFFHCIIKGSMAQGGDFVKRDGTGGESIYGGKFPDESPRLKHDSPGLLTMAVADRDTL  123

Query  526  GSLFMVTFNALHHL  567
            GS F++TF A HHL
Sbjct  124  GSQFIITFKANHHL  137



>gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=722

 Score =   208 bits (529),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  VITFKANHDL  133



>gb|KJB07776.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07777.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07787.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07788.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=801

 Score =   207 bits (528),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  VITFKANHDL  133



>gb|KJB07775.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07778.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07785.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=799

 Score =   207 bits (528),  Expect = 6e-59, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  VITFKANHDL  133



>ref|XP_006450486.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=792

 Score =   207 bits (527),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMA+ GD ++ DG  GESIY GKFPDE P+LKHD PGLLSM+IADRD  GS F
Sbjct  64   FHRVIKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  IITFKANHSL  133



>ref|XP_006450487.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 ref|XP_006450488.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=801

 Score =   207 bits (527),  Expect = 8e-59, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMA+ GD ++ DG  GESIY GKFPDE P+LKHD PGLLSM+IADRD  GS F
Sbjct  64   FHRVIKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  IITFKANHSL  133



>ref|XP_006483322.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Citrus sinensis]
Length=792

 Score =   207 bits (526),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMA+ GD ++ DG  GESIY GKFPDE P+LKHD PGLLSM+IADRD  GS F
Sbjct  64   FHRVIKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  IITFKANHSL  133



>ref|XP_006483320.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483321.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
Length=801

 Score =   206 bits (525),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGSMA+ GD ++ DG  GESIY GKFPDE P+LKHD PGLLSM+IADRD  GS F
Sbjct  64   FHRVIKGSMAEGGDFVKRDGTSGESIYEGKFPDESPRLKHDRPGLLSMSIADRDTLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  IITFKANHSL  133



>ref|XP_003523694.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006578153.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=843

 Score =   206 bits (524),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ Q GD +  +G  GESIYG KFPDE PKLKHD+ GLLSMAIADRD  G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNGTAGESIYGSKFPDESPKLKHDATGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  121  SHFIITLKADHHL  133



>gb|KHN08115.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=805

 Score =   205 bits (522),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ Q GD +  +G  GESIYG KFPDE PKLKHD+ GLLSMAIADRD  G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNGTAGESIYGSKFPDESPKLKHDATGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  121  SHFIITLKADHHL  133



>gb|KDP33623.1| hypothetical protein JCGZ_07194 [Jatropha curcas]
Length=789

 Score =   205 bits (522),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 96/130 (74%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDPFERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFIDVSIDGDPFERMVFELFYDIAPKTAENFRALCTGEKGIGPKTGRPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++GSMAQ GD ++ DG  GESIYG KFPDE  +LKHDSPGLLSM IADR+  GS F
Sbjct  64   FHCIIRGSMAQGGDFVKRDGTGGESIYGDKFPDETSRLKHDSPGLLSMPIADRETLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A HHL
Sbjct  124  IITFKANHHL  133



>ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=765

 Score =   205 bits (521),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 98/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            K+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGSMAQ GDLLR++G+ GESI+G +FPDE PKLKHD  GLLSM+IADRDIRGSLF
Sbjct  64   FHRIVKGSMAQGGDLLRQEGSAGESIFGDRFPDESPKLKHDERGLLSMSIADRDIRGSLF  123

Query  538  MVTFNALHHL  567
             + F A  +L
Sbjct  124  NLMFKANQNL  133



>ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   205 bits (521),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 98/130 (75%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            K+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGSMAQ GDLLR++G+ GESI+G +FPDE PKLKHD  GLLSM+IADRDIRGSLF
Sbjct  64   FHRIVKGSMAQGGDLLRQEGSAGESIFGDRFPDESPKLKHDERGLLSMSIADRDIRGSLF  123

Query  538  MVTFNALHHL  567
             + F A  +L
Sbjct  124  NLMFKANQNL  133



>ref|XP_003526420.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006581364.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=850

 Score =   205 bits (521),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 96/133 (72%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ Q GD +  +G  GESIYG KFPDE P+LKHD+ GLLSMAIADRD  G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNGTAGESIYGSKFPDESPRLKHDATGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  121  SHFIITLKADHHL  133



>gb|KHG30308.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=196

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 103/130 (79%), Gaps = 3/130 (2%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERM   LF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERM---LFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  60

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  61   FHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  120

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  121  VITFKANHDL  130



>ref|XP_006581365.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=837

 Score =   204 bits (520),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 96/133 (72%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ Q GD +  +G  GESIYG KFPDE P+LKHD+ GLLSMAIADRD  G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNGTAGESIYGSKFPDESPRLKHDATGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  121  SHFIITLKADHHL  133



>gb|KHN07093.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=824

 Score =   204 bits (520),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 96/133 (72%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ Q GD +  +G  GESIYG KFPDE P+LKHD+ GLLSMAIADRD  G
Sbjct  61   GSFFHQIIKGSIVQGGDFVNRNGTAGESIYGSKFPDESPRLKHDATGLLSMAIADRDTLG  120

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  121  SHFIITLKADHHL  133



>gb|KCW80439.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=614

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>gb|KCW80440.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80441.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=695

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>ref|XP_004501305.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   203 bits (516),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/133 (72%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVF+DV IDGDP E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  4    MSKKKNPLVFMDVSIDGDPVEKMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH ++KGS+ + GD +  +G  GESIYG KFPDE PKLKHD PGLLSMAIADRD+ G
Sbjct  64   GSFFHQVIKGSIVKGGDFVNRNGTDGESIYGSKFPDESPKLKHDGPGLLSMAIADRDMLG  123

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  124  SHFIITLKADHHL  136



>gb|KJB07770.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07771.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07772.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07773.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
Length=787

 Score =   203 bits (516),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF D+APKT ENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPVERMVFELFPDIAPKTVENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH + KGS+A+ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD  GS F
Sbjct  64   FHRVSKGSLAKGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRDTVGSQF  123

Query  538  MVTFNALHHL  567
            ++TF A H L
Sbjct  124  VITFKANHDL  133



>gb|EPS68763.1| hypothetical protein M569_06004, partial [Genlisea aurea]
Length=756

 Score =   201 bits (511),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 97/140 (69%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            K+ KK+V VF DV +DGDP+ERM+FELF DVAPKTAENFRALCTGEKGTS  TG  LHYK
Sbjct  3    KIKKKRVSVFFDVSVDGDPYERMIFELFADVAPKTAENFRALCTGEKGTSVTTGKPLHYK  62

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFP-------DELPKLKHDSPGLLSMAI  507
            GTFFH I+KG + Q GDLLR+DG +GESIY G FP       +E  KLKHD PGLLSMAI
Sbjct  63   GTFFHRIIKGYVVQGGDLLRQDGKYGESIYAGNFPGKKLLPLNESAKLKHDGPGLLSMAI  122

Query  508  ADRDIRGSLFMVTFNALHHL  567
            ADRD RGS+F +T  A HHL
Sbjct  123  ADRDERGSIFSITLKADHHL  142



>ref|XP_007161230.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
 gb|ESW33224.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
Length=933

 Score =   202 bits (513),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 93/130 (72%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYKG+F
Sbjct  4    KKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPNTGKSLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGS+A+ GD +  +G  GESIYG KFPDE P+LKHD+PGLLSM +ADRD  GS F
Sbjct  64   FHRIVKGSIARGGDFVNRNGTGGESIYGSKFPDESPRLKHDAPGLLSMPVADRDTLGSHF  123

Query  538  MVTFNALHHL  567
            M+TF A  HL
Sbjct  124  MITFKADPHL  133



>gb|KJB07786.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=807

 Score =   201 bits (511),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 96/136 (71%), Positives = 106/136 (78%), Gaps = 6/136 (4%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFE------LFTDVAPKTAENFRALCTGEKGTSPKTGATL  339
            KK  LVF+DV IDGDP ERMVFE      LF D+APKTAENFRALCTGEKG  PKTG  L
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFEFSLILQLFPDIAPKTAENFRALCTGEKGIGPKTGKPL  63

Query  340  HYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRD  519
            HYKG+FFH ++KGS+AQ GD +R DG  GESIY GKFPDE P+LKHD PGLLSMAIADRD
Sbjct  64   HYKGSFFHRVMKGSLAQGGDFVRRDGTSGESIYDGKFPDESPRLKHDGPGLLSMAIADRD  123

Query  520  IRGSLFMVTFNALHHL  567
              GS F++TF A H L
Sbjct  124  TVGSQFVITFKANHDL  139



>ref|XP_007161232.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
 gb|ESW33226.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
Length=895

 Score =   201 bits (511),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNCLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPSTGKSLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH IVKGS+A+ GD +  +G  GESIYG KFPDE P+LKHD+PGLLSM +ADRD  G
Sbjct  61   GSFFHRIVKGSIARGGDFVNRNGTGGESIYGSKFPDESPRLKHDAPGLLSMPVADRDSLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF +  HL
Sbjct  121  SHFIITFKSDPHL  133



>ref|XP_010048238.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Eucalyptus grandis]
Length=794

 Score =   200 bits (509),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>ref|XP_010048237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Eucalyptus grandis]
 gb|KCW80434.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80435.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=796

 Score =   200 bits (509),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>ref|XP_010048236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Eucalyptus grandis]
Length=797

 Score =   200 bits (508),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>ref|XP_010048233.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048235.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 gb|KCW80436.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=799

 Score =   200 bits (508),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            +FFH I++GSMAQ GD  + DG  GESIYG KFPDE P+LKHD PGLLSM +ADRD  GS
Sbjct  62   SFFHRIIRGSMAQGGDFHKRDGTSGESIYGEKFPDESPRLKHDGPGLLSMLVADRDALGS  121

Query  532  LFMVTFNALHHL  567
             F++TF A HHL
Sbjct  122  HFLITFKADHHL  133



>ref|XP_007161231.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
 gb|ESW33225.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
Length=915

 Score =   198 bits (503),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE G SP TG +LHYKG+F
Sbjct  4    KKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGESGVSPNTGKSLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH +VKGS+A+ GD +  +G  GESIYG KFPDE P+LKHD+PGLLSM +A RD  GS F
Sbjct  64   FHRVVKGSIARGGDFVNRNGTGGESIYGSKFPDESPRLKHDAPGLLSMPVAVRDTLGSHF  123

Query  538  MVTFNALHHL  567
            ++TF A  HL
Sbjct  124  IITFKADPHL  133



>gb|AES58972.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=772

 Score =   197 bits (501),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VF+DV +DGDP+E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYKG+F
Sbjct  4    KKNSMVFMDVSVDGDPYEKMVFELFYDVAPKTAENFRALCTGEKGVSPNTGKSLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS+ + GD +  +G  GESIY  KFPDE P+LKHDSPGLLSMAIADRD  GS F
Sbjct  64   FHQILKGSIVKGGDFINRNGTGGESIY-PKFPDESPRLKHDSPGLLSMAIADRDTLGSHF  122

Query  538  MVTFNALHHL  567
            ++T  A HHL
Sbjct  123  IITLKADHHL  132



>gb|AES73684.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=895

 Score =   196 bits (498),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV IDGDP +RMVFELF DVAPKTAENFRALCTGE+G S  TG  LHYK
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGERGISSNTGKLLHYK  63

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KGS+ + GD +  +G  GESIYG  FPDE P+LKHD PGLLSMAIADRD  G
Sbjct  64   GSFFHQIMKGSIVKGGDFVNRNGTGGESIYGSNFPDESPRLKHDGPGLLSMAIADRDKLG  123

Query  529  SLFMVTFNALHHL  567
            S F++T  A HHL
Sbjct  124  SHFIITLKADHHL  136



>ref|XP_004498656.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498657.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=773

 Score =   190 bits (483),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 92/130 (71%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG S  TG +LHYKG+F
Sbjct  4    KKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGEKGVSSNTGKSLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKGS+ + GD +  +G  GESIY  KFPDE P+LKHDSPGLL MA+ADRD  GS F
Sbjct  64   FHQIVKGSIVRGGDFINRNGTGGESIY-PKFPDESPRLKHDSPGLLFMAVADRDTLGSHF  122

Query  538  MVTFNALHHL  567
             +T  A HHL
Sbjct  123  KITLKADHHL  132



>ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus 
domestica]
Length=835

 Score =   190 bits (483),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 89/129 (69%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLG  120

Query  529  SLFMVTFNA  555
            S F +TF A
Sbjct  121  SHFNITFAA  129



>ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus 
domestica]
Length=856

 Score =   190 bits (483),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 89/129 (69%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLG  120

Query  529  SLFMVTFNA  555
            S F +TF A
Sbjct  121  SHFNITFAA  129



>ref|XP_008219899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
 ref|XP_008219900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=843

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAP+TAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPRTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PG+LSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFIKRDGTAGESIYGEKFPDESPVLKHSGPGILSMPVAVRDSLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF A H+L
Sbjct  121  SHFIITFAANHNL  133



>ref|XP_007225294.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
 gb|EMJ26493.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
Length=854

 Score =   190 bits (483),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 91/133 (68%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPKTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PG+LSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFIKRDGTAGESIYGEKFPDESPVLKHSGPGVLSMPVAVRDSLG  120

Query  529  SLFMVTFNALHHL  567
            S F++TF A H+L
Sbjct  121  SHFIITFAANHNL  133



>ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus 
x bretschneideri]
Length=1043

 Score =   191 bits (484),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 88/129 (68%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM++ADRD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDGTGGESIYGEKFPDESPVLKHSGPGLLSMSVADRDSLG  120

Query  529  SLFMVTFNA  555
            S F +TF A
Sbjct  121  SHFNITFAA  129



>emb|CDX75243.1| BnaA01g04590D [Brassica napus]
Length=765

 Score =   187 bits (475),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+HD  GLLSM +A+RD  GS F
Sbjct  64   FHRILKGSSAQAGDFVSRDGTAGESIYAGKFPDESPKLRHDERGLLSMDVAERDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF   H L
Sbjct  124  HITFRPNHQL  133



>ref|XP_010110347.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
 gb|EXC26034.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
Length=860

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 9/139 (6%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFEL---------FTDVAPKTAENFRALCTGEKGTSPKTG  330
            +K  +VF+DV IDGDP E+MVFEL         F D+APKTAENFRALCTGEKG  P++G
Sbjct  4    RKNSMVFMDVSIDGDPAEKMVFELIDYSFTQQLFFDIAPKTAENFRALCTGEKGIGPQSG  63

Query  331  ATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIA  510
              LHYKG+FFH I+KG MAQ GD ++ DG  GESIYGGKFPDE  +LKHD PGLLSM +A
Sbjct  64   RPLHYKGSFFHRIIKGFMAQGGDFVKRDGTGGESIYGGKFPDESSRLKHDEPGLLSMPLA  123

Query  511  DRDIRGSLFMVTFNALHHL  567
            DRD  GS F+VTF A H L
Sbjct  124  DRDSLGSHFIVTFAANHSL  142



>ref|XP_008378303.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=517

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKG  AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  GS F
Sbjct  64   FHRIVKGYNAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLGSHF  123

Query  538  MVTFNALHHL  567
             +TF A  +L
Sbjct  124  NITFAANRNL  133



>emb|CDX68845.1| BnaC01g06080D [Brassica napus]
Length=765

 Score =   186 bits (473),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+HD  GLLSM +A+RD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTGGESIYAGKFPDESPKLRHDERGLLSMDVAERDKLGSHF  123

Query  538  MVTFNALHHL  567
             +TF   H L
Sbjct  124  HITFRPNHQL  133



>ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Pyrus x bretschneideri]
Length=846

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLG  120

Query  529  SLFMVTFNA  555
            S F +TF A
Sbjct  121  SHFNITFAA  129



>ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Pyrus x bretschneideri]
Length=854

 Score =   187 bits (474),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 87/129 (67%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG +AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  G
Sbjct  61   GSFFHRIIKGYIAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLG  120

Query  529  SLFMVTFNA  555
            S F +TF A
Sbjct  121  SHFNITFAA  129



>ref|XP_009126010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
 ref|XP_009126018.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
Length=760

 Score =   186 bits (472),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+HD  GLLSM +A+RD  GS F
Sbjct  64   FHRILKGSSAQAGDFVSRDGTAGESIYAGKFPDESPKLRHDERGLLSMDVAERDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF   H L
Sbjct  124  HITFRPNHQL  133



>ref|XP_010447392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=822

 Score =   186 bits (472),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/130 (68%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKLKHD PGLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLKHDEPGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HLTFRPNQQL  133



>ref|XP_010447391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=824

 Score =   186 bits (472),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/130 (68%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKLKHD PGLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLKHDEPGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HLTFRPNQQL  133



>ref|XP_002867244.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43503.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   185 bits (470),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++GS AQAGD +  DG  GESIY GKFPDE PKL+H+ PGLLSM++ADRD  GS F
Sbjct  64   FHRILQGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHEEPGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score =   184 bits (468),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAP TA+NFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPNTADNFRALCTGEKGVGLRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGSMAQAGD +  DG  GESI+ GKFPDELPKL+HD PGLLSM++ +RD  GS F
Sbjct  64   FHKIIKGSMAQAGDFVNRDGTAGESIFAGKFPDELPKLRHDEPGLLSMSVDERDKLGSQF  123

Query  538  MVTFNALHHL  567
            ++TF   H L
Sbjct  124  IITFKPNHQL  133



>ref|XP_006412476.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
 gb|ESQ53929.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
Length=810

 Score =   184 bits (466),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   V++DVCIDGDP E MVFELF +VAPKT+ENFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGLRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVKG  AQAGD +  DG  GESIY GKFPDE PKL+H+ PGLLSMA+++RD  GS F
Sbjct  64   FHRIVKGYSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHEEPGLLSMAVSERDKLGSHF  123

Query  538  MVTFNALHHL  567
             +TF   H L
Sbjct  124  HITFRPNHQL  133



>ref|XP_008378304.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like isoform 
X2 [Malus domestica]
Length=826

 Score =   183 bits (465),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH IVKG  AQ GD ++ DG  GESIYG KFPDE P LKH  PGLLSM +A RD  G
Sbjct  61   GSFFHRIVKGYNAQGGDFVKRDGTAGESIYGEKFPDESPVLKHSGPGLLSMPVAVRDSLG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF A  +L
Sbjct  121  SHFNITFAANRNL  133



>ref|NP_194968.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190889.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8RWY7.2|CYP95_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP95; Short=AtCYP95; 
Short=PPIase CYP95; AltName: Full=Cyclophilin-like 
protein CypRS92 [Arabidopsis thaliana]
 gb|AEE86054.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AEE86057.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=837

 Score =   183 bits (464),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  +G  GESIY GKFPDE PKL+H+  GLLSM+IADRD  GS F
Sbjct  64   FHRIMKGSSAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|NP_001190888.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86056.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=820

 Score =   182 bits (462),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  +G  GESIY GKFPDE PKL+H+  GLLSM+IADRD  GS F
Sbjct  64   FHRIMKGSSAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|XP_004291478.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011459211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=761

 Score =   181 bits (459),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVF+D+CIDGDP E+MVFELF D APKTA+NFRALCTGEKG  PK+G  LHYKG+F
Sbjct  4    KKNPLVFMDLCIDGDPAEKMVFELFYDRAPKTADNFRALCTGEKGIGPKSGRPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYG-GKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
            FH I+KG  A+ GD ++ DG  GESIY   +FPDE PKLKH+ PGLLSM +A RD  GS 
Sbjct  64   FHRILKGYYAKGGDFVKRDGTGGESIYSEEEFPDESPKLKHNEPGLLSMPVALRDSLGSQ  123

Query  535  FMVTFNALHHL  567
            F++TF A H L
Sbjct  124  FIITFEANHSL  134



>ref|XP_010432722.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=825

 Score =   181 bits (460),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+HD  GLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHDEAGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|XP_010432723.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Camelina sativa]
Length=808

 Score =   181 bits (459),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+HD  GLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHDEAGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|XP_006283087.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
 gb|EOA15985.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
Length=879

 Score =   181 bits (458),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  LDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKG  378
            +DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+FFH I+KG
Sbjct  1    MDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRILKG  60

Query  379  SMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNAL  558
            S AQAGD +  DG  GESIY GKFPDE PKL+HD PGLLSM++ADRD  GS F +TF   
Sbjct  61   SSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHDEPGLLSMSVADRDKFGSHFHITFRPN  120

Query  559  HHL  567
              L
Sbjct  121  QQL  123



>ref|XP_010437912.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=806

 Score =   180 bits (456),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+H+  GLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHEEAGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HLTFRPNQQL  133



>ref|XP_010437913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=805

 Score =   180 bits (456),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  DG  GESIY GKFPDE PKL+H+  GLLSM++ADRD  GS F
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPDESPKLRHEEAGLLSMSVADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HLTFRPNQQL  133



>gb|AAM13845.1| unknown protein [Arabidopsis thaliana]
 gb|AAS75312.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=837

 Score =   179 bits (455),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++   LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSRKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KGS AQAGD +  +G  GESIY GKFPDE PKL+H+  GLLSM+IADRD  GS F
Sbjct  64   FHRIMKGSSAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFGSHF  123

Query  538  MVTFNALHHL  567
             +TF     L
Sbjct  124  HITFRPNQQL  133



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   177 bits (449),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 88/133 (66%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+K+K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I++G MAQ GD  R DG  GESIYGGKF DE  KL HD PGLLSMA A  +  G
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDGTGGESIYGGKFADESFKLNHDGPGLLSMANAGSNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF A  HL
Sbjct  121  SQFFITFKATPHL  133



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   177 bits (449),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 88/133 (66%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+K+K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I++G MAQ GD  R DG  GESIYGGKF DE  KL HD PGLLSMA A  +  G
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDGTGGESIYGGKFADESFKLNHDGPGLLSMANAGSNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF A  HL
Sbjct  121  SQFFITFKATPHL  133



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score =   176 bits (446),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K   VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG  P T   LHYKG+ F
Sbjct  5    KNPTVFLDVAIGGGPSRRMVFELFADIVPKTAENFRALCTGEKGIGPTTRKPLHYKGSIF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  + DG  GESIYGGKFPDE   L+HD PGLLSMA A RD  GS F 
Sbjct  65   HRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFLLRHDGPGLLSMANAGRDTNGSQFF  124

Query  541  VTFNALHHL  567
            +TF A  HL
Sbjct  125  ITFKAAPHL  133



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score =   175 bits (444),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K   VFLDV I   P ERMVFELF D+ PKTAENFRALCTGEKG  P TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGRGPAERMVFELFADIVPKTAENFRALCTGEKGVGPSTGKPLHYRGSIF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  + DG  GESIYGGKFPDE   L+HD PGLLSMA A RD  GS F 
Sbjct  65   HRIIKGFMAQGGDFAKRDGTGGESIYGGKFPDENFVLRHDGPGLLSMANAGRDTNGSQFF  124

Query  541  VTFNALHHL  567
            +TF A  HL
Sbjct  125  ITFKAAPHL  133



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score =   174 bits (442),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 85/129 (66%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K   VFLDV I G P ERMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGGGPAERMVFELFADIVPKTAENFRALCTGEKGVGSTTGKPLHYRGSIF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  + DG  GESIYGGKFPDE   L+HD PGLLSMA A RD  GS F 
Sbjct  65   HRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFILRHDGPGLLSMANAGRDTNGSQFF  124

Query  541  VTFNALHHL  567
            +TF A  HL
Sbjct  125  ITFKAAPHL  133



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score =   174 bits (440),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 84/129 (65%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K+  VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KRPTVFLDVAIGGRPSGRMVFELFADIVPKTAENFRALCTGEKGIGHTTGKPLHYRGSIF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  + DG  GESIYGGKFPDE   L+HD PGLLSMA A RD  GS F 
Sbjct  65   HRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFVLRHDGPGLLSMANAGRDTNGSQFF  124

Query  541  VTFNALHHL  567
            +TF A  HL
Sbjct  125  ITFKAAPHL  133



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score =   171 bits (433),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV I GDP  +MVFELF+DV PKTAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNSLVFLDVSIGGDPAGKMVFELFSDVVPKTAENFRALCTGEKGIGQVTGKPLHYKGSI  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD  R+DG  GESIYGGKF DE  KL HD PG+LSMA A  D  GS F
Sbjct  64   FHRIIKGFMAQGGDFSRKDGTGGESIYGGKFVDENFKLHHDGPGVLSMANAGPDTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF +  HL
Sbjct  124  FITFKSTGHL  133



>ref|XP_010432719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=846

 Score =   169 bits (429),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 86/151 (57%), Positives = 99/151 (66%), Gaps = 21/151 (14%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFP---------------------DELPKLK  474
            FH I+KGS AQAGD +  DG  GESIY GKFP                     DE PKL+
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPGWLPLRSLSAISFQFPHQYLRDESPKLR  123

Query  475  HDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            HD  GLLSM++ADRD  GS F +TF     L
Sbjct  124  HDEAGLLSMSVADRDKFGSHFHITFRPNQQL  154



>ref|XP_010432721.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=829

 Score =   169 bits (428),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 86/151 (57%), Positives = 99/151 (66%), Gaps = 21/151 (14%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFP---------------------DELPKLK  474
            FH I+KGS AQAGD +  DG  GESIY GKFP                     DE PKL+
Sbjct  64   FHRILKGSSAQAGDFVNRDGTAGESIYAGKFPGWLPLRSLSAISFQFPHQYLRDESPKLR  123

Query  475  HDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            HD  GLLSM++ADRD  GS F +TF     L
Sbjct  124  HDEAGLLSMSVADRDKFGSHFHITFRPNQQL  154



>ref|XP_004498655.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=812

 Score =   168 bits (426),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 92/163 (56%), Positives = 102/163 (63%), Gaps = 34/163 (21%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCT-------------------  300
            KK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCT                   
Sbjct  4    KKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGNITFDLHGTFLFLLKSVI  63

Query  301  ---GEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLR-----------EDGNFGESIY  438
               GEKG S  TG +LHYKG+FFH IVKGS+ + GD +             +G  GESIY
Sbjct  64   LHSGEKGVSSNTGKSLHYKGSFFHQIVKGSIVRGGDFINRNVLFHFHVSCHNGTGGESIY  123

Query  439  GGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
              KFPDE P+LKHDSPGLL MA+ADRD  GS F +T  A HHL
Sbjct  124  -PKFPDESPRLKHDSPGLLFMAVADRDTLGSHFKITLKADHHL  165



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+F H I+KG MAQ GD  + +G  GESIYGGK  DE  KL HD PG+LSMA +  +  G
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNGTGGESIYGGKLVDENFKLAHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score =   167 bits (424),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 82/132 (62%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            M+K+  +VFLDV IDG+   R++FELF D+ PKTAENFRALCTGE G  P T   LHYKG
Sbjct  1    MAKRNPIVFLDVAIDGNAAGRLMFELFADIVPKTAENFRALCTGEMGFGPMTKKPLHYKG  60

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH I+KG MAQ GD  R DG  GESIYGGKF DE   L HD PGLLSMA A RD  GS
Sbjct  61   SIFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFADENFVLNHDGPGLLSMANAGRDTNGS  120

Query  532  LFMVTFNALHHL  567
             F +TF    HL
Sbjct  121  QFFITFKPAPHL  132



>gb|KDO68605.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=622

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG M Q GD  + +G  GESIYGGKF DE  KL H+ PG+LSMA +  +  GS F
Sbjct  64   FHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF   HHL
Sbjct  124  FITFRRQHHL  133



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score =   167 bits (422),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 83/130 (64%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            K   +VFLDV IDG    RMVFELF D+ PKTAENFRALCTGE G  P T   LHYKG+ 
Sbjct  4    KNNPIVFLDVAIDGKAAGRMVFELFADIVPKTAENFRALCTGEMGIGPTTKKPLHYKGSV  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD  R DG  GESIYGGKF DE   L HD  GLLSMA A RD  GS F
Sbjct  64   FHRIIKGFMAQGGDFSRRDGTGGESIYGGKFSDENFVLNHDGRGLLSMANAGRDANGSQF  123

Query  538  MVTFNALHHL  567
             +TFN+  HL
Sbjct  124  FITFNSAPHL  133



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG M Q GD  + +G  GESIYGGKF DE  KL H+ PG+LSMA +  +  GS F
Sbjct  64   FHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF   HHL
Sbjct  124  FITFRRQHHL  133



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG M Q GD  + +G  GESIYGGKF DE  KL H+ PG+LSMA +  +  GS F
Sbjct  64   FHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF   HHL
Sbjct  124  FITFRRQHHL  133



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG M Q GD  + +G  GESIYGGKF DE  KL H+ PG+LSMA +  +  GS F
Sbjct  64   FHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF   HHL
Sbjct  124  FITFRRQHHL  133



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score =   165 bits (418),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH I+KG MAQ GD    +G  GESIYGGKF DE  K+ HD PGLLSMA A +D  GS
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNGS  121

Query  532  LFMVTFNALHHL  567
             F +TF +  HL
Sbjct  122  QFFITFKSARHL  133



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score =   165 bits (418),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH I+KG MAQ GD    +G  GESIYGGKF DE  K+ HD PGLLSMA A +D  GS
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNGS  121

Query  532  LFMVTFNALHHL  567
             F +TF +  HL
Sbjct  122  QFFITFKSARHL  133



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score =   165 bits (418),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH I+KG MAQ GD    +G  GESIYGGKF DE  K+ HD PGLLSMA A +D  GS
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNGS  121

Query  532  LFMVTFNALHHL  567
             F +TF +  HL
Sbjct  122  QFFITFKSARHL  133



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   165 bits (417),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            + K   LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    VKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH I+KG MAQ GD    +G  GESIYGGKF DE  K+ HD PGLLSMA A +D  GS
Sbjct  62   SIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNGS  121

Query  532  LFMVTFNALHHL  567
             F +TF +  HL
Sbjct  122  QFFITFKSARHL  133



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score =   164 bits (416),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 84/133 (63%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSK+K  LVF DV IDGDP ER+ FELF +  PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKRKNPLVFFDVSIDGDPVERIAFELFANFVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I++G MAQ GD  + +G  GESIYGGKF DE   LKHD PGLLSMA +  +  G
Sbjct  61   GSFFHRIIRGFMAQGGDFSKGNGTGGESIYGGKFADENFILKHDEPGLLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F VTF    HL
Sbjct  121  SQFFVTFKRQPHL  133



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score =   164 bits (415),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+F H I+KG MAQ GD  + +G  GESIYGGK  DE  KL HD PG+LSMA +  +  G
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNGTGGESIYGGKLVDENFKLAHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score =   164 bits (415),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  R +G  GES+YGGKF DE  KLKHD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKPQPHL  133



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score =   164 bits (414),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  R +G  GES+YGGKF DE  KLKHD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKPQPHL  133



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score =   164 bits (414),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  R +G  GES+YGGKF DE  KLKHD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKPQPHL  133



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD  + +G  GESIYGGKF DE  K  H+ PG LSMA +  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKRAHEGPGFLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FMTFKRQPHL  133



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD  + +G  GESIYGGKF DE  K  H+ PG LSMA +  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKRAHEGPGFLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FMTFKRQPHL  133



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score =   163 bits (413),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = +1

Query  169  KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            K  KK  +VFLDV +DG+   RMVFELF D+ PKTAENFRALCTGE G    T   LHYK
Sbjct  3    KKVKKNPIVFLDVSVDGNAARRMVFELFADIVPKTAENFRALCTGEIGFGLMTRKPLHYK  62

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH I+KG MAQ GD  R +G  GESIYGGKF DE   L HD PGLL+MA A RD  G
Sbjct  63   GSIFHRIIKGFMAQGGDFSRHNGTGGESIYGGKFADENFMLNHDGPGLLAMANAGRDTNG  122

Query  529  SLFMVTFNALHHL  567
            S F +TF A  HL
Sbjct  123  SQFFITFKAAPHL  135



>ref|XP_008802287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Phoenix dactylifera]
Length=681

 Score =   162 bits (410),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVK   AQ GD+ + DG+ GES+YGGKF DE  KLKHD PG+LSMA    D  GS F
Sbjct  64   FHRIVKRLGAQGGDIAKLDGSGGESVYGGKFSDENFKLKHDGPGVLSMASPAPDSNGSQF  123

Query  538  MVTFNA  555
             ++F A
Sbjct  124  FISFRA  129



>ref|XP_008802286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Phoenix dactylifera]
Length=682

 Score =   162 bits (410),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVK   AQ GD+ + DG+ GES+YGGKF DE  KLKHD PG+LSMA    D  GS F
Sbjct  64   FHRIVKRLGAQGGDIAKLDGSGGESVYGGKFSDENFKLKHDGPGVLSMASPAPDSNGSQF  123

Query  538  MVTFNA  555
             ++F A
Sbjct  124  FISFRA  129



>ref|XP_008802285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Phoenix dactylifera]
Length=684

 Score =   162 bits (410),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVK   AQ GD+ + DG+ GES+YGGKF DE  KLKHD PG+LSMA    D  GS F
Sbjct  64   FHRIVKRLGAQGGDIAKLDGSGGESVYGGKFSDENFKLKHDGPGVLSMASPAPDSNGSQF  123

Query  538  MVTFNA  555
             ++F A
Sbjct  124  FISFRA  129



>ref|XP_008802283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   162 bits (410),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH IVK   AQ GD+ + DG+ GES+YGGKF DE  KLKHD PG+LSMA    D  GS F
Sbjct  64   FHRIVKRLGAQGGDIAKLDGSGGESVYGGKFSDENFKLKHDGPGVLSMASPAPDSNGSQF  123

Query  538  MVTFNA  555
             ++F A
Sbjct  124  FISFRA  129



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPCVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKLLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  G
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDRPGLLSMANAGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFRRQPHL  133



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   162 bits (409),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 82/131 (63%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
            FFH IVKG +AQ GD  R DG+ GESIYG KFPDE  KLKHD PGLLSMA +  +  GS 
Sbjct  63   FFHRIVKGFVAQGGDFSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQ  122

Query  535  FMVTFNALHHL  567
            F +TF A   L
Sbjct  123  FFITFKATPQL  133



>gb|KJB25951.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=602

 Score =   161 bits (408),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  + +G  GESIYGGKF DE  KL HD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score =   162 bits (409),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 82/131 (63%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
            FFH IVKG +AQ GD  R DG+ GESIYG KFPDE  KLKHD PGLLSMA +  +  GS 
Sbjct  63   FFHRIVKGFVAQGGDFSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQ  122

Query  535  FMVTFNALHHL  567
            F +TF A   L
Sbjct  123  FFITFKATPQL  133



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score =   161 bits (408),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFRRQPHL  133



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score =   161 bits (408),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFRRQPHL  133



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score =   161 bits (407),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 82/130 (63%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFRRQPHL  133



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE   LKHD PGLLSMA A  +  G
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFNLKHDRPGLLSMANAGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFRRQPHL  133



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score =   161 bits (407),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K   VFLDV +DGDP ER+V ELF+ + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPCVFLDVSVDGDPVERIVIELFSSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTC  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD  R +G  GESIYGGKF DE  KLKHD PG+LSMA +  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSRGNGTGGESIYGGKFADENVKLKHDGPGILSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFKRQPHL  133



>gb|KJB25952.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=626

 Score =   160 bits (406),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  + +G  GESIYGGKF DE  KL HD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score =   161 bits (407),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYKG++
Sbjct  4    RKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYKGSY  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KL HD PGLLSMA    +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLAHDGPGLLSMANGGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFKRQPHL  133



>gb|KJB25950.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=599

 Score =   160 bits (405),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  + +G  GESIYGGKF DE  KL HD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>gb|KJB25949.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=661

 Score =   160 bits (406),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  + +G  GESIYGGKF DE  KL HD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>gb|KJB25953.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=634

 Score =   160 bits (405),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 93/133 (70%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GTFFH I+KG MAQ GD  + +G  GESIYGGKF DE  KL HD PG+LSMA +  +  G
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYKG++
Sbjct  4    RKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYKGSY  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KL HD PGLLSMA    +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLAHDGPGLLSMANGGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFKRQPHL  133



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   160 bits (405),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVF DV IDG P ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFFDVSIDGSPAERITIELFADVVPKTAENFRALCTGEKGIGSSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH I+KG MAQ GD  + +G  GESIYGGKFPDE  KL H   GLLSMA +  +  G
Sbjct  61   GSSFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKLDHSEAGLLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRQPHL  133



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score =   160 bits (404),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 80/129 (62%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K   VF DV +DGDP ER+V ELF+ V PKTAENFRALCTGEKG    TG  LHYKGT F
Sbjct  5    KNPCVFFDVSVDGDPVERIVIELFSSVVPKTAENFRALCTGEKGIGEATGKPLHYKGTSF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  R +G  GESIYGGKF DE  KLKHD PG+LSMA +  +  GS F 
Sbjct  65   HRIIKGFMAQGGDFSRGNGTGGESIYGGKFADENFKLKHDGPGVLSMANSGPNTNGSQFF  124

Query  541  VTFNALHHL  567
            + F    HL
Sbjct  125  IIFKRQAHL  133



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  G
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKLKHDGPGLLSMANAGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFRHQPHL  133



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  KLKHD PGLLSMA A  +  G
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKLKHDGPGLLSMANAGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFRHQPHL  133



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score =   159 bits (403),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 81/130 (62%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD    +G  GESIYGGKF DE  KLKHD PG+LSMA A  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGVLSMANAGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FIIFRRQPHL  133



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score =   159 bits (403),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLD+ IDGDP ER+V ELF DV PKTAENFRALCTGEKG    TG  LHY+G++
Sbjct  4    KKNPFVFLDLSIDGDPVERIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYRGSY  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
             H I+KG MAQ GD    DG  GESIYGGKF DE  +LKHD  G+LSMA    +  GS F
Sbjct  64   LHRIIKGFMAQGGDFSSGDGTGGESIYGGKFADENFRLKHDGAGVLSMANCGLNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>gb|KHG26228.1| Peptidyl-prolyl cis-trans isomerase D [Gossypium arboreum]
Length=177

 Score =   150 bits (379),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 92/144 (64%), Gaps = 12/144 (8%)
 Frame = +1

Query  172  MSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNF-----------GESIYGGKFPDELPKLKHDSPGLL  495
            GTF H I+KG MAQ GD  + +G             GESIYGGKF DE  KL HD PG+L
Sbjct  61   GTFLHRIIKGFMAQGGDFSKGNGMLAHSSASKFCTGGESIYGGKFADENFKLTHDGPGIL  120

Query  496  SMAIADRDIRGSLFMVTFNALHHL  567
            SMA +  +  GS F +TF    HL
Sbjct  121  SMANSGPNTNGSQFFITFKGQPHL  144



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score =   159 bits (402),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 79/130 (61%), Positives = 89/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K V VF DV ID DP ER+V +LF  + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNVRVFFDVSIDADPVERIVIQLFDSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+KG MAQ GD  R +G  GESIYGGKF DE  KL+HD PG LSMA +  +  GS F
Sbjct  64   FHRIIKGFMAQGGDFSRGNGTGGESIYGGKFADENFKLRHDGPGFLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score =   159 bits (401),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 82/127 (65%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LV+ DV IDGDP ER+V ELF DVAPKTAENFRALCTGE G    TG  LHYK
Sbjct  1    MSKKKNPLVYFDVSIDGDPVERIVIELFADVAPKTAENFRALCTGEMGIGKTTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD  + +G  GESIYGGKF DE   LKHD  G LSMA +  +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFSDENFILKHDGAGFLSMANSGPNTNG  120

Query  529  SLFMVTF  549
            S F +TF
Sbjct  121  SQFFITF  127



>gb|AAP44536.1| cyclophilin-like protein [Triticum aestivum]
Length=636

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 77/125 (62%), Positives = 89/125 (71%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VFL++ IDG P ER+ F+LF DV PKTAENFRALCTGEKG    T   L++KGT  H I+
Sbjct  12   VFLEISIDGRPAERITFQLFADVVPKTAENFRALCTGEKGLGESTKKPLYFKGTHIHRII  71

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
             G MAQAGD    DG  GESIYGGKFPDE  KLKHD PG+LSMA +  +  GS F +TF 
Sbjct  72   PGFMAQAGDFSGGDGRGGESIYGGKFPDENFKLKHDQPGILSMANSGENTNGSQFFITFK  131

Query  553  ALHHL  567
            A+ HL
Sbjct  132  AVPHL  136



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score =   158 bits (400),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 83/130 (64%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  169  KMSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  345
            KM+KKK  LVFLD+ IDG+  ER+V ELF+DV PKTAENFRALCTGEKG    TG +LHY
Sbjct  6    KMAKKKNPLVFLDISIDGNRAERIVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHY  65

Query  346  KGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIR  525
            KG+ FH IVK   AQ GD+ + DG+ GESIYGGKF DE  KLKHD PG+LSMA    D  
Sbjct  66   KGSIFHRIVKRFGAQGGDIAKLDGSGGESIYGGKFSDENFKLKHDGPGVLSMASPAPDSN  125

Query  526  GSLFMVTFNA  555
            GS F ++F A
Sbjct  126  GSQFFMSFRA  135



>ref|XP_011458604.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63 [Fragaria vesca subsp. vesca]
Length=652

 Score =   157 bits (397),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 84/133 (63%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKK-KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKK    VFLDV I+  P ER+V ELF DVAPKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKANPCVFLDVSINEAPTERIVIELFADVAPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH I+KG MAQ GD    +G  GESIYGGKF DE  KLKHD  GLLSMA A  +  G
Sbjct  61   GSQFHRIIKGFMAQGGDFSAGNGTGGESIYGGKFADEAFKLKHDKLGLLSMANAGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + FN   HL
Sbjct  121  SQFFIIFNPTPHL  133



>ref|XP_010527622.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X7 [Tarenaya hassleriana]
Length=541

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X9 [Tarenaya hassleriana]
Length=536

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X8 [Tarenaya hassleriana]
Length=538

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score =   156 bits (395),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 77/130 (59%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSIDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD  + +G  GESIYGGKFPDE  K+ H   GLLSMA +  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVVHTGAGLLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRTPHL  133



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score =   156 bits (395),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA +  +  GS F
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score =   156 bits (395),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA +  +  GS F
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score =   156 bits (395),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA +  +  GS F
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score =   156 bits (395),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 78/130 (60%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA +  +  GS F
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>ref|XP_010527616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Tarenaya hassleriana]
Length=634

 Score =   155 bits (393),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Tarenaya hassleriana]
Length=636

 Score =   155 bits (393),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527620.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Tarenaya hassleriana]
Length=631

 Score =   155 bits (393),  Expect = 7e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Tarenaya hassleriana]
Length=633

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527621.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X6 [Tarenaya hassleriana]
Length=629

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_010527619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Tarenaya hassleriana]
Length=631

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+FFH I+KG MAQ GD    +G  GESIYGGKF DE  KL+HD  G+LSMA    +  G
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRQPHL  133



>ref|XP_002302085.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
 gb|EEE81358.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
Length=688

 Score =   156 bits (394),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 80/132 (61%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            + KK  LVFLDV IDGDP ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    IKKKNPLVFLDVSIDGDPAERIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLHYKG  61

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
              FH I+KG MAQ GD  + +G+ GESIYGGKF DE   L+H+  GLLSMA +  D  GS
Sbjct  62   CSFHRIIKGFMAQGGDFSKRNGSGGESIYGGKFADENFILRHEGAGLLSMANSGPDTNGS  121

Query  532  LFMVTFNALHHL  567
             F + F    HL
Sbjct  122  QFFIIFKPHVHL  133



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GT FH I+KG MAQ GD  + DG  GESIYGGKF DE  KL+H   G LSMA   RD  G
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRTPHL  133



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GT FH I+KG MAQ GD  + DG  GESIYGGKF DE  KL+H   G LSMA   RD  G
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRTPHL  133



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score =   155 bits (393),  Expect = 8e-41, Method: Composition-based stats.
 Identities = 82/133 (62%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GT FH I+KG MAQ GD  + DG  GESIYGGKF DE  KL+H   G LSMA   RD  G
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF    HL
Sbjct  121  SQFFITFKRTPHL  133



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score =   155 bits (393),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 92/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  163  ICKMSK-----KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKT  327
            +C +SK     K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    T
Sbjct  53   MCLLSKVMGLEKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGEST  112

Query  328  GATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAI  507
            G  LHYKGT  H I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA 
Sbjct  113  GKPLHYKGTSLHRIIRGFMAQGGDFSRGNGTGGESIYGGKFADENFKLTHDGPGILSMAN  172

Query  508  ADRDIRGSLFMVTFNALHHL  567
            +  +  GS F +TF    HL
Sbjct  173  SGPNTNGSQFFITFKRQPHL  192



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score =   155 bits (391),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 75/130 (58%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD  + +G  GESIYGGKFPDE  K+ H   G+LSMA +  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVDHTEAGILSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRTPHL  133



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score =   154 bits (390),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 75/130 (58%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD  + +G  GESIYGGKFPDE  K+ H   G+LSMA +  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVDHTEAGILSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRTPHL  133



>ref|XP_003557489.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Brachypodium distachyon]
Length=637

 Score =   154 bits (389),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ IDG   ER+  ELF+DV PKTAENFRALCTGEKG    T   L++KGT  H I+
Sbjct  13   VFMDISIDGQAAERITIELFSDVVPKTAENFRALCTGEKGLGQTTKTPLYFKGTNIHRII  72

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG MAQ GD  R DG  GESIYG KFPDE  KLKHD PG+LSMA +  +  GS F +TF 
Sbjct  73   KGFMAQGGDFSRGDGRGGESIYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFITFK  132

Query  553  ALHHL  567
            A  HL
Sbjct  133  ATPHL  137



>ref|XP_010228289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Brachypodium distachyon]
Length=651

 Score =   154 bits (389),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 76/125 (61%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ IDG   ER+  ELF+DV PKTAENFRALCTGEKG    T   L++KGT  H I+
Sbjct  13   VFMDISIDGQAAERITIELFSDVVPKTAENFRALCTGEKGLGQTTKTPLYFKGTNIHRII  72

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG MAQ GD  R DG  GESIYG KFPDE  KLKHD PG+LSMA +  +  GS F +TF 
Sbjct  73   KGFMAQGGDFSRGDGRGGESIYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFITFK  132

Query  553  ALHHL  567
            A  HL
Sbjct  133  ATPHL  137



>ref|XP_006657500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=626

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VFLD+ I G   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
              H I+KG MAQ GD  R DG  GESIYG KF DE  KLKHD PG+LSMA A  D  GS 
Sbjct  64   TMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQ  123

Query  535  FMVTFNALHHL  567
            F +TF  + HL
Sbjct  124  FFITFLPVPHL  134



>ref|XP_006657499.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=627

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VFLD+ I G   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
              H I+KG MAQ GD  R DG  GESIYG KF DE  KLKHD PG+LSMA A  D  GS 
Sbjct  64   TMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQ  123

Query  535  FMVTFNALHHL  567
            F +TF  + HL
Sbjct  124  FFITFLPVPHL  134



>ref|XP_003521263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Glycine 
max]
Length=668

 Score =   153 bits (387),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 76/130 (58%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            +K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
             H I++G MAQ GD  R +G  GESIYGGKF DE  KL HD PG+LSMA +  +  GS F
Sbjct  64   LHRIIRGFMAQGGDFSRGNGTGGESIYGGKFADENFKLTHDGPGILSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  FITFKRQPHL  133



>dbj|BAJ87064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VFLD+ IDG   ER+ FELF DV PKTAENFRALCTGEKG    T   L++KGT  H I+
Sbjct  12   VFLDISIDGRLTERITFELFADVVPKTAENFRALCTGEKGLGESTKKPLYFKGTHIHRII  71

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
             G M Q GD  R DG  GESIYGGKF DE  KLKHD PG+LSMA +  D  GS F +TF 
Sbjct  72   PGFMVQGGDFSRGDGRGGESIYGGKFQDENFKLKHDQPGILSMANSGEDSNGSQFFITFK  131

Query  553  ALHHL  567
            A+ HL
Sbjct  132  AVPHL  136



>tpg|DAA42557.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=187

 Score =   145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FEL  +V PKTAENFRALCTGE G    T   L+YKGT  H IV
Sbjct  35   VFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGTHIHRIV  94

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG + Q GD  R DG  GESIYGGKFPDE  +L H+ PG+LSMA +  D  GS F +TF 
Sbjct  95   KGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFK  154

Query  553  ALHHL  567
            AL HL
Sbjct  155  ALPHL  159



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score =   153 bits (386),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 77/133 (58%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV +DGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDAAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G  FH ++KG MAQ GD  + +G  GESIYGGKFPDE  K+ H   GLLSMA +  +  G
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVAHAEAGLLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRTPHL  133



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score =   152 bits (385),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 78/133 (59%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV IDGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDTAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G  FH ++KG MAQ GD  + +G  GESIYGGKFPDE  K+ H   GLLSMA +  +  G
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVAHTEAGLLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKRTPHL  133



>tpg|DAA59762.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=340

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKTAENFRALCTGE+G    T   L+YKGT+ H IV
Sbjct  9    VFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGTYIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD    DG  GESIYGGKFPDE  KL H+ PG+LSMA +     GS F +TF 
Sbjct  69   KGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>ref|XP_002459423.1| hypothetical protein SORBIDRAFT_02g004430 [Sorghum bicolor]
 gb|EER95944.1| hypothetical protein SORBIDRAFT_02g004430 [Sorghum bicolor]
Length=648

 Score =   152 bits (383),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 80/133 (60%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSK-KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSK K   VF+D+ I G   ER+ FELF +V PKTAENFRALCTGE+G    T   L+YK
Sbjct  1    MSKVKNPHVFMDISIGGSSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            GT  H IVKG +AQ GD  R DG  GESIYGGKFPDE  +L HD PG+LSMA +  D  G
Sbjct  61   GTNIHRIVKGFVAQGGDFSRGDGRGGESIYGGKFPDENFRLLHDQPGVLSMANSGPDSNG  120

Query  529  SLFMVTFNALHHL  567
            S F +TF AL HL
Sbjct  121  SQFFITFKALPHL  133



>ref|XP_002306802.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
 gb|EEE93798.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
Length=673

 Score =   152 bits (384),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 80/133 (60%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKGT   TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGTGKTTGKPLHYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH I+K  MAQ GD  + +G  GESIYGGKF DE   L+H+  G LSMA +  +  G
Sbjct  61   GSSFHRIIKEFMAQGGDFSKGNGTGGESIYGGKFADENFILRHEGAGHLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F +T     HL
Sbjct  121  SQFFITLKPQAHL  133



>ref|XP_011079927.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Sesamum 
indicum]
Length=696

 Score =   151 bits (382),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 78/131 (60%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            S K   VFLDV ID D  +R+V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+
Sbjct  3    STKNPSVFLDVSIDSDTTQRIVIELFADVVPKTAENFRALCTGEKGVGSLTGKPLHYKGS  62

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
             FH I+KG MAQ GD  + +G  GESIYGGKF DE  KL H  PG LSMA    +  GS 
Sbjct  63   TFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSGPGFLSMANGGPNTNGSQ  122

Query  535  FMVTFNALHHL  567
            F +TF    HL
Sbjct  123  FFITFKRQPHL  133



>gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Erythranthe guttata]
Length=688

 Score =   150 bits (380),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 77/129 (60%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K  LVFL+V I+GD  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPLVFLEVSIEGDTAERIVIELFADTVPKTAENFRALCTGEKGVGTSTGKPLHYKGCTF  64

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H I+KG MAQ GD  + +G  GESIYGGKF DE  KL H  PGLLSMA    +  GS F 
Sbjct  65   HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANGGPNTNGSQFF  124

Query  541  VTFNALHHL  567
            + F    HL
Sbjct  125  IIFKRQPHL  133



>tpg|DAA42555.1| TPA: hypothetical protein ZEAMMB73_596682, partial [Zea mays]
Length=313

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FEL  +V PKTAENFRALCTGE G    T   L+YKGT  H IV
Sbjct  9    VFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGTHIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG + Q GD  R DG  GESIYGGKFPDE  +L H+ PG+LSMA +  D  GS F +TF 
Sbjct  69   KGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>dbj|BAJ98045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 91/136 (67%), Gaps = 1/136 (1%)
 Frame = +1

Query  163  ICKMSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATL  339
            I KM +KK  +VFLDV I   P ERM+FELF +VAP TAENFRALCTGE G    T   L
Sbjct  3    IEKMGRKKNPIVFLDVSIGDGPDERMIFELFANVAPLTAENFRALCTGEMGIGQTTKKPL  62

Query  340  HYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRD  519
            +YKG+ FH ++KG MAQ GD    DGN GESIYG +F DE   L+HD  GLLSMA A R+
Sbjct  63   YYKGSTFHRVIKGFMAQGGDFSNGDGNGGESIYGEQFEDENFVLRHDDRGLLSMANAGRN  122

Query  520  IRGSLFMVTFNALHHL  567
              GS F +TF    HL
Sbjct  123  TNGSQFFITFKPNSHL  138



>ref|NP_850740.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80476.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=387

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FILFKRQPHL  133



>ref|XP_011026088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Populus 
euphratica]
Length=694

 Score =   149 bits (377),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 80/133 (60%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK  LVFLDV IDGDP   +  ELF DV PKTAENFRALCTGEKG    TG  L YK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAASIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLRYK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G  FH I+KG MAQ GD  + +G+ GESIYGGKF DE   L+H+  GLLSMA +  D  G
Sbjct  61   GCSFHRIIKGFMAQGGDFSKGNGSGGESIYGGKFADENFILRHEGAGLLSMANSGPDTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFIIFKPQAHL  133



>ref|XP_011032623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
 ref|XP_011032624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
Length=680

 Score =   149 bits (376),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 76/130 (58%), Positives = 87/130 (67%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGIGKTTGKPLHYKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH I+K  MAQ GD  + +G  GESIYGGKF DE   L+H+  G LSMA +  +  GS F
Sbjct  64   FHRIIKEFMAQGGDFSKGNGTGGESIYGGKFSDENFILRHEGAGRLSMANSGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             +T     HL
Sbjct  124  FITLKPQAHL  133



>ref|XP_004955639.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Setaria italica]
Length=643

 Score =   147 bits (372),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKT ENFRALCTGE+G    T   L+YKGT  H IV
Sbjct  9    VFMDISIGGGSTERITFELFANVVPKTVENFRALCTGERGLGASTQKPLYYKGTNIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD  + DG  GESIYGGKFPDE  +L HD PG+LSMA A  D  GS F +TF 
Sbjct  69   KGFVAQGGDFSKGDGRGGESIYGGKFPDENFRLTHDQPGMLSMANAGPDTNGSQFFITFK  128

Query  553  ALHHL  567
             L HL
Sbjct  129  PLPHL  133



>ref|XP_004955636.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Setaria italica]
 ref|XP_004955637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Setaria italica]
 ref|XP_004955638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Setaria italica]
Length=644

 Score =   147 bits (372),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKT ENFRALCTGE+G    T   L+YKGT  H IV
Sbjct  9    VFMDISIGGGSTERITFELFANVVPKTVENFRALCTGERGLGASTQKPLYYKGTNIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD  + DG  GESIYGGKFPDE  +L HD PG+LSMA A  D  GS F +TF 
Sbjct  69   KGFVAQGGDFSKGDGRGGESIYGGKFPDENFRLTHDQPGMLSMANAGPDTNGSQFFITFK  128

Query  553  ALHHL  567
             L HL
Sbjct  129  PLPHL  133



>ref|XP_008651151.1| PREDICTED: uncharacterized protein LOC100274576 isoform X3 [Zea 
mays]
 tpg|DAA59760.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
 tpg|DAA59761.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=621

 Score =   147 bits (371),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKTAENFRALCTGE+G    T   L+YKGT+ H IV
Sbjct  9    VFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGTYIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD    DG  GESIYGGKFPDE  KL H+ PG+LSMA +     GS F +TF 
Sbjct  69   KGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>gb|AAS75310.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=566

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FILFKRQPHL  133



>ref|XP_008651150.1| PREDICTED: uncharacterized protein LOC100274576 isoform X2 [Zea 
mays]
 tpg|DAA59759.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=648

 Score =   147 bits (371),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKTAENFRALCTGE+G    T   L+YKGT+ H IV
Sbjct  9    VFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGTYIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD    DG  GESIYGGKFPDE  KL H+ PG+LSMA +     GS F +TF 
Sbjct  69   KGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>ref|XP_008651149.1| PREDICTED: uncharacterized protein LOC100274576 isoform X1 [Zea 
mays]
Length=649

 Score =   147 bits (371),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FELF +V PKTAENFRALCTGE+G    T   L+YKGT+ H IV
Sbjct  9    VFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGTYIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG +AQ GD    DG  GESIYGGKFPDE  KL H+ PG+LSMA +     GS F +TF 
Sbjct  69   KGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>emb|CDX93909.1| BnaC04g20680D [Brassica napus]
Length=612

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I GDP ER+V ELF  V PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  80   KKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGEAGLGKTTGKPLHFKGSS  139

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKFPDE  +L H+  G+LSMA    +  GS F
Sbjct  140  FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMANCGPNTNGSQF  199

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  200  FILFKRQPHL  209



>dbj|BAH57223.1| AT3G63400 [Arabidopsis thaliana]
Length=570

 Score =   146 bits (369),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FILFKRQPHL  133



>ref|NP_191899.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190169.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q9LY75.1|CYP63_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP63; Short=AtCYP63; 
Short=PPIase CYP63; AltName: Full=Cyclophilin-63; 
AltName: Full=Cyclophilin-like protein CypRS64 [Arabidopsis 
thaliana]
 emb|CAB87793.1| cyclophylin-like protein [Arabidopsis thaliana]
 gb|AAN41315.1| putative cyclophylin protein [Arabidopsis thaliana]
 gb|AEE80475.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80477.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=570

 Score =   146 bits (369),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/130 (57%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FILFKRQPHL  133



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKK    VFLDV + GDP ER+V ELF DV PKTAENFRALCTGE G    TG  L +K
Sbjct  1    MSKKNNPNVFLDVSLGGDPVERIVIELFADVVPKTAENFRALCTGEAGIGKTTGKPLQFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  KL HD  G+LSMA    +  G
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLDHDGAGVLSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFILFKRQPHL  133



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 91/157 (58%), Gaps = 27/157 (17%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  358  FHHIVKGSMAQAGDLLREDG---------------------------NFGESIYGGKFPD  456
            FH I+KG MAQ GD  + +G                             GESIYGGKF D
Sbjct  64   FHRIIKGFMAQGGDFSKGNGMCFLFPSSIASVDAYSLFDLYLNAQTCTGGESIYGGKFAD  123

Query  457  ELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            E  K  H+ PG LSMA +  +  GS F +TF    HL
Sbjct  124  ENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHL  160



>ref|XP_006647053.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=845

 Score =   148 bits (374),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YKG+ 
Sbjct  4    KKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYKGSL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    DG+ GESIYGG F DE   L+HD  GLLSMA A  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFDLRHDDRGLLSMANAGPNANGSQF  123

Query  538  MVTF  549
             +TF
Sbjct  124  FITF  127



>ref|XP_006647052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=847

 Score =   148 bits (374),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YKG+ 
Sbjct  4    KKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYKGSL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    DG+ GESIYGG F DE   L+HD  GLLSMA A  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFDLRHDDRGLLSMANAGPNANGSQF  123

Query  538  MVTF  549
             +TF
Sbjct  124  FITF  127



>ref|XP_001651471.1| AAEL005799-PA, partial [Aedes aegypti]
 gb|EAT42690.1| AAEL005799-PA, partial [Aedes aegypti]
Length=218

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
             K+  F D+ + G P  R+VFELF D+APKT ENFR+LCTGEKGT  KTG  LHYKG  F
Sbjct  14   NKIRCFFDITLGGLPAGRIVFELFPDIAPKTCENFRSLCTGEKGTGQKTGKPLHYKGIIF  73

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H +VK  M Q+GD    +G  GESIYGG F DE   LKHD P LLSMA   ++  GS F 
Sbjct  74   HRVVKDFMIQSGDFSNGNGTGGESIYGGTFDDEAFTLKHDKPFLLSMANRGKNTNGSQFF  133

Query  541  VTFNALHHL  567
            +T     HL
Sbjct  134  ITTQPAPHL  142



>ref|XP_001780456.1| predicted protein [Physcomitrella patens]
 gb|EDQ54746.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VFLD+ I G P  +M+ EL+ DV PKTAENFRALCTGEKG    T   LH K T FH I+
Sbjct  10   VFLDITIGGGPAGKMIMELYADVVPKTAENFRALCTGEKGLGRMTKKPLHLKDTIFHRII  69

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
             G MAQ GD  + DG  GESIYGGKF DE  KL HD  G+LSMA A  +  GS F +TF 
Sbjct  70   PGFMAQGGDFSKRDGTGGESIYGGKFDDENFKLGHDGAGILSMANAGPNTNGSQFFLTFK  129

Query  553  ALHHL  567
            +  HL
Sbjct  130  SQPHL  134



>gb|EEC72707.1| hypothetical protein OsI_06299 [Oryza sativa Indica Group]
Length=787

 Score =   147 bits (370),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YKG+ 
Sbjct  4    KKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGSL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    DG+ GESIYGG F DE   L+HD  GLLSMA A  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNGSQF  123

Query  538  MVTF  549
             +TF
Sbjct  124  FITF  127



>ref|XP_002876720.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52979.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTRKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  G
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGILSMANCGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFILFKRQPHL  133



>gb|EEE66674.1| hypothetical protein OsJ_23316 [Oryza sativa Japonica Group]
Length=632

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VF D+ I G   ER+ FELF DV PKT ENFRALCTGE+G    T   L++KGT
Sbjct  4    AKKNPHVFFDIAIGGRAAERITFELFADVVPKTTENFRALCTGERGLGVSTQKPLYFKGT  63

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
              H I+KG MAQ GD  R DG  GESIYG KF DE  KLKHD PG+LSMA A  D  GS 
Sbjct  64   NMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQ  123

Query  535  FMVTFNALHHL  567
            F +TF    HL
Sbjct  124  FFITFMPTPHL  134



>gb|EEE56526.1| hypothetical protein OsJ_05815 [Oryza sativa Japonica Group]
Length=670

 Score =   145 bits (367),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YKG+ 
Sbjct  4    KKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGSL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    DG+ GESIYGG F DE   L+HD  GLLSMA A  +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNGSQF  123

Query  538  MVTF  549
             +TF
Sbjct  124  FITF  127



>tpg|DAA42558.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=670

 Score =   145 bits (366),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FEL  +V PKTAENFRALCTGE G    T   L+YKGT  H IV
Sbjct  35   VFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGTHIHRIV  94

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG + Q GD  R DG  GESIYGGKFPDE  +L H+ PG+LSMA +  D  GS F +TF 
Sbjct  95   KGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFK  154

Query  553  ALHHL  567
            AL HL
Sbjct  155  ALPHL  159



>gb|EEC81610.1| hypothetical protein OsI_25113 [Oryza sativa Indica Group]
Length=632

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  354
            +KK   VF D+ I G   ER+ FELF DV PKT ENFRALCTGE+G    T   L++KGT
Sbjct  4    AKKNPHVFFDIAIGGRAAERITFELFADVVPKTTENFRALCTGERGLGVSTQKPLYFKGT  63

Query  355  FFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSL  534
              H I+KG MAQ GD  R DG  GESIYG KF DE  KLKHD PG+LSMA A  D  GS 
Sbjct  64   NMHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQ  123

Query  535  FMVTFNALHHL  567
            F +TF    HL
Sbjct  124  FFITFVPTPHL  134



>gb|AIZ68177.1| peptidyl-prolyl cis-trans isomerase CYP40-like protein [Ornithogalum 
saundersiae]
Length=367

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  375
            +LD+ I G+   R+V EL+ DV PKTAENFRALCTGEKGT P TGA LHYKG  FH I K
Sbjct  13   YLDISIGGELDGRIVVELYADVVPKTAENFRALCTGEKGTGPTTGAPLHYKGVRFHRITK  72

Query  376  GSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNA  555
            G M Q GD+   DG  GESIYG KF DE  KLKH+  G+LSMA +  D  GS F +T   
Sbjct  73   GFMIQGGDISSSDGTGGESIYGPKFDDENFKLKHERKGILSMANSGPDTNGSQFFITTTR  132

Query  556  LHHL  567
              HL
Sbjct  133  ASHL  136



>ref|NP_001232291.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH46307.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=206

 Score =   138 bits (348),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            K  M Q GD   ++G  GESIYG KF DE    +HD PGLLSMA A     GS F +T  
Sbjct  78   KQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQFFITTV  137

Query  553  ALHHL  567
               HL
Sbjct  138  PTPHL  142



>ref|XP_006290850.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
 gb|EOA23748.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
Length=551

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = +1

Query  172  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  348
            M+KKK   VFLDV I GDP ER+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MTKKKNPHVFLDVSIGGDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTTKPLHFK  60

Query  349  GTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRG  528
            G+ FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA +  +  G
Sbjct  61   GSSFHRVIKGFMAQGGDFSVGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANSGPNTNG  120

Query  529  SLFMVTFNALHHL  567
            S F + F    HL
Sbjct  121  SQFFILFKRQPHL  133



>ref|NP_001170592.1| uncharacterized protein LOC100384625 [Zea mays]
 gb|ACR34149.1| unknown [Zea mays]
 tpg|DAA42556.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=644

 Score =   145 bits (365),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FEL  +V PKTAENFRALCTGE G    T   L+YKGT  H IV
Sbjct  9    VFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGTHIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG + Q GD  R DG  GESIYGGKFPDE  +L H+ PG+LSMA +  D  GS F +TF 
Sbjct  69   KGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>ref|XP_008668501.1| PREDICTED: uncharacterized protein LOC100384625 isoform X1 [Zea 
mays]
Length=645

 Score =   145 bits (365),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 73/125 (58%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF+D+ I G   ER+ FEL  +V PKTAENFRALCTGE G    T   L+YKGT  H IV
Sbjct  9    VFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGTHIHRIV  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG + Q GD  R DG  GESIYGGKFPDE  +L H+ PG+LSMA +  D  GS F +TF 
Sbjct  69   KGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQFFITFK  128

Query  553  ALHHL  567
            AL HL
Sbjct  129  ALPHL  133



>emb|CDK25020.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=363

 Score =   142 bits (357),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  172  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  351
            MS+ +  VF DV I G+P  R+VFELF DV PKTAENFRALCTGEKG   ++G  LHYKG
Sbjct  1    MSEVRPRVFFDVSIGGEPTRRIVFELFADVVPKTAENFRALCTGEKGVG-QSGKPLHYKG  59

Query  352  TFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGS  531
            + FH +++  M Q GD    DG  GESIYG KF DE  +LKHD P LLSMA A  +  GS
Sbjct  60   SIFHRVIESFMCQGGDFTLGDGRGGESIYGEKFEDENFQLKHDKPFLLSMANAGPNTNGS  119

Query  532  LFMVTFNALHHL  567
             F +T  +  HL
Sbjct  120  QFFITTVSTPHL  131



>ref|XP_004926608.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Bombyx 
mori]
Length=202

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 82/130 (63%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            K +  VF+D+ I G P  R+VFELF +VAPKTAENFRALCTGE G    TG  L YKG  
Sbjct  9    KPRDRVFMDISIGGMPSGRIVFELFNEVAPKTAENFRALCTGEMGIGKNTGKPLTYKGMV  68

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH +VK  M Q GD    +G  GESIYGG F DE  +LKHD P LLSMA   +D  GS F
Sbjct  69   FHRVVKDFMIQGGDFTNANGTGGESIYGGTFEDETFELKHDRPLLLSMANRGKDTNGSQF  128

Query  538  MVTFNALHHL  567
             +T     HL
Sbjct  129  FITTQPAPHL  138



>ref|XP_007184203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=370

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VFLDV + G+   R+V ELF D+ PKTAENFRALCTGEKG  P TG  LH+KG  FH I+
Sbjct  18   VFLDVDVGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRII  77

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            K  M Q GD   ++G  GESIYGGKF DE    KHD  GLLSMA A R+  GS F +T  
Sbjct  78   KKFMIQGGDFSNQNGTGGESIYGGKFEDENFHYKHDKEGLLSMANAGRNTNGSQFFITMA  137

Query  553  ALHHL  567
               HL
Sbjct  138  PTPHL  142



>ref|XP_010512756.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Camelina 
sativa]
Length=658

 Score =   144 bits (362),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 72/129 (56%), Positives = 83/129 (64%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K  LVFLDV I  DP +R+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ F
Sbjct  79   KNPLVFLDVSIGEDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFKGSSF  138

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F 
Sbjct  139  HRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQFF  198

Query  541  VTFNALHHL  567
            + F    HL
Sbjct  199  ILFKRQPHL  207



>ref|XP_010468852.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63-like [Camelina sativa]
Length=591

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK   VFLDV I  DP ER+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  4    KKNPFVFLDVSIGEDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFKGSS  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD    +G  GESIYGGKF DE  +L HD  G+LSMA    +  GS F
Sbjct  64   FHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNGSQF  123

Query  538  MVTFNALHHL  567
             + F    HL
Sbjct  124  FILFKRQPHL  133



>ref|XP_010999957.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Populus euphratica]
Length=370

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 85/129 (66%), Gaps = 0/129 (0%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            ++   FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TGA LHYKG  F
Sbjct  2    RRSRCFLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGVGPNTGAPLHYKGCCF  61

Query  361  HHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFM  540
            H ++KG M Q GD+   DG  GESIYG KF DE  +LKH+  G+LSMA A  +  GS F 
Sbjct  62   HRVIKGFMVQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFF  121

Query  541  VTFNALHHL  567
            +T     HL
Sbjct  122  ITTTRTSHL  130



>ref|XP_009138664.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Brassica 
rapa]
Length=556

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  163  ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  342
            +    KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  343  YKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDI  522
            +KG+ FH ++KG MAQ GD    +G  GESIYGGKFPDE  +L H+  G+LSMA    + 
Sbjct  61   FKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMANCGPNT  120

Query  523  RGSLFMVTFNALHHL  567
             GS F + F    HL
Sbjct  121  NGSQFFILFKRQPHL  135



>emb|CDY53714.1| BnaAnng12550D [Brassica napus]
Length=556

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = +1

Query  163  ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  342
            +    KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  343  YKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDI  522
            +KG+ FH ++KG MAQ GD    +G  GESIYGGKFPDE  +L H+  G+LSMA    + 
Sbjct  61   FKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMANCGPNT  120

Query  523  RGSLFMVTFNALHHL  567
             GS F + F    HL
Sbjct  121  NGSQFFILFKRQPHL  135



>ref|XP_010584392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Haliaeetus 
leucocephalus]
Length=341

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            K  M Q GD   ++G  GESIYG KF DE    KHD PGLLSMA A     GS F +T  
Sbjct  78   KQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTV  137

Query  553  ALHHL  567
               HL
Sbjct  138  PTSHL  142



>gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea]
Length=565

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 85/136 (63%), Gaps = 7/136 (5%)
 Frame = +1

Query  181  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  360
            K   VFLD+ +DG+  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPFVFLDISVDGNAAERIVIELFADAVPKTAENFRALCTGEKGVGVSTGKPLHYKGITF  64

Query  361  HHIVKGSMAQAGDLLREDGNF-------GESIYGGKFPDELPKLKHDSPGLLSMAIADRD  519
            H I++G MAQ GD  + +G         GESIYGGKF DE  K  H+ PG+LSMA    +
Sbjct  65   HRIIRGFMAQGGDFSKGNGMLITSRRTGGESIYGGKFADENFKFDHNEPGILSMANGGPN  124

Query  520  IRGSLFMVTFNALHHL  567
              GS F +TF    HL
Sbjct  125  TNGSQFFITFKRQPHL  140



>gb|ELU12765.1| hypothetical protein CAPTEDRAFT_170435, partial [Capitella teleta]
Length=365

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF DV I  D   R+VFELF D+ PKT ENFRALCTGEKG    TG  LH+KG  FH I+
Sbjct  9    VFFDVKIGNDDVGRIVFELFKDIVPKTVENFRALCTGEKGIGESTGKPLHFKGCPFHRII  68

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            KG M Q GD   ++G  GESIYG KF DE  +LKHD PGLLSMA A ++  GS F +T  
Sbjct  69   KGFMLQGGDFSNQNGTGGESIYGAKFEDENFELKHDRPGLLSMANAGKNTNGSQFFITTV  128

Query  553  ALHHL  567
               HL
Sbjct  129  PTAHL  133



>ref|XP_010685556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-4 [Beta 
vulgaris subsp. vulgaris]
Length=208

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 89/148 (60%), Gaps = 11/148 (7%)
 Frame = +1

Query  133  ILCSFSVLT*ICKMSKKKVL----------VFLDVCIDGDPFERMVFELFTDVAPKTAEN  282
            +LC+ ++   + ++  KK            VF DV IDG P  R+V  LF    PKTAEN
Sbjct  11   LLCTLAIFGSLAQIQAKKQSSEDLKEVTHKVFFDVEIDGKPAGRVVMGLFGKAVPKTAEN  70

Query  283  FRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDEL  462
            FRALCTGEKG S K+G  LHYKG+ FH I+   M Q GD  R DG  GESIYG KF DE 
Sbjct  71   FRALCTGEKGVS-KSGKPLHYKGSTFHRIIPSFMIQGGDFTRGDGTGGESIYGEKFADEN  129

Query  463  PKLKHDSPGLLSMAIADRDIRGSLFMVT  546
             KLKH  PG LSMA A ++  GS F +T
Sbjct  130  FKLKHTGPGFLSMANAGKNTNGSQFFIT  157



>ref|XP_005148983.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Melopsittacus 
undulatus]
Length=370

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   TFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            K  M Q GD   ++G  GESIYG KF DE    KHD PGLLSMA A     GS F +T  
Sbjct  78   KQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTV  137

Query  553  ALHHL  567
               HL
Sbjct  138  PTSHL  142



>ref|XP_010584391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Haliaeetus 
leucocephalus]
Length=370

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFN  552
            K  M Q GD   ++G  GESIYG KF DE    KHD PGLLSMA A     GS F +T  
Sbjct  78   KQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTV  137

Query  553  ALHHL  567
               HL
Sbjct  138  PTSHL  142



>gb|KIZ04415.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Monoraphidium 
neglectum]
Length=204

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 88/139 (63%), Gaps = 3/139 (2%)
 Frame = +1

Query  136  LCSFSVLT*ICKMSKKKVL--VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEK  309
            +C+ +VL       K +V   VF D+ IDG P  R+V  LF D+ PKT ENFRALCTGEK
Sbjct  14   ICASTVLVEAKDKKKAEVTHKVFFDIEIDGKPAGRIVMGLFGDIVPKTVENFRALCTGEK  73

Query  310  GTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPG  489
            GT  K+G  LH+KG+ FH I+   M Q GD  R DG  GESIYG KF DE  KLKH +PG
Sbjct  74   GTG-KSGKPLHFKGSVFHRIIPQFMIQGGDFTRGDGTGGESIYGEKFADENFKLKHKAPG  132

Query  490  LLSMAIADRDIRGSLFMVT  546
             LSMA A  +  GS F +T
Sbjct  133  YLSMANAGPNTNGSQFFIT  151



>ref|XP_010262860.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1 [Nelumbo 
nucifera]
Length=207

 Score =   135 bits (341),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = +1

Query  130  FILCSFSVLT*ICKMSKKKVL------VFLDVCIDGDPFERMVFELFTDVAPKTAENFRA  291
            +IL  F  L  I    +KK L      V+ D+ IDG P  R+V  LF    PKTAENFRA
Sbjct  13   WILVLFGTLALIEAKKEKKNLKEITHKVYFDIEIDGKPAGRIVMGLFGKTVPKTAENFRA  72

Query  292  LCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKL  471
            LCTGEKG   K G  LHYKG+ FH I+   M Q GD    DG  GESIYG KF DE  K+
Sbjct  73   LCTGEKGIG-KNGKPLHYKGSTFHRIIPSFMIQGGDFTLGDGRGGESIYGEKFADENFKI  131

Query  472  KHDSPGLLSMAIADRDIRGSLFMVT  546
            KH  PGLLSMA A RD  GS F +T
Sbjct  132  KHTGPGLLSMANAGRDTNGSQFFIT  156



>gb|EYU44370.1| hypothetical protein MIMGU_mgv1a0089282mg, partial [Erythranthe 
guttata]
Length=268

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  375
            +LD+ IDG+   R+V EL++DV P+TAENFRALCTGEKG SP++G  LHYKG+ F+ I++
Sbjct  7    YLDISIDGEMEGRIVVELYSDVVPRTAENFRALCTGEKGISPRSGVPLHYKGSHFNSIIR  66

Query  376  GSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNA  555
            G M Q GD+  E+G  GESIYG KF DE  +LKH   G+LSMA +  +  GS F +  N 
Sbjct  67   GLMVQGGDISAEEGVPGESIYGEKFEDENFELKHSRKGMLSMANSGPNSNGSKFAILTNQ  126

Query  556  LHHL  567
              HL
Sbjct  127  ATHL  130



>ref|XP_010028504.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Eucalyptus 
grandis]
 gb|KCW55241.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
 gb|KCW55242.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
Length=361

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +1

Query  184  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  363
            K   F+D+ I G+   R+V EL+TDVAPKTAENFRALCTGEKG  P TGA LHYKG  FH
Sbjct  3    KPRCFMDISIGGELEGRIVGELYTDVAPKTAENFRALCTGEKGIGPHTGAPLHYKGVRFH  62

Query  364  HIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMV  543
             ++KG M Q GD+   DG  GESIYG KF DE   LKH+  G+LSMA +  +  GS F +
Sbjct  63   RVIKGFMVQGGDISAGDGTGGESIYGLKFEDENFDLKHERKGMLSMANSGPNTNGSQFFI  122

Query  544  TFNALHHL  567
            T     HL
Sbjct  123  TTTRTSHL  130



>gb|KFP78820.1| Peptidyl-prolyl cis-trans isomerase D, partial [Acanthisitta 
chloris]
 gb|KFQ07802.1| Peptidyl-prolyl cis-trans isomerase D, partial [Haliaeetus albicilla]
 gb|KFR08685.1| Peptidyl-prolyl cis-trans isomerase D, partial [Nipponia nippon]
Length=137

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFP14006.1| Peptidyl-prolyl cis-trans isomerase D, partial [Egretta garzetta]
 gb|KFQ65493.1| Peptidyl-prolyl cis-trans isomerase D, partial [Phaethon lepturus]
Length=137

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>ref|XP_008236639.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Prunus 
mume]
Length=362

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  375
            FLD+ I  +   R+V EL+ DV PKTAENFRALCTGEKG  P TGA LHYKG  FH +VK
Sbjct  7    FLDISIGEELEGRIVVELYNDVVPKTAENFRALCTGEKGIGPNTGAPLHYKGVRFHRVVK  66

Query  376  GSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNA  555
            G M Q GD+   DG  GESIYG KF DE  +LKH+  G+LSMA + +D  GS F +T   
Sbjct  67   GFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANSGQDTNGSQFFITTTR  126

Query  556  LHHL  567
              HL
Sbjct  127  TSHL  130



>gb|KFQ46673.1| Peptidyl-prolyl cis-trans isomerase D, partial [Nestor notabilis]
Length=137

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFO07741.1| Peptidyl-prolyl cis-trans isomerase D, partial [Balearica regulorum 
gibbericeps]
 gb|KFQ73186.1| Peptidyl-prolyl cis-trans isomerase D, partial [Phoenicopterus 
ruber ruber]
 gb|KFV95244.1| Peptidyl-prolyl cis-trans isomerase D, partial [Eurypyga helias]
Length=152

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>ref|XP_010530877.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Tarenaya hassleriana]
Length=361

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = +1

Query  196  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  375
            F+D+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FVDIAIGGELEGRIVVELYNDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGNRFHRVIK  66

Query  376  GSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNA  555
            G M Q GD+  +DG  GESIYG KF DE  +LKH+  G+LSMA A  +  GS F +T   
Sbjct  67   GFMVQGGDISAQDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTR  126

Query  556  LHHL  567
              HL
Sbjct  127  TSHL  130



>ref|XP_002601271.1| hypothetical protein BRAFLDRAFT_229322 [Branchiostoma floridae]
 gb|EEN57283.1| hypothetical protein BRAFLDRAFT_229322, partial [Branchiostoma 
floridae]
Length=168

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = +1

Query  193  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  372
            VF D+ I G P  R+VFEL  DV PKTAENFRALCTGEKG     G  LHYKG  FH  +
Sbjct  2    VFFDITIGGTPAGRIVFELRADVVPKTAENFRALCTGEKGRG-TWGEPLHYKGVIFHRCI  60

Query  373  KGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVT  546
             G M Q GD+   +G+ GESIYGG FPDE  KL H  PG+LSMA A  D  GS F +T
Sbjct  61   PGFMVQGGDIQFNNGSGGESIYGGDFPDENFKLNHTGPGILSMANAGPDTNGSQFFIT  118



>ref|XP_008681079.1| PREDICTED: uncharacterized protein LOC100192934 isoform X2 [Zea 
mays]
 gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=829

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 72/130 (55%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD+ +E+G+ GE+IY GKF DE   L HD  GLL+ A       GS F
Sbjct  64   FHRVIKGFMAQGGDIAKENGSGGENIYSGKFTDETCVLLHDDRGLLTTADTGFKPSGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  CITFKPNSHL  133



>ref|XP_008681078.1| PREDICTED: uncharacterized protein LOC100192934 isoform X1 [Zea 
mays]
 gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=832

 Score =   142 bits (359),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 72/130 (55%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  178  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  357
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  358  FHHIVKGSMAQAGDLLREDGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLF  537
            FH ++KG MAQ GD+ +E+G+ GE+IY GKF DE   L HD  GLL+ A       GS F
Sbjct  64   FHRVIKGFMAQGGDIAKENGSGGENIYSGKFTDETCVLLHDDRGLLTTADTGFKPSGSQF  123

Query  538  MVTFNALHHL  567
             +TF    HL
Sbjct  124  CITFKPNSHL  133



>gb|KFP00867.1| Peptidyl-prolyl cis-trans isomerase D, partial [Calypte anna]
Length=152

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFP46157.1| Peptidyl-prolyl cis-trans isomerase D, partial [Cathartes aura]
 gb|KFP64835.1| Peptidyl-prolyl cis-trans isomerase D, partial [Cariama cristata]
 gb|KFV39637.1| Peptidyl-prolyl cis-trans isomerase D, partial [Tyto alba]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFO88271.1| Peptidyl-prolyl cis-trans isomerase D, partial [Buceros rhinoceros 
silvestris]
 gb|KFU88340.1| Peptidyl-prolyl cis-trans isomerase D, partial [Chaetura pelagica]
 gb|KFV01257.1| Peptidyl-prolyl cis-trans isomerase D, partial [Tauraco erythrolophus]
 gb|KFV70433.1| Peptidyl-prolyl cis-trans isomerase D, partial [Picoides pubescens]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFP32657.1| Peptidyl-prolyl cis-trans isomerase D, partial [Colius striatus]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFV98604.1| Peptidyl-prolyl cis-trans isomerase D, partial [Fulmarus glacialis]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



>gb|KFQ13013.1| Peptidyl-prolyl cis-trans isomerase D, partial [Leptosomus discolor]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  RMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKGSMAQAGDLLRE  411
            R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+K  M Q GD   +
Sbjct  3    RIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRIIKQFMVQGGDFSNQ  62

Query  412  DGNFGESIYGGKFPDELPKLKHDSPGLLSMAIADRDIRGSLFMVTFNALHHL  567
            +G  GESIYG KF DE    KHD PGLLSMA A     GS F +T     HL
Sbjct  63   NGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGPGTNGSQFFITTVPTSHL  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960