BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF031B02

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772199.1|  PREDICTED: mitochondrial outer membrane prot...    284   5e-93   Nicotiana sylvestris
ref|XP_004228386.1|  PREDICTED: mitochondrial outer membrane prot...    283   7e-93   Solanum lycopersicum
ref|XP_009627246.1|  PREDICTED: mitochondrial outer membrane prot...    283   1e-92   Nicotiana tomentosiformis
ref|NP_001275134.1|  mitochondrial outer membrane protein porin o...    282   2e-92   Solanum tuberosum [potatoes]
emb|CAA56601.1|  36kDa porin I                                          280   1e-91   Solanum tuberosum [potatoes]
ref|XP_009797869.1|  PREDICTED: mitochondrial outer membrane prot...    278   7e-91   Nicotiana sylvestris
ref|XP_009599229.1|  PREDICTED: mitochondrial outer membrane prot...    277   3e-90   Nicotiana tomentosiformis
emb|CDP00288.1|  unnamed protein product                                273   7e-89   Coffea canephora [robusta coffee]
emb|CBI32017.3|  unnamed protein product                                271   1e-88   Vitis vinifera
ref|XP_002276636.1|  PREDICTED: mitochondrial outer membrane prot...    271   3e-88   Vitis vinifera
emb|CDP00287.1|  unnamed protein product                                270   2e-87   Coffea canephora [robusta coffee]
gb|KDO82798.1|  hypothetical protein CISIN_1g0238541mg                  263   2e-86   Citrus sinensis [apfelsine]
ref|XP_010096343.1|  Mitochondrial outer membrane protein porin o...    266   6e-86   Morus notabilis
ref|XP_006438620.1|  hypothetical protein CICLE_v10032366mg             264   2e-85   Citrus clementina [clementine]
ref|XP_006483230.1|  PREDICTED: mitochondrial outer membrane prot...    264   2e-85   Citrus sinensis [apfelsine]
ref|XP_010066951.1|  PREDICTED: mitochondrial outer membrane prot...    263   5e-85   Eucalyptus grandis [rose gum]
ref|XP_007046222.1|  Mitochondrial outer membrane protein porin 1...    261   9e-85   
gb|AAA96275.1|  voltage-dependent anion channel protein                 261   3e-84   Spinacia oleracea
ref|XP_007046221.1|  Voltage dependent anion channel 1 isoform 1        261   6e-84   Theobroma cacao [chocolate]
ref|XP_010683253.1|  PREDICTED: mitochondrial outer membrane prot...    260   1e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008339931.1|  PREDICTED: mitochondrial outer membrane prot...    259   2e-83   
ref|XP_011010796.1|  PREDICTED: mitochondrial outer membrane prot...    258   8e-83   Populus euphratica
gb|AAQ87021.1|  VDAC1.3                                                 258   9e-83   Lotus japonicus
gb|KHG20441.1|  Mitochondrial outer membrane porin of 36 kDa            258   1e-82   Gossypium arboreum [tree cotton]
ref|XP_010242364.1|  PREDICTED: mitochondrial outer membrane prot...    257   1e-82   Nelumbo nucifera [Indian lotus]
gb|KJB50696.1|  hypothetical protein B456_008G182700                    257   1e-82   Gossypium raimondii
ref|XP_008443436.1|  PREDICTED: mitochondrial outer membrane prot...    257   1e-82   Cucumis melo [Oriental melon]
ref|XP_010087805.1|  Mitochondrial outer membrane protein porin o...    257   1e-82   Morus notabilis
ref|XP_004147460.1|  PREDICTED: mitochondrial outer membrane prot...    257   2e-82   
ref|XP_009360395.1|  PREDICTED: mitochondrial outer membrane prot...    256   3e-82   Pyrus x bretschneideri [bai li]
gb|KJB60740.1|  hypothetical protein B456_009G323300                    253   4e-82   Gossypium raimondii
ref|XP_006431074.1|  hypothetical protein CICLE_v10012445mg             256   5e-82   Citrus clementina [clementine]
ref|XP_010256458.1|  PREDICTED: mitochondrial outer membrane prot...    256   5e-82   Nelumbo nucifera [Indian lotus]
ref|XP_006482536.1|  PREDICTED: mitochondrial outer membrane prot...    256   6e-82   Citrus sinensis [apfelsine]
ref|XP_011086392.1|  PREDICTED: mitochondrial outer membrane prot...    256   6e-82   Sesamum indicum [beniseed]
ref|XP_011071026.1|  PREDICTED: mitochondrial outer membrane prot...    255   8e-82   Sesamum indicum [beniseed]
ref|XP_008389525.1|  PREDICTED: mitochondrial outer membrane prot...    255   1e-81   Malus domestica [apple tree]
gb|KJB60742.1|  hypothetical protein B456_009G323300                    252   1e-81   Gossypium raimondii
dbj|BAG09387.1|  peroxisomal voltage-dependent anion-selective ch...    251   2e-81   Glycine max [soybeans]
gb|AFK37646.1|  unknown                                                 250   3e-81   Lotus japonicus
ref|XP_004297335.1|  PREDICTED: mitochondrial outer membrane prot...    254   3e-81   Fragaria vesca subsp. vesca
gb|KJB30016.1|  hypothetical protein B456_005G139100                    250   4e-81   Gossypium raimondii
ref|XP_008221678.1|  PREDICTED: mitochondrial outer membrane prot...    253   4e-81   Prunus mume [ume]
gb|KJB60739.1|  hypothetical protein B456_009G323300                    253   4e-81   Gossypium raimondii
gb|AAD38145.1|AF139498_1  porin                                         253   5e-81   Prunus armeniaca
ref|XP_009798894.1|  PREDICTED: mitochondrial outer membrane prot...    253   5e-81   Nicotiana sylvestris
gb|EYU22439.1|  hypothetical protein MIMGU_mgv1a011543mg                253   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_011034213.1|  PREDICTED: mitochondrial outer membrane prot...    253   8e-81   Populus euphratica
ref|XP_006378154.1|  porin family protein                               253   8e-81   Populus trichocarpa [western balsam poplar]
gb|ACU19720.1|  unknown                                                 251   8e-81   Glycine max [soybeans]
ref|XP_009587690.1|  PREDICTED: mitochondrial outer membrane prot...    253   9e-81   Nicotiana tomentosiformis
gb|KHG13762.1|  Mitochondrial outer membrane porin of 36 kDa            252   1e-80   Gossypium arboreum [tree cotton]
ref|XP_010029375.1|  PREDICTED: mitochondrial outer membrane prot...    252   1e-80   Eucalyptus grandis [rose gum]
gb|EYU28705.1|  hypothetical protein MIMGU_mgv1a011554mg                252   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_003554316.1|  PREDICTED: mitochondrial outer membrane prot...    251   2e-80   Glycine max [soybeans]
ref|XP_007032450.1|  Voltage dependent anion channel 1                  251   2e-80   
ref|XP_002312708.1|  porin family protein                               251   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_003543710.1|  PREDICTED: outer plastidial membrane protein...    251   2e-80   Glycine max [soybeans]
gb|AID59897.1|  voltage-dependent anion channel protein                 251   2e-80   Prunus persica
gb|AAQ87020.1|  VDAC1.2                                                 251   3e-80   Lotus japonicus
gb|KJB30018.1|  hypothetical protein B456_005G139100                    251   3e-80   Gossypium raimondii
ref|XP_003532049.1|  PREDICTED: mitochondrial outer membrane prot...    251   4e-80   Glycine max [soybeans]
gb|KHN13242.1|  Outer plastidial membrane protein porin                 251   4e-80   Glycine soja [wild soybean]
gb|KHG03636.1|  Mitochondrial outer membrane porin of 34 kDa            251   4e-80   Gossypium arboreum [tree cotton]
gb|AAB38498.1|  porin                                                   251   4e-80   Mesembryanthemum crystallinum
ref|XP_007215668.1|  hypothetical protein PRUPE_ppa008585mg             253   5e-80   
ref|XP_007153842.1|  hypothetical protein PHAVU_003G069300g             250   8e-80   Phaseolus vulgaris [French bean]
ref|XP_007222361.1|  hypothetical protein PRUPE_ppa008111mg             252   8e-80   
ref|NP_001275154.1|  mitochondrial outer membrane protein porin o...    249   2e-79   Solanum tuberosum [potatoes]
ref|XP_004233349.1|  PREDICTED: mitochondrial outer membrane prot...    249   2e-79   Solanum lycopersicum
gb|KJB33661.1|  hypothetical protein B456_006G024700                    249   3e-79   Gossypium raimondii
ref|NP_001241054.1|  uncharacterized protein LOC100805016               248   3e-79   Glycine max [soybeans]
ref|XP_008379329.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    248   4e-79   Malus domestica [apple tree]
gb|KDP21225.1|  hypothetical protein JCGZ_21696                         248   5e-79   Jatropha curcas
gb|AFK40985.1|  unknown                                                 248   6e-79   Lotus japonicus
ref|XP_010550070.1|  PREDICTED: mitochondrial outer membrane prot...    248   8e-79   Tarenaya hassleriana [spider flower]
gb|EPS57816.1|  hypothetical protein M569_17001                         248   9e-79   Genlisea aurea
ref|XP_007139603.1|  hypothetical protein PHAVU_008G043800g             247   1e-78   Phaseolus vulgaris [French bean]
ref|XP_011085779.1|  PREDICTED: mitochondrial outer membrane prot...    246   3e-78   Sesamum indicum [beniseed]
ref|XP_011085778.1|  PREDICTED: mitochondrial outer membrane prot...    246   3e-78   Sesamum indicum [beniseed]
gb|AAY82249.1|  mitochrondrial voltage-dependent anion-selective ...    246   3e-78   Phaseolus coccineus [scarlet runner bean]
gb|KGN47800.1|  hypothetical protein Csa_6G404150                       248   4e-78   Cucumis sativus [cucumbers]
gb|KHN11584.1|  Outer plastidial membrane protein porin                 245   7e-78   Glycine soja [wild soybean]
ref|XP_008230727.1|  PREDICTED: mitochondrial outer membrane prot...    245   7e-78   Prunus mume [ume]
ref|XP_010524325.1|  PREDICTED: mitochondrial outer membrane prot...    245   7e-78   Tarenaya hassleriana [spider flower]
ref|XP_004146750.1|  PREDICTED: mitochondrial outer membrane prot...    245   7e-78   Cucumis sativus [cucumbers]
gb|ACU20122.1|  unknown                                                 245   8e-78   Glycine max [soybeans]
ref|XP_008456460.1|  PREDICTED: mitochondrial outer membrane prot...    245   9e-78   Cucumis melo [Oriental melon]
emb|CAN67632.1|  hypothetical protein VITISV_019646                     241   1e-77   Vitis vinifera
ref|XP_009779190.1|  PREDICTED: mitochondrial outer membrane prot...    244   1e-77   Nicotiana sylvestris
ref|XP_004234781.2|  PREDICTED: mitochondrial outer membrane prot...    244   2e-77   Solanum lycopersicum
dbj|BAF95070.1|  voltage-dependent anion channel                        244   2e-77   Nicotiana tabacum [American tobacco]
ref|NP_001238377.1|  peroxisomal voltage-dependent anion-selectiv...    244   2e-77   Glycine max [soybeans]
ref|XP_006842115.1|  hypothetical protein AMTR_s00078p00100600          244   3e-77   Amborella trichopoda
ref|XP_002520135.1|  voltage-dependent anion-selective channel, p...    243   3e-77   Ricinus communis
ref|XP_011098570.1|  PREDICTED: mitochondrial outer membrane prot...    243   4e-77   Sesamum indicum [beniseed]
emb|CDP02196.1|  unnamed protein product                                243   4e-77   Coffea canephora [robusta coffee]
ref|XP_003552508.1|  PREDICTED: outer plastidial membrane protein...    243   5e-77   Glycine max [soybeans]
gb|AAQ87019.1|  VDAC1.1                                                 243   5e-77   Lotus japonicus
ref|XP_004514771.1|  PREDICTED: mitochondrial outer membrane prot...    243   5e-77   Cicer arietinum [garbanzo]
gb|AIL25718.1|  voltage-dependent anion channel                         243   5e-77   Nicotiana tabacum [American tobacco]
gb|ACU24178.1|  unknown                                                 243   5e-77   Glycine max [soybeans]
gb|KJB11403.1|  hypothetical protein B456_001G256800                    243   6e-77   Gossypium raimondii
gb|KJB11402.1|  hypothetical protein B456_001G256800                    243   6e-77   Gossypium raimondii
gb|ABC01904.1|  34 kDa outer mitochondrial membrane protein porin...    243   6e-77   Solanum tuberosum [potatoes]
ref|XP_006361834.1|  PREDICTED: uncharacterized LOC102577832            243   6e-77   Solanum tuberosum [potatoes]
gb|KHG01383.1|  Mitochondrial outer membrane porin of 36 kDa            242   8e-77   Gossypium arboreum [tree cotton]
gb|AFK39621.1|  unknown                                                 242   1e-76   Lotus japonicus
ref|XP_011005064.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-76   Populus euphratica
ref|XP_002282471.1|  PREDICTED: mitochondrial outer membrane prot...    242   1e-76   Vitis vinifera
ref|XP_002324035.1|  hypothetical protein POPTR_0017s11430g             242   1e-76   Populus trichocarpa [western balsam poplar]
ref|XP_009596455.1|  PREDICTED: mitochondrial outer membrane prot...    241   2e-76   Nicotiana tomentosiformis
sp|P42054.2|VDAC_PEA  RecName: Full=Outer plastidial membrane pro...    241   2e-76   Pisum sativum [garden pea]
gb|EYU34669.1|  hypothetical protein MIMGU_mgv1a011608mg                241   4e-76   Erythranthe guttata [common monkey flower]
ref|XP_010033217.1|  PREDICTED: mitochondrial outer membrane prot...    240   5e-76   Eucalyptus grandis [rose gum]
gb|EPS68383.1|  hypothetical protein M569_06388                         240   9e-76   Genlisea aurea
ref|XP_004302356.1|  PREDICTED: mitochondrial outer membrane prot...    238   4e-75   Fragaria vesca subsp. vesca
gb|KJB11404.1|  hypothetical protein B456_001G256800                    237   1e-74   Gossypium raimondii
ref|XP_004489372.1|  PREDICTED: outer plastidial membrane protein...    237   1e-74   Cicer arietinum [garbanzo]
gb|KDP45473.1|  hypothetical protein JCGZ_09722                         236   2e-74   Jatropha curcas
ref|XP_008341536.1|  PREDICTED: outer plastidial membrane protein...    235   7e-74   Malus domestica [apple tree]
gb|EYU34113.1|  hypothetical protein MIMGU_mgv1a011597mg                234   2e-73   Erythranthe guttata [common monkey flower]
ref|XP_004489166.1|  PREDICTED: outer plastidial membrane protein...    232   1e-72   Cicer arietinum [garbanzo]
gb|KEH19833.1|  porin/voltage-dependent anion-selective channel p...    231   4e-72   Medicago truncatula
gb|ACJ85279.1|  unknown                                                 231   4e-72   Medicago truncatula
ref|XP_010670319.1|  PREDICTED: mitochondrial outer membrane prot...    230   7e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24200.1|  unknown                                                 229   1e-71   Picea sitchensis
gb|AFK34190.1|  unknown                                                 229   2e-71   Medicago truncatula
emb|CAJ42303.1|  VDAC-like porin                                        228   3e-71   Plantago major [cart-track plant]
ref|XP_002517470.1|  voltage-dependent anion-selective channel, p...    228   5e-71   Ricinus communis
gb|KHG10147.1|  Mitochondrial outer membrane porin of 34 kDa            226   1e-70   Gossypium arboreum [tree cotton]
pir||B55017  porin, plastid - garden pea                                225   4e-70
emb|CDY63765.1|  BnaCnng42590D                                          225   7e-70   Brassica napus [oilseed rape]
ref|NP_001288964.1|  mitochondrial outer membrane protein porin 3       224   7e-70   Brassica rapa
emb|CDX85566.1|  BnaA02g02470D                                          224   8e-70   
gb|KFK37589.1|  hypothetical protein AALP_AA3G002700                    223   3e-69   Arabis alpina [alpine rockcress]
gb|KHN45480.1|  Mitochondrial outer membrane protein porin of 34 kDa    222   4e-69   Glycine soja [wild soybean]
ref|XP_006298185.1|  hypothetical protein CARUB_v10014234mg             223   5e-69   
ref|XP_010463547.1|  PREDICTED: mitochondrial outer membrane prot...    221   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010485517.1|  PREDICTED: mitochondrial outer membrane prot...    221   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010453637.1|  PREDICTED: mitochondrial outer membrane prot...    220   4e-68   Camelina sativa [gold-of-pleasure]
emb|CDX91952.1|  BnaC03g32540D                                          220   5e-68   
emb|CDY28690.1|  BnaCnng05760D                                          220   5e-68   Brassica napus [oilseed rape]
ref|XP_010420161.1|  PREDICTED: mitochondrial outer membrane prot...    220   6e-68   Camelina sativa [gold-of-pleasure]
gb|AAM65525.1|  putative porin                                          219   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186777.1|  voltage dependent anion channel 1                     219   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492333.1|  PREDICTED: mitochondrial outer membrane prot...    219   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010512938.1|  PREDICTED: mitochondrial outer membrane prot...    219   1e-67   Camelina sativa [gold-of-pleasure]
gb|AAW22621.1|  outer mitochondrial membrane protein porin 1            219   2e-67   Brassica napus [oilseed rape]
ref|XP_009131920.1|  PREDICTED: mitochondrial outer membrane prot...    219   2e-67   Brassica rapa
emb|CDY66736.1|  BnaCnng52100D                                          218   2e-67   Brassica napus [oilseed rape]
ref|XP_006408480.1|  hypothetical protein EUTSA_v10021076mg             220   3e-67   
ref|XP_009125035.1|  PREDICTED: mitochondrial outer membrane prot...    218   3e-67   Brassica rapa
ref|XP_006400027.1|  hypothetical protein EUTSA_v10014354mg             217   6e-67   Eutrema salsugineum [saltwater cress]
ref|XP_002884286.1|  hypothetical protein ARALYDRAFT_477400             217   8e-67   
gb|AAM62480.1|  voltage-dependent anion-selective channel protein...    216   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134621.1|  PREDICTED: mitochondrial outer membrane prot...    217   1e-66   Brassica rapa
ref|XP_003621109.1|  Outer plastidial membrane protein porin            217   1e-66   Medicago truncatula
gb|AFK38338.1|  unknown                                                 216   1e-66   Medicago truncatula
ref|XP_002873707.1|  voltage-dependent anion-selective channel pr...    216   1e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_009147408.1|  PREDICTED: mitochondrial outer membrane prot...    216   1e-66   Brassica rapa
emb|CDY68122.1|  BnaA05g37480D                                          216   1e-66   Brassica napus [oilseed rape]
gb|KFK25745.1|  hypothetical protein AALP_AA8G154100                    216   1e-66   Arabis alpina [alpine rockcress]
gb|ACJ85253.1|  unknown                                                 215   3e-66   Medicago truncatula
ref|NP_197013.1|  voltage dependent anion channel 3                     215   5e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74294.1|  BnaA03g27530D                                          214   1e-65   
gb|KJB30017.1|  hypothetical protein B456_005G139100                    212   2e-65   Gossypium raimondii
ref|XP_006286537.1|  hypothetical protein CARUB_v10001678mg             213   3e-65   Capsella rubella
ref|XP_010932447.1|  PREDICTED: mitochondrial outer membrane prot...    213   3e-65   Elaeis guineensis
ref|XP_008808420.1|  PREDICTED: mitochondrial outer membrane prot...    213   3e-65   Phoenix dactylifera
emb|CDY59668.1|  BnaCnng35410D                                          212   9e-65   Brassica napus [oilseed rape]
ref|XP_010925058.1|  PREDICTED: mitochondrial outer membrane prot...    211   1e-64   Elaeis guineensis
ref|XP_008775594.1|  PREDICTED: mitochondrial outer membrane prot...    211   2e-64   Phoenix dactylifera
ref|XP_008786741.1|  PREDICTED: mitochondrial outer membrane prot...    210   3e-64   Phoenix dactylifera
gb|KHG07129.1|  Mitochondrial outer membrane protein porin of 34 kDa    212   5e-64   Gossypium arboreum [tree cotton]
gb|AAS48868.1|  voltage-dependent anion-selective channel               209   1e-63   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009410756.1|  PREDICTED: mitochondrial outer membrane prot...    207   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001288856.1|  mitochondrial outer membrane protein porin 3...    207   5e-63   Brassica rapa
ref|XP_010925360.1|  PREDICTED: mitochondrial outer membrane prot...    207   5e-63   Elaeis guineensis
ref|XP_009408682.1|  PREDICTED: mitochondrial outer membrane prot...    206   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660565.1|  PREDICTED: mitochondrial outer membrane prot...    204   5e-62   Oryza brachyantha
gb|KHG07130.1|  Mitochondrial outer membrane protein porin of 34 kDa    202   2e-61   Gossypium arboreum [tree cotton]
gb|EAZ08792.1|  hypothetical protein OsI_31052                          203   2e-61   Oryza sativa Indica Group [Indian rice]
gb|EAZ44453.1|  hypothetical protein OsJ_29066                          203   2e-61   Oryza sativa Japonica Group [Japonica rice]
sp|P46274.1|VDAC1_WHEAT  RecName: Full=Mitochondrial outer membra...    203   2e-61   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001062983.1|  Os09g0361400                                       203   2e-61   
gb|KDO82799.1|  hypothetical protein CISIN_1g0238541mg                  198   6e-61   Citrus sinensis [apfelsine]
ref|XP_004956656.1|  PREDICTED: mitochondrial outer membrane prot...    201   9e-61   Setaria italica
ref|XP_002460110.1|  hypothetical protein SORBIDRAFT_02g022910          201   1e-60   Sorghum bicolor [broomcorn]
ref|XP_009403419.1|  PREDICTED: mitochondrial outer membrane prot...    201   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578022.1|  PREDICTED: mitochondrial outer membrane porin      200   3e-60   Brachypodium distachyon [annual false brome]
ref|NP_001105619.1|  voltage-dependent anion channel protein1a          200   4e-60   Zea mays [maize]
ref|XP_009408829.1|  PREDICTED: mitochondrial outer membrane prot...    199   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF85328.1|  unknown                                                 198   1e-59   Zea mays [maize]
ref|XP_009393634.1|  PREDICTED: mitochondrial outer membrane prot...    197   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK23226.1|  unknown                                                 195   2e-58   Picea sitchensis
tpg|DAA61162.1|  TPA: voltage-dependent anion-selective channel p...    195   2e-58   
ref|NP_001104948.1|  voltage-dependent anion channel protein1b          194   9e-58   
gb|EMS51310.1|  Mitochondrial outer membrane porin                      201   1e-57   Triticum urartu
gb|EMS47295.1|  Outer plastidial membrane protein porin                 192   3e-57   Triticum urartu
emb|CAA57646.1|  Voltage dependent anion channel (VDAC)                 192   4e-57   Triticum aestivum [Canadian hard winter wheat]
emb|CDM83072.1|  unnamed protein product                                191   6e-57   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ99489.1|  predicted protein                                      191   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT02908.1|  Mitochondrial outer membrane porin                      199   2e-56   
ref|XP_006646048.1|  PREDICTED: mitochondrial outer membrane prot...    190   3e-56   Oryza brachyantha
ref|NP_001043433.1|  Os01g0588200                                       189   6e-56   
ref|XP_004969385.1|  PREDICTED: mitochondrial outer membrane prot...    188   1e-55   Setaria italica
ref|XP_010231957.1|  PREDICTED: mitochondrial outer membrane prot...    187   2e-55   Brachypodium distachyon [annual false brome]
gb|KCW56275.1|  hypothetical protein EUGRSUZ_I02018                     186   4e-55   Eucalyptus grandis [rose gum]
ref|XP_002458065.1|  hypothetical protein SORBIDRAFT_03g026350          186   9e-55   Sorghum bicolor [broomcorn]
ref|XP_001779057.1|  predicted protein                                  185   1e-54   
dbj|BAL41368.1|  porin                                                  182   4e-54   Arum maculatum [cuckoo-pint]
gb|AFW83107.1|  outer plastidial membrane protein porin                 183   8e-54   
ref|XP_001781995.1|  predicted protein                                  183   1e-53   
gb|ACG45954.1|  outer plastidial membrane protein porin                 182   2e-53   Zea mays [maize]
ref|NP_001278544.1|  outer plastidial membrane protein porin            182   3e-53   Zea mays [maize]
sp|P42057.1|VDAC_MAIZE  RecName: Full=Outer plastidial membrane p...    182   4e-53   Zea mays [maize]
ref|XP_006298184.1|  hypothetical protein CARUB_v10014234mg             181   5e-53   
ref|NP_001141587.1|  outer plastidial membrane protein porin            179   6e-52   Zea mays [maize]
gb|ACG25664.1|  outer plastidial membrane protein porin                 177   2e-51   Zea mays [maize]
gb|ADE77918.1|  unknown                                                 177   2e-51   Picea sitchensis
ref|XP_004969745.1|  PREDICTED: mitochondrial outer membrane prot...    175   1e-50   Setaria italica
ref|NP_001056162.1|  Os05g0536200                                       175   2e-50   
ref|XP_006845625.1|  hypothetical protein AMTR_s00019p00217910          174   2e-50   Amborella trichopoda
ref|XP_006655528.1|  PREDICTED: mitochondrial outer membrane prot...    172   1e-49   Oryza brachyantha
ref|XP_002964960.1|  hypothetical protein SELMODRAFT_143103             171   9e-49   Selaginella moellendorffii
gb|KJB34748.1|  hypothetical protein B456_006G081500                    169   1e-48   Gossypium raimondii
ref|XP_002973372.1|  hypothetical protein SELMODRAFT_271012             170   1e-48   Selaginella moellendorffii
ref|XP_002976531.1|  hypothetical protein SELMODRAFT_267998             170   1e-48   Selaginella moellendorffii
ref|XP_004961383.1|  PREDICTED: mitochondrial outer membrane prot...    169   2e-48   Setaria italica
ref|XP_010942794.1|  PREDICTED: mitochondrial outer membrane prot...    169   4e-48   
ref|XP_008338437.1|  PREDICTED: mitochondrial outer membrane prot...    168   9e-48   
ref|XP_009354614.1|  PREDICTED: mitochondrial outer membrane prot...    167   2e-47   Pyrus x bretschneideri [bai li]
gb|KJB30164.1|  hypothetical protein B456_005G132100                    169   2e-47   Gossypium raimondii
ref|XP_008787191.1|  PREDICTED: mitochondrial outer membrane prot...    166   4e-47   Phoenix dactylifera
ref|XP_008354718.1|  PREDICTED: mitochondrial outer membrane prot...    166   5e-47   Malus domestica [apple tree]
ref|XP_007205702.1|  hypothetical protein PRUPE_ppa009821mg             166   6e-47   Prunus persica
ref|XP_003568015.1|  PREDICTED: mitochondrial outer membrane prot...    165   9e-47   Brachypodium distachyon [annual false brome]
ref|XP_002458403.1|  hypothetical protein SORBIDRAFT_03g032840          164   3e-46   Sorghum bicolor [broomcorn]
ref|XP_008238010.1|  PREDICTED: mitochondrial outer membrane prot...    164   3e-46   Prunus mume [ume]
ref|XP_009150694.1|  PREDICTED: mitochondrial outer membrane prot...    163   6e-46   Brassica rapa
ref|XP_006649363.1|  PREDICTED: mitochondrial outer membrane prot...    163   7e-46   Oryza brachyantha
emb|CDY08723.1|  BnaA06g25010D                                          162   9e-46   Brassica napus [oilseed rape]
emb|CAA63968.1|  pom30                                                  162   1e-45   Solanum tuberosum [potatoes]
ref|XP_004231921.1|  PREDICTED: mitochondrial outer membrane prot...    164   2e-45   
ref|XP_006649583.1|  PREDICTED: mitochondrial outer membrane prot...    162   2e-45   Oryza brachyantha
ref|XP_002279650.2|  PREDICTED: mitochondrial outer membrane prot...    162   2e-45   Vitis vinifera
ref|XP_010652706.1|  PREDICTED: mitochondrial outer membrane prot...    162   2e-45   Vitis vinifera
emb|CDY36497.1|  BnaC03g48560D                                          160   7e-45   Brassica napus [oilseed rape]
emb|CAA57647.1|  Voltage dependent anion channel (VDAC)                 159   1e-44   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001049301.1|  Os03g0202200                                       159   2e-44   
ref|XP_008457836.1|  PREDICTED: mitochondrial outer membrane prot...    159   2e-44   Cucumis melo [Oriental melon]
ref|XP_006841082.1|  hypothetical protein AMTR_s00086p00035910          159   2e-44   Amborella trichopoda
ref|NP_001048902.1|  Os03g0137500                                       159   2e-44   
gb|EEC74475.1|  hypothetical protein OsI_09925                          159   3e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006381815.1|  VDAC3.1 family protein                             158   5e-44   Populus trichocarpa [western balsam poplar]
ref|XP_008805677.1|  PREDICTED: mitochondrial outer membrane prot...    158   5e-44   Phoenix dactylifera
ref|XP_010551867.1|  PREDICTED: mitochondrial outer membrane prot...    155   6e-44   Tarenaya hassleriana [spider flower]
ref|XP_009386273.1|  PREDICTED: mitochondrial outer membrane prot...    158   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004288248.1|  PREDICTED: mitochondrial outer membrane prot...    157   9e-44   Fragaria vesca subsp. vesca
ref|XP_004148030.1|  PREDICTED: mitochondrial outer membrane prot...    157   1e-43   Cucumis sativus [cucumbers]
ref|XP_002440144.1|  hypothetical protein SORBIDRAFT_09g026790          157   2e-43   Sorghum bicolor [broomcorn]
emb|CDP02599.1|  unnamed protein product                                157   2e-43   Coffea canephora [robusta coffee]
ref|XP_009801997.1|  PREDICTED: mitochondrial outer membrane prot...    157   2e-43   Nicotiana sylvestris
ref|XP_009770519.1|  PREDICTED: mitochondrial outer membrane prot...    156   2e-43   Nicotiana sylvestris
ref|XP_003558558.1|  PREDICTED: mitochondrial outer membrane prot...    156   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_011007586.1|  PREDICTED: mitochondrial outer membrane prot...    156   2e-43   Populus euphratica
ref|XP_009615970.1|  PREDICTED: mitochondrial outer membrane prot...    156   3e-43   Nicotiana tomentosiformis
ref|XP_009411051.1|  PREDICTED: mitochondrial outer membrane prot...    156   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003569678.1|  PREDICTED: mitochondrial outer membrane prot...    157   4e-43   Brachypodium distachyon [annual false brome]
ref|XP_007047520.1|  Voltage dependent anion channel 2                  155   4e-43   
ref|NP_001104949.1|  voltage-dependent anion channel protein2           155   4e-43   Zea mays [maize]
ref|XP_010550330.1|  PREDICTED: mitochondrial outer membrane prot...    155   5e-43   Tarenaya hassleriana [spider flower]
ref|XP_010938962.1|  PREDICTED: mitochondrial outer membrane prot...    155   5e-43   Elaeis guineensis
ref|XP_009604076.1|  PREDICTED: mitochondrial outer membrane prot...    155   6e-43   Nicotiana tomentosiformis
ref|XP_010943374.1|  PREDICTED: mitochondrial outer membrane prot...    155   6e-43   Elaeis guineensis
ref|XP_002984740.1|  hypothetical protein SELMODRAFT_156847             155   1e-42   
gb|KJB48714.1|  hypothetical protein B456_008G082900                    154   1e-42   Gossypium raimondii
ref|XP_007018499.1|  Voltage dependent anion channel 2                  154   1e-42   Theobroma cacao [chocolate]
dbj|BAJ99317.1|  predicted protein                                      155   1e-42   
ref|XP_010046987.1|  PREDICTED: mitochondrial outer membrane prot...    154   2e-42   
gb|KCW78721.1|  hypothetical protein EUGRSUZ_C00165                     155   2e-42   
gb|AAL04449.1|  voltage-dependent anion channel                         148   2e-42   
ref|XP_008777255.1|  PREDICTED: mitochondrial outer membrane prot...    154   2e-42   
ref|XP_002525270.1|  voltage-dependent anion-selective channel, p...    154   2e-42   
gb|KCW78720.1|  hypothetical protein EUGRSUZ_C00165                     155   2e-42   
ref|XP_002465683.1|  hypothetical protein SORBIDRAFT_01g043700          154   2e-42   
ref|XP_006644617.1|  PREDICTED: mitochondrial outer membrane prot...    155   2e-42   
ref|NP_001147486.1|  outer mitochondrial membrane protein porin         154   2e-42   
gb|AAW22622.1|  porin-like protein                                      154   3e-42   
ref|XP_009112213.1|  PREDICTED: mitochondrial outer membrane prot...    154   3e-42   
ref|XP_002306507.2|  hypothetical protein POPTR_0005s19050g             155   3e-42   
gb|KDP32072.1|  hypothetical protein JCGZ_12533                         153   3e-42   
gb|ABB16970.1|  POM30-like protein                                      153   4e-42   
emb|CDY18662.1|  BnaA09g07330D                                          153   4e-42   
ref|XP_010247341.1|  PREDICTED: mitochondrial outer membrane prot...    153   4e-42   
ref|XP_006393957.1|  hypothetical protein EUTSA_v10004631mg             154   4e-42   
ref|XP_010102769.1|  Mitochondrial outer membrane protein porin 2       153   4e-42   
gb|KHG00012.1|  Mitochondrial outer membrane porin 2 -like protein      153   5e-42   
sp|Q0JJV1.3|VDAC4_ORYSJ  RecName: Full=Mitochondrial outer membra...    154   6e-42   
ref|XP_006426127.1|  hypothetical protein CICLE_v10026251mg             152   8e-42   
ref|XP_006600196.1|  PREDICTED: uncharacterized protein LOC100797...    152   8e-42   
ref|NP_201551.1|  voltage dependent anion channel 2                     152   1e-41   
ref|XP_011043983.1|  PREDICTED: mitochondrial outer membrane prot...    152   1e-41   
ref|XP_006280940.1|  hypothetical protein CARUB_v10026938mg             152   2e-41   
tpg|DAA43927.1|  TPA: outer membrane protein porin                      151   2e-41   
ref|NP_001239899.1|  uncharacterized protein LOC100790578               151   2e-41   
emb|CDX81312.1|  BnaC09g07230D                                          151   2e-41   
ref|XP_010484488.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-41   
ref|XP_009413143.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-41   
ref|XP_010444638.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-41   
ref|XP_004985298.1|  PREDICTED: mitochondrial outer membrane prot...    151   2e-41   
gb|AAP46186.1|  PgPOR29                                                 151   2e-41   
ref|XP_010463972.1|  PREDICTED: mitochondrial outer membrane prot...    151   3e-41   
ref|NP_001242630.1|  uncharacterized protein LOC100797369               150   3e-41   
ref|XP_009400023.1|  PREDICTED: mitochondrial outer membrane prot...    150   3e-41   
gb|KJB58633.1|  hypothetical protein B456_009G219700                    150   4e-41   
ref|XP_008805725.1|  PREDICTED: mitochondrial outer membrane prot...    150   4e-41   
ref|NP_001288497.1|  mitochondrial outer membrane protein porin 5       150   5e-41   
ref|XP_002866701.1|  hypothetical protein ARALYDRAFT_496845             150   6e-41   
ref|XP_002325061.1|  VDAC3.1 family protein                             150   6e-41   
gb|EMT32910.1|  Mitochondrial outer membrane protein porin              150   7e-41   
ref|XP_010272561.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-40   
gb|KJB23474.1|  hypothetical protein B456_004G100400                    146   1e-40   
ref|XP_011099371.1|  PREDICTED: mitochondrial outer membrane prot...    149   1e-40   
ref|XP_007154773.1|  hypothetical protein PHAVU_003G146600g             149   2e-40   
gb|KJB23472.1|  hypothetical protein B456_004G100400                    146   2e-40   
ref|XP_004234649.1|  PREDICTED: mitochondrial outer membrane prot...    149   2e-40   
ref|XP_006350613.1|  PREDICTED: mitochondrial outer membrane prot...    148   2e-40   
ref|XP_010918626.1|  PREDICTED: mitochondrial outer membrane prot...    148   3e-40   
gb|KDP41624.1|  hypothetical protein JCGZ_16031                         148   3e-40   
ref|XP_002866208.1|  hypothetical protein ARALYDRAFT_495848             148   4e-40   
ref|XP_011008399.1|  PREDICTED: mitochondrial outer membrane prot...    148   4e-40   
gb|KHN36298.1|  Mitochondrial outer membrane protein porin 2            148   5e-40   
ref|XP_003558860.1|  PREDICTED: mitochondrial outer membrane prot...    148   5e-40   
ref|XP_007156717.1|  hypothetical protein PHAVU_002G011300g             148   5e-40   
ref|NP_001241153.1|  uncharacterized protein LOC100818855               147   5e-40   
ref|NP_001152335.1|  outer mitochondrial membrane protein porin         148   7e-40   
ref|XP_010259833.1|  PREDICTED: mitochondrial outer membrane prot...    147   7e-40   
ref|XP_006593432.1|  PREDICTED: uncharacterized protein LOC100790...    147   8e-40   
gb|KJB23473.1|  hypothetical protein B456_004G100400                    147   8e-40   
gb|KFK28435.1|  hypothetical protein AALP_AA8G514300                    147   9e-40   
ref|NP_001242891.1|  uncharacterized protein LOC100790270               147   9e-40   
ref|XP_004511842.1|  PREDICTED: mitochondrial outer membrane prot...    147   1e-39   
ref|XP_009136524.1|  PREDICTED: mitochondrial outer membrane prot...    147   1e-39   
ref|NP_200557.1|  voltage dependent anion channel 4                     146   2e-39   
gb|AFK40966.1|  unknown                                                 142   2e-39   
ref|XP_006280944.1|  hypothetical protein CARUB_v10026945mg             146   2e-39   
ref|XP_010679633.1|  PREDICTED: mitochondrial outer membrane prot...    146   2e-39   
ref|XP_006453392.1|  hypothetical protein CICLE_v10009163mg             146   2e-39   
emb|CBI33688.3|  unnamed protein product                                142   2e-39   
ref|XP_010547555.1|  PREDICTED: mitochondrial outer membrane prot...    145   3e-39   
gb|KHG14881.1|  Mitochondrial outer membrane porin 2 -like protein      145   4e-39   
ref|XP_007014286.1|  Voltage dependent anion channel 4                  147   4e-39   
ref|XP_003611587.1|  Mitochondrial outer membrane protein porin         145   4e-39   
gb|KHG05706.1|  Mitochondrial outer membrane porin 4 -like protein      145   6e-39   
ref|XP_010688492.1|  PREDICTED: mitochondrial outer membrane prot...    145   7e-39   
tpg|DAA43264.1|  TPA: outer membrane protein porin                      144   8e-39   
gb|KJB43907.1|  hypothetical protein B456_007G223000                    144   9e-39   
gb|EYU20913.1|  hypothetical protein MIMGU_mgv1a011651mg                144   1e-38   
ref|XP_009338032.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-38   
ref|XP_006662285.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-38   
ref|XP_004498999.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-38   
emb|CDY02103.1|  BnaA03g40640D                                          144   2e-38   
ref|XP_008223703.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-38   
ref|XP_004507844.1|  PREDICTED: mitochondrial outer membrane prot...    144   2e-38   
gb|AAQ87023.1|  VDAC3.1                                                 143   3e-38   
ref|XP_009614284.1|  PREDICTED: mitochondrial outer membrane prot...    143   3e-38   
emb|CDX88625.1|  BnaA03g10240D                                          143   3e-38   
emb|CDY11866.1|  BnaC03g12920D                                          143   3e-38   
ref|XP_009132124.1|  PREDICTED: mitochondrial outer membrane prot...    143   4e-38   
emb|CDP02971.1|  unnamed protein product                                144   4e-38   
ref|XP_002877711.1|  hypothetical protein ARALYDRAFT_323570             143   4e-38   
ref|XP_008453611.1|  PREDICTED: mitochondrial outer membrane prot...    143   4e-38   
ref|NP_001147762.1|  outer mitochondrial membrane protein porin         142   6e-38   
ref|XP_007222510.1|  hypothetical protein PRUPE_ppa009817mg             142   6e-38   
ref|XP_010545418.1|  PREDICTED: mitochondrial outer membrane prot...    142   7e-38   
ref|XP_010452150.1|  PREDICTED: mitochondrial outer membrane prot...    142   8e-38   
ref|XP_008363546.1|  PREDICTED: mitochondrial outer membrane prot...    142   9e-38   
ref|XP_010551868.1|  PREDICTED: mitochondrial outer membrane prot...    138   9e-38   
ref|XP_006404089.1|  hypothetical protein EUTSA_v10010622mg             142   1e-37   
ref|XP_004507845.1|  PREDICTED: mitochondrial outer membrane prot...    142   1e-37   
ref|XP_003610136.1|  Mitochondrial outer membrane protein porin         141   1e-37   
ref|XP_010539443.1|  PREDICTED: mitochondrial outer membrane prot...    141   2e-37   
ref|XP_011079306.1|  PREDICTED: mitochondrial outer membrane prot...    141   2e-37   
ref|XP_004146313.1|  PREDICTED: mitochondrial outer membrane prot...    141   2e-37   
ref|XP_010536913.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-37   
ref|XP_010443435.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-37   
emb|CAN64922.1|  hypothetical protein VITISV_017201                     140   3e-37   
ref|XP_002272180.1|  PREDICTED: mitochondrial outer membrane prot...    140   3e-37   
ref|XP_010483270.1|  PREDICTED: mitochondrial outer membrane prot...    140   4e-37   
ref|XP_010028100.1|  PREDICTED: mitochondrial outer membrane prot...    140   4e-37   
gb|KJB50697.1|  hypothetical protein B456_008G182700                    138   6e-37   
gb|EEC71387.1|  hypothetical protein OsI_03508                          140   6e-37   
ref|XP_009798280.1|  PREDICTED: mitochondrial outer membrane prot...    139   6e-37   
ref|XP_008351971.1|  PREDICTED: mitochondrial outer membrane prot...    139   6e-37   
gb|EYU29628.1|  hypothetical protein MIMGU_mgv1a011618mg                139   8e-37   
gb|ACJ85119.1|  unknown                                                 139   8e-37   
gb|AAC64164.1|  voltage-dependent anion-selective channel protein       134   1e-36   
ref|XP_004296415.1|  PREDICTED: mitochondrial outer membrane prot...    138   3e-36   
ref|NP_001149108.1|  outer mitochondrial membrane protein porin         138   3e-36   
ref|XP_002510098.1|  voltage-dependent anion-selective channel, p...    137   3e-36   
ref|XP_006366956.1|  PREDICTED: mitochondrial outer membrane prot...    137   4e-36   
gb|KJB31318.1|  hypothetical protein B456_005G186100                    137   4e-36   
gb|EMT20213.1|  Mitochondrial outer membrane porin                      144   4e-36   
ref|XP_011073688.1|  PREDICTED: mitochondrial outer membrane prot...    137   4e-36   
ref|XP_010999872.1|  PREDICTED: mitochondrial outer membrane prot...    137   5e-36   
ref|NP_001149101.1|  outer mitochondrial membrane protein porin         137   5e-36   
gb|ACG30926.1|  outer mitochondrial membrane protein porin              137   5e-36   
ref|XP_010323316.1|  PREDICTED: mitochondrial outer membrane prot...    137   5e-36   
ref|NP_001190641.1|  voltage dependent anion channel 2                  138   6e-36   
ref|XP_004290968.1|  PREDICTED: mitochondrial outer membrane prot...    137   7e-36   
ref|XP_003557011.2|  PREDICTED: mitochondrial outer membrane prot...    137   8e-36   
ref|XP_008777257.1|  PREDICTED: mitochondrial outer membrane prot...    136   9e-36   
ref|XP_006607011.1|  PREDICTED: mitochondrial outer membrane prot...    137   1e-35   
ref|XP_006607010.1|  PREDICTED: mitochondrial outer membrane prot...    137   1e-35   
gb|KHN07668.1|  Mitochondrial outer membrane protein porin 2            137   1e-35   
gb|AAQ87022.1|  VDAC2.1                                                 136   2e-35   
gb|AFK33448.1|  unknown                                                 136   2e-35   
ref|XP_006607009.1|  PREDICTED: mitochondrial outer membrane prot...    137   2e-35   
ref|XP_006380609.1|  VDAC2.1 family protein                             135   2e-35   
ref|XP_006401200.1|  hypothetical protein EUTSA_v10014362mg             135   2e-35   
gb|ACU23163.1|  unknown                                                 135   3e-35   
gb|KJB11405.1|  hypothetical protein B456_001G256800                    134   3e-35   
ref|XP_007160908.1|  hypothetical protein PHAVU_001G027200g             135   3e-35   
ref|NP_001044063.2|  Os01g0715500                                       136   4e-35   
ref|XP_008220333.1|  PREDICTED: mitochondrial outer membrane prot...    135   4e-35   
ref|XP_010943375.1|  PREDICTED: mitochondrial outer membrane prot...    134   4e-35   
ref|XP_002320689.2|  hypothetical protein POPTR_0014s01660g             135   5e-35   
gb|EMT12164.1|  Mitochondrial outer membrane protein porin of 34 kDa    134   6e-35   
ref|XP_010259832.1|  PREDICTED: mitochondrial outer membrane prot...    135   6e-35   
dbj|BAJ91367.1|  predicted protein                                      134   7e-35   
ref|XP_007227465.1|  hypothetical protein PRUPE_ppa009796mg             134   7e-35   
gb|KFK34258.1|  hypothetical protein AALP_AA5G121500                    134   1e-34   
ref|XP_004985785.1|  PREDICTED: mitochondrial outer membrane prot...    135   1e-34   
ref|XP_002468550.1|  hypothetical protein SORBIDRAFT_01g047800          133   2e-34   
gb|KHN17590.1|  Mitochondrial outer membrane protein porin 6            132   5e-34   
ref|XP_011011237.1|  PREDICTED: mitochondrial outer membrane prot...    132   5e-34   
ref|XP_010918628.1|  PREDICTED: mitochondrial outer membrane prot...    131   1e-33   
ref|XP_009360705.1|  PREDICTED: mitochondrial outer membrane prot...    130   2e-33   
ref|XP_006826371.1|  hypothetical protein AMTR_s00004p00132290          124   6e-33   
gb|EPS70241.1|  hypothetical protein M569_04517                         128   1e-32   
gb|EMS62963.1|  Mitochondrial outer membrane protein porin              134   1e-32   
ref|XP_010691575.1|  PREDICTED: mitochondrial outer membrane prot...    127   3e-32   
tpg|DAA43267.1|  TPA: hypothetical protein ZEAMMB73_938356              127   5e-32   
tpg|DAA43266.1|  TPA: hypothetical protein ZEAMMB73_938356              125   7e-32   
gb|KEH40016.1|  porin/voltage-dependent anion-selective channel p...    126   1e-31   
ref|XP_003589068.1|  Mitochondrial outer membrane protein porin         126   1e-31   
tpg|DAA43265.1|  TPA: hypothetical protein ZEAMMB73_938356              125   2e-31   
emb|CDP01200.1|  unnamed protein product                                125   2e-31   
ref|XP_008452645.1|  PREDICTED: mitochondrial outer membrane prot...    125   2e-31   
ref|XP_010061677.1|  PREDICTED: mitochondrial outer membrane prot...    125   3e-31   
ref|XP_004141289.1|  PREDICTED: mitochondrial outer membrane prot...    123   1e-30   
ref|XP_004983259.1|  PREDICTED: mitochondrial outer membrane prot...    123   2e-30   
emb|CDY23028.1|  BnaC07g31590D                                          120   5e-30   
ref|XP_010061676.1|  PREDICTED: mitochondrial outer membrane prot...    121   6e-30   
gb|EPS73591.1|  pom30 protein                                           120   1e-29   
ref|XP_008665842.1|  PREDICTED: mitochondrial outer membrane prot...    116   6e-29   
ref|XP_010101100.1|  Mitochondrial outer membrane protein porin 4       119   1e-28   
ref|XP_010551869.1|  PREDICTED: mitochondrial outer membrane prot...    112   3e-28   
ref|XP_006291699.1|  hypothetical protein CARUB_v10017863mg             114   2e-27   
gb|EEE58291.1|  hypothetical protein OsJ_09329                          117   9e-27   
gb|ABE77194.1|  putative voltage-dependent ion channel                  113   1e-26   
ref|XP_007201143.1|  hypothetical protein PRUPE_ppa016048mg             111   3e-26   
dbj|BAG92834.1|  unnamed protein product                                107   4e-26   
emb|CDY70638.1|  BnaCnng69120D                                          110   4e-26   
gb|ABF94514.1|  Eukaryotic porin family protein, expressed              108   2e-25   
dbj|BAD87377.1|  putative 36kDA porin II                                109   4e-25   
ref|XP_011030342.1|  PREDICTED: mitochondrial outer membrane prot...    105   6e-24   
ref|XP_008236314.1|  PREDICTED: mitochondrial outer membrane prot...    103   3e-23   
gb|EMS46046.1|  Mitochondrial outer membrane protein porin of 34 kDa    102   5e-23   
ref|XP_004172904.1|  PREDICTED: mitochondrial outer membrane prot...    102   7e-23   
gb|ABA26972.1|  TO25b-23rc                                            95.5    4e-22   
gb|KHN36963.1|  Mitochondrial outer membrane protein porin 5          99.4    1e-21   
ref|XP_002298773.1|  hypothetical protein POPTR_0001s30130g           99.4    2e-21   
ref|XP_010550772.1|  PREDICTED: mitochondrial outer membrane prot...  97.4    2e-21   
gb|KJB29688.1|  hypothetical protein B456_005G114000                  96.7    4e-21   
ref|XP_003550309.2|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...  97.4    6e-21   
ref|XP_006383551.1|  hypothetical protein POPTR_0005s19050g           96.7    7e-21   
ref|XP_006367075.1|  PREDICTED: mitochondrial outer membrane prot...  95.1    2e-20   
gb|KDP31208.1|  hypothetical protein JCGZ_11584                       94.7    3e-20   
ref|XP_002511521.1|  voltage-dependent anion-selective channel, p...  93.6    9e-20   
ref|NP_001190045.1|  voltage dependent anion channel 5                90.5    1e-19   
gb|KHG11726.1|  Mitochondrial outer membrane porin of 34 kDa          92.0    2e-19   
ref|XP_003634314.2|  PREDICTED: mitochondrial outer membrane prot...  92.0    4e-19   
gb|AFW82970.1|  outer membrane protein porin                          89.7    1e-18   
emb|CDY25906.1|  BnaC09g32780D                                        90.9    1e-18   
gb|AFW82971.1|  hypothetical protein ZEAMMB73_507543                  88.6    5e-18   
ref|XP_004236191.1|  PREDICTED: mitochondrial outer membrane prot...  87.4    1e-17   
gb|AFK40114.1|  unknown                                               86.7    3e-17   
gb|KJB79456.1|  hypothetical protein B456_013G050600                  86.7    3e-17   
ref|XP_001700901.1|  voltage-dependent anion-selective channel pr...  85.5    8e-17   
ref|XP_003634315.2|  PREDICTED: mitochondrial outer membrane prot...  84.3    2e-16   
ref|NP_190561.1|  voltage dependent anion channel 5                   84.0    2e-16   
ref|XP_006476654.1|  PREDICTED: mitochondrial outer membrane prot...  84.0    3e-16   
ref|XP_006439652.1|  hypothetical protein CICLE_v10021785mg           83.6    3e-16   
ref|XP_009801980.1|  PREDICTED: mitochondrial outer membrane prot...  82.8    5e-16   
ref|XP_009614188.1|  PREDICTED: mitochondrial outer membrane prot...  82.8    5e-16   
ref|XP_004164031.1|  PREDICTED: mitochondrial outer membrane prot...  82.8    5e-16   
ref|XP_010086579.1|  Mitochondrial outer membrane protein porin o...  82.0    1e-15   



>ref|XP_009772199.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana sylvestris]
 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFT+TTYS+TGVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS +YTTITVDEPAPGLKTI+SFV PDQ+SGKVELQYLHEYAGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQRSGKVELQYLHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTA+G F
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTASGNF  155



>ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Solanum lycopersicum]
Length=276

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFTITT+S TGVAITSSG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTITTFSTTGVAITSSGLKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS LYTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASPLV+FSGVAGNN +ALGTDVSFDTATG F
Sbjct  121  IGLTASPLVNFSGVAGNNIVALGTDVSFDTATGNF  155



>ref|XP_009627246.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nicotiana tomentosiformis]
Length=276

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFT+TTYS+TGVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSSTGVAITSSGLKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS +YTTITVDEPAPGLKTI+SFV PDQKSGKVELQYLHEYAGIST 
Sbjct  61   KNKNVTTDVKVDTNSNVYTTITVDEPAPGLKTIVSFVLPDQKSGKVELQYLHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASPLV+FSGVAGNNT+ALGTD+SF+TA+G F
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFNTASGNF  155



>ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum 
tuberosum]
 sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 
kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56600.1| 36kDA porin II [Solanum tuberosum]
Length=276

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFT+TTYS TGVAIT+SG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTATG F
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNF  155



>emb|CAA56601.1| 36kDa porin I [Solanum tuberosum]
Length=276

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFT+TTYS TGVAIT+SG+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVD NS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGI+TS
Sbjct  61   KNKNITTDVKVDANSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASPLV+FSGVAGNNT+ALGTD+SFDTATG F
Sbjct  121  IGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNF  155



>ref|XP_009797869.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   278 bits (712),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDYV+DHKFT+TTY++ GVAITSSGVKKGE L+ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN TTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL ASPLV+FSGVAGNN +ALGTD+SFDT++G F
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNF  155



>ref|XP_009599229.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MV GPGLYSDIGKKA+DLLYRDYV+DHKFT+TTY++ GVAITSSGVKKGE L+ADVNTQL
Sbjct  1    MVMGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYTSNGVAITSSGVKKGEFLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN TTD+KVDTNS +YTTITVDEPAPGLKTI SFV PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNFTTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL ASPLV+FSGVAGNN +ALGTD+SFDT++G F
Sbjct  121  IGLAASPLVNFSGVAGNNKIALGTDLSFDTSSGNF  155



>emb|CDP00288.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   273 bits (699),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLLY+DY  DHKFT+TTY+A GVAITSSG+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFTVTTYTANGVAITSSGIKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNSK++TTITVDEPAPGLKTIISFV PDQ+SGKVELQYLHEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSKVFTTITVDEPAPGLKTIISFVVPDQRSGKVELQYLHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGVAGN+ LALG D+SFDTATG F
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGADLSFDTATGNF  155



>emb|CBI32017.3| unnamed protein product [Vitis vinifera]
Length=240

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK A+DLLYRDY +DHKFT+TTY+++GVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNNTL+LGTD+SFDTATG F
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNF  155



>ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Vitis vinifera]
Length=276

 Score =   271 bits (694),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK A+DLLYRDY +DHKFT+TTY+++GVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKIARDLLYRDYQSDHKFTVTTYTSSGVAITSSGTKKGELFIADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKTIFSFIIPDQRSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNNTL+LGTD+SFDTATG F
Sbjct  121  IGLTANPIVNFSGVVGNNTLSLGTDLSFDTATGNF  155



>emb|CDP00287.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLLY+DY  DHKF++TTYS  GVAIT+SG+KKGEL + DVNTQL
Sbjct  1    MVKGPGLYSDIGKRARDLLYKDYQGDHKFSVTTYSPNGVAITASGLKKGELFLGDVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD KVDTNSK++TTITVDEPAPGLKTI SFV PDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNITTDFKVDTNSKVFTTITVDEPAPGLKTIFSFVVPDQRSGKVELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGVAGN+ LALGTDVSFDTATG F
Sbjct  121  IGLTANPIVNFSGVAGNDKLALGTDVSFDTATGNF  155



>gb|KDO82798.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=174

 Score =   263 bits (673),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYS+IGKKA+DLLY+DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG F
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNF  155



>ref|XP_010096343.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis]
Length=276

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLY+DY ADHKFTITTY++ GVAITS+G+KKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQADHKFTITTYTSAGVAITSTGIKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P V+FSG  GNNTLA+GTD+SFDTATG F
Sbjct  121  IGLTANPSVNFSGAVGNNTLAIGTDLSFDTATGNF  155



>ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
 gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina]
Length=276

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYS+IGKKA+DLLY+DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG F
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNF  155



>ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Citrus sinensis]
Length=276

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYS+IGKKA+DLLY+DY +DHKFT+TTY++ GVAITSSGVKKGEL +ADV+TQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSSGVKKGELFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IG TA+P+V+FSGV GNN++ALGTD+SFDTATG F
Sbjct  121  IGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNF  155



>ref|XP_010066951.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Eucalyptus grandis]
 gb|KCW65006.1| hypothetical protein EUGRSUZ_G02544 [Eucalyptus grandis]
Length=276

 Score =   263 bits (673),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  DHKFTITTY++TG+A+TS+G+KKGE  +ADV+TQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYKDYQGDHKFTITTYTSTGIALTSTGIKKGEFFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN LALGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLALGTDLSFDTASGNF  155



>ref|XP_007046222.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
 gb|EOY02054.1| Mitochondrial outer membrane protein porin 1 isoform 2, partial 
[Theobroma cacao]
Length=224

 Score =   261 bits (667),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYS+IGKKA+DLLY+DY  DHKFT+TTY++ GVAITS+G+KKGELL+ADV+TQL
Sbjct  28   MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  87

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+SKL+TT+TVDEPAPGLKTI SFV PDQ+SGKVELQY HEYAGISTS
Sbjct  88   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  147

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+PLV+FSGV GNN +++GTD+SFDTA+G F
Sbjct  148  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNF  182



>gb|AAA96275.1| voltage-dependent anion channel protein [Spinacia oleracea]
Length=276

 Score =   261 bits (668),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLLYRDY +DHKFT+TTY+A GVAITS+G KKGEL +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTYTANGVAITSTGTKKGELFLADVSTKL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
             NKNITTD+KVDTNS L+TTITVDEPAPGLK I SF  PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV GN+TLALGTD+SFDTA+G F
Sbjct  121  LGLTANPIVNFSGVFGNSTLALGTDLSFDTASGNF  155



>ref|XP_007046221.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
 gb|EOY02053.1| Voltage dependent anion channel 1 isoform 1 [Theobroma cacao]
Length=276

 Score =   261 bits (666),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYS+IGKKA+DLLY+DY  DHKFT+TTY++ GVAITS+G+KKGELL+ADV+TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYQGDHKFTVTTYTSDGVAITSTGIKKGELLLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+SKL+TT+TVDEPAPGLKTI SFV PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTSSKLFTTVTVDEPAPGLKTIFSFVVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+PLV+FSGV GNN +++GTD+SFDTA+G F
Sbjct  121  IGLTANPLVNFSGVVGNNCVSVGTDLSFDTASGNF  155



>ref|XP_010683253.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLLYRDY +DHKFT+TT+++ GVAITS+G KKGEL +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKRARDLLYRDYQSDHKFTLTTFTSNGVAITSTGTKKGELFLADVSTKL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
             NKNITTD+KVDTNS L+TTITVDEPAPGLK I SF  PDQ+SGKVELQYLHEYAGISTS
Sbjct  61   TNKNITTDVKVDTNSNLFTTITVDEPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV GN+TLALGTD+SFDTA+G F
Sbjct  121  LGLTANPIVNFSGVIGNSTLALGTDLSFDTASGNF  155



>ref|XP_008339931.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Malus domestica]
Length=276

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KGEL + DV+TQL
Sbjct  1    MVKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGELYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTIT+DEPAPGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  155



>ref|XP_011010796.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Populus euphratica]
Length=276

 Score =   258 bits (658),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY +DHKFT+TTY++TGVAITS+G+KKGEL +AD+++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAITSTGIKKGELFLADISSQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITVDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G+N +ALGTD+SFDTATG F
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNF  155



>gb|AAQ87021.1| VDAC1.3 [Lotus japonicus]
Length=276

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLL++DY  DHKFTITTY++ GV ITS+GVKKGE+ +ADV+T+L
Sbjct  1    MVKGPGLYSDIGKKARDLLFKDYQNDHKFTITTYTSAGVEITSTGVKKGEIYLADVSTKL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDEPAPGLKTI SF+ PDQKSGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLHTTITVDEPAPGLKTIFSFIFPDQKSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASP+V+FSG+ GNN +A+GTD+SFDTA+G F
Sbjct  121  IGLTASPIVNFSGIIGNNLVAVGTDLSFDTASGNF  155



>gb|KHG20441.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+K D+ S L+TT+T+DEPAPGLKTI SFV PDQKSGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKFDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGKVELQYRHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA PLVSFSGV GN+++++GTD+SFDTA+G F
Sbjct  121  IGLTAKPLVSFSGVIGNDSVSVGTDLSFDTASGNF  155



>ref|XP_010242364.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Nelumbo nucifera]
Length=276

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLY+DY  DHKFT+TT+++ GVAITS+G+KKGEL +ADVNTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQNDHKFTLTTFTSAGVAITSTGLKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS ++TTITV+EPAPGLKTI+SFV PDQKSGK ELQYLH++AGISTS
Sbjct  61   KNKNITTDVKVDTNSNVFTTITVNEPAPGLKTIVSFVVPDQKSGKAELQYLHDHAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASP+V+FSGV G +  ++GTD+SFDT+TGKF
Sbjct  121  IGLTASPIVNFSGVVGTSAASIGTDLSFDTSTGKF  155



>gb|KJB50696.1| hypothetical protein B456_008G182700 [Gossypium raimondii]
Length=276

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G KKGELL+AD++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITT++KVDT+SKL+ T+TVDEPAPGLKTI SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTNVKVDTSSKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+PLV+FSGV GNN++ +GTD+SFDTA+G F
Sbjct  121  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNF  155



>ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Cucumis melo]
Length=276

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLY+DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L TTITVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G+N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNF  155



>ref|XP_010087805.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
 gb|EXB30112.1| Mitochondrial outer membrane protein porin of 34 kDa [Morus notabilis]
Length=276

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY +DHKFTITTYS TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSTGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TT+TVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGI+TS
Sbjct  61   KNKNITTDIKVDTNSNLFTTVTVDEPAPGLKTILSFRLPDQRSGKVELQYLHDYAGITTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N +ALGTDVSFD+ TG+F
Sbjct  121  VGLTANPVVNFSGVFGTNVVALGTDVSFDSKTGQF  155



>ref|XP_004147460.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 ref|XP_004168625.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Cucumis sativus]
 gb|KGN59595.1| Porin [Cucumis sativus]
Length=276

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLY+DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L TTITVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTSSNLVTTITVDEPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G+N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNFSGVVGSNLLALGTDLSFDTKTGNF  155



>ref|XP_009360395.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Pyrus x bretschneideri]
Length=276

 Score =   256 bits (655),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS + TTITVDEPAPGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPAPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  155



>gb|KJB60740.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60741.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60743.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
 gb|KJB60744.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=175

 Score =   253 bits (645),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNF  155



>ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina]
 gb|KDO72482.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
 gb|KDO72483.1| hypothetical protein CISIN_1g023969mg [Citrus sinensis]
Length=274

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY +DHKFTITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDT S L+TTITVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FS V G N L+LGTD+SFD+ +G F
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNF  155



>ref|XP_010256458.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Nelumbo nucifera]
Length=276

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLY+DY +DHKFT+TTY++TGVA+TS+G+KKGEL +AD+NTQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYKDYQSDHKFTLTTYTSTGVAVTSTGIKKGELFLADINTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS ++TTITVDEPAPGLKTI+SF  PDQ+SGK ELQYLH+YAGIS S
Sbjct  61   KNKNITTDIKVDTNSNVFTTITVDEPAPGLKTILSFKVPDQRSGKAELQYLHDYAGISAS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G +  ++GTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGTSAASVGTDLSFDTASGNF  155



>ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Citrus sinensis]
Length=274

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY +DHKFTITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDT S L+TTITVDEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTASNLFTTITVDEPAPGLKTILSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FS V G N L+LGTD+SFD+ +G F
Sbjct  121  VGLTANPIVNFSAVIGTNVLSLGTDLSFDSKSGNF  155



>ref|XP_011086392.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Sesamum indicum]
Length=278

 Score =   256 bits (653),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
             VKGPGLYSDIGKKA+DLLYRDY  D KFT+TTY++ GVAITSSG +KG+L +AD+NTQL
Sbjct  3    FVKGPGLYSDIGKKARDLLYRDYQGDQKFTLTTYTSNGVAITSSGTRKGDLFLADINTQL  62

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT S +YTTITVDEPAPG+K I+SFVAPDQKSGKVELQY HE+AGISTS
Sbjct  63   KNKNITTDVKVDTYSNVYTTITVDEPAPGVKAIVSFVAPDQKSGKVELQYFHEHAGISTS  122

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA P+V+FSGVAGN   A GTD+SFDTATG F
Sbjct  123  LGLTAKPIVNFSGVAGNQKAAFGTDISFDTATGNF  157



>ref|XP_011071026.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Sesamum indicum]
Length=278

 Score =   255 bits (652),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
             VKGPGLYSDIGK+A+DLLY+DY  D KFT+TT ++ GV ITSSG KKGEL +ADVNTQL
Sbjct  3    FVKGPGLYSDIGKRARDLLYKDYQGDQKFTLTTCTSNGVIITSSGTKKGELFLADVNTQL  62

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS ++TTITVDEPAPG+K I SFVAPDQKSGKVELQYLHEYAGISTS
Sbjct  63   KNKNITTDVKVDTNSNVHTTITVDEPAPGVKAIFSFVAPDQKSGKVELQYLHEYAGISTS  122

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA P+V+FSGVAGN+  A GTD+SFDTATG F
Sbjct  123  LGLTAKPIVNFSGVAGNHKAAFGTDISFDTATGNF  157



>ref|XP_008389525.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Malus domestica]
Length=276

 Score =   255 bits (651),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS + TTITVDEP+PGLK I SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNVITTITVDEPSPGLKAIFSFIAPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVHFSGVVGNNLLSLGTDLSFDTASGNF  155



>gb|KJB60742.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=207

 Score =   252 bits (644),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNF  155



>dbj|BAG09387.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=181

 Score =   251 bits (640),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT S L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGEL  155



>gb|AFK37646.1| unknown [Lotus japonicus]
Length=177

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGK+A+DLL++DY +D KFTITTYS TGVAITSSG+KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P+V+FSGV G N LA+GTD+SFDT  G+ 
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGEL  155



>ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGKKA+DLLYRDY  DHKFT+TT +A+GVAITSSG+KKG+LL+ DV+TQL
Sbjct  1    MVKGPGLYSDIGKKARDLLYRDYQTDHKFTVTTLTASGVAITSSGIKKGDLLLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L  TITVDEPAPGLK I+SF+ PDQKS +VELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLATITVDEPAPGLKAILSFIVPDQKSARVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+++FSGV GN  L+LGTDVSFDTA+G  
Sbjct  121  LGLTANPVINFSGVVGNAALSLGTDVSFDTASGNL  155



>gb|KJB30016.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=184

 Score =   250 bits (639),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G F
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNF  155



>ref|XP_008221678.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa 
[Prunus mume]
Length=276

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  155



>gb|KJB60739.1| hypothetical protein B456_009G323300 [Gossypium raimondii]
Length=276

 Score =   253 bits (647),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  DHKFT+TTY++ GVAITS+G KKGELL+ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQVDHKFTVTTYTSNGVAITSTGTKKGELLLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVD+ S L+TT+T+DEPAPGLKTI SFV PDQKSG VELQY HEYAGIS  
Sbjct  61   KNKNITTDVKVDSRSNLFTTVTIDEPAPGLKTIFSFVVPDQKSGMVELQYRHEYAGISNG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA PLVSFSGV GN+ +++GTD+SFDTA+G F
Sbjct  121  IGLTAKPLVSFSGVIGNDCVSVGTDLSFDTASGNF  155



>gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca]
Length=276

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  155



>ref|XP_009798894.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana sylvestris]
Length=276

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKK +DLLY+DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYHSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFDT TG F
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDTKTGDF  155



>gb|EYU22439.1| hypothetical protein MIMGU_mgv1a011543mg [Erythranthe guttata]
Length=278

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
             VKGPGLY DIGK+A+DLLY+DY  DHKFT+TTYS+ G+AITS+G KKGEL++ DVNTQL
Sbjct  3    FVKGPGLYPDIGKRARDLLYKDYQGDHKFTLTTYSSNGLAITSTGTKKGELILGDVNTQL  62

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDTNS + TTITVDEPAPG+K IISF APDQKSGKVELQY HEYA ISTS
Sbjct  63   KNKNITTDLKVDTNSNVCTTITVDEPAPGVKAIISFAAPDQKSGKVELQYFHEYAAISTS  122

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA P+V+FSGVAG++  A GTDVSFDTATG F
Sbjct  123  LGLTAKPIVNFSGVAGSHKAAFGTDVSFDTATGNF  157



>ref|XP_011034213.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Populus euphratica]
Length=276

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY +DHKFT+TTY++TGVA+TS+G+KKGEL +ADV+ QL
Sbjct  1    MGKGPGLYADIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G+N ++LGTD+SFDTATG F
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNF  155



>ref|XP_006378154.1| porin family protein [Populus trichocarpa]
 gb|ABK92505.1| unknown [Populus trichocarpa]
 gb|ERP55951.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++ GVAITS+G+KKGEL +AD+++QL
Sbjct  1    MGKGPGLYFDIGKKARDLLYKDYQSDHKFTVTTYTSAGVAITSTGIKKGELFLADISSQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G+N +ALGTD+SFDTATG F
Sbjct  121  LGLTANPIVNFSGVVGSNVVALGTDLSFDTATGNF  155



>gb|ACU19720.1| unknown [Glycine max]
Length=241

 Score =   251 bits (642),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G F
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNF  155



>ref|XP_009587690.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Nicotiana tomentosiformis]
 dbj|BAF95072.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   253 bits (645),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKK +DLLY+DY +DHKFTITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKTRDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITVD+ APGLKTI+SF  PDQ+SGK+E+QYLHEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVDDAAPGLKTILSFRVPDQRSGKLEVQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFD+ TG F
Sbjct  121  VGLTANPIVNFSGVVGTNILALGTDVSFDSKTGDF  155



>gb|KHG13762.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=276

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKK++DLLY+DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKSRDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSNLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL A+PLV+FSGV GNN +++GTD+SFDTA+G F
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTASGNF  155



>ref|XP_010029375.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW56274.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=276

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY +DHKFTITT+S TGV +TS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTITTFSPTGVTLTSTGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITVDEPAPGLK+I SF  PDQ+SGK+ELQYLHE+AGIS+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPDQRSGKIELQYLHEHAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G + LALGTDVSFDT +G F
Sbjct  121  IGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDF  155



>gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Erythranthe guttata]
Length=278

 Score =   252 bits (643),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
             VKGPGLY DIGK+A+DLLY+DY  D KFT+TTY++ GVAITSSG +KG+L +ADV+TQ+
Sbjct  3    FVKGPGLYPDIGKRARDLLYKDYQGDQKFTLTTYTSNGVAITSSGTQKGDLFLADVSTQM  62

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS +YTT TVDEPAPG+K I SFVAPDQKSGKVELQY HEY+GISTS
Sbjct  63   KNKNITTDVKVDTNSNVYTTFTVDEPAPGVKAIFSFVAPDQKSGKVELQYFHEYSGISTS  122

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA P+V+FSGVAGN+T A GTDVSFDT TG F
Sbjct  123  LGLTAKPIVNFSGVAGNHTFAFGTDVSFDTETGNF  157



>ref|XP_003554316.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Glycine max]
Length=276

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT S L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTGSNLFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGEL  155



>ref|XP_007032450.1| Voltage dependent anion channel 1 [Theobroma cacao]
 gb|EOY03376.1| Voltage dependent anion channel 1 [Theobroma cacao]
Length=276

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY  D KFT+TT+S TGVAITS+G KKG+L VADVNTQL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQTDQKFTLTTFSPTGVAITSAGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN+N+TTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNRNVTTDIKVDTSSNLFTTITVDEPAPGLKTIFSFRVPDQRSGKVELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNFSGVFGTNVLALGTDLSFDTKTGNF  155



>ref|XP_002312708.1| porin family protein [Populus trichocarpa]
 gb|ABK94257.1| unknown [Populus trichocarpa]
 gb|EEE90075.1| porin family protein [Populus trichocarpa]
Length=276

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVA+TS+G+KKGEL +ADV+ QL
Sbjct  1    MGKGPGLYVDIGKKARDLLYKDYQSDHKFTVTTYTSTGVALTSTGIKKGELFLADVSGQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTIT+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITIDEPAPGLKTIFSFKVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G+N ++LGTD+SFDTATG F
Sbjct  121  LGLTANPIVNFSGVIGSNVVSLGTDLSFDTATGNF  155



>ref|XP_003543710.1| PREDICTED: outer plastidial membrane protein porin-like [Glycine 
max]
Length=276

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+K+DTNS L TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGTDVSFDTKIGEL  155



>gb|AID59897.1| voltage-dependent anion channel protein [Prunus persica]
Length=276

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+TQL
Sbjct  1    MVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  155



>gb|AAQ87020.1| VDAC1.2 [Lotus japonicus]
Length=276

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGK+A+DLL++DY +D KFTITTYS TGVAITSSG+KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIKKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P+V+FSGV G N LA+GTD+SFDT  G+ 
Sbjct  121  VGLTPNPIVNFSGVVGTNALAVGTDLSFDTKIGEL  155



>gb|KJB30018.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
 gb|KJB30019.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=276

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G+KKGELL+ADV+T+L
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLADVSTEL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN NITT++KVDT S L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNNNITTNVKVDTKSTLFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G F
Sbjct  121  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNF  155



>ref|XP_003532049.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Glycine max]
 gb|KHN13488.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGI+TS
Sbjct  61   KNKNITTDVKVDTNSNLRTTITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G F
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTASGNF  155



>gb|KHN13242.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+K+DTNS L TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKLDTNSNLLTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSG+ G N LALGTDVSFDT  G+ 
Sbjct  121  VGLTANPIVNFSGIVGTNVLALGTDVSFDTKIGEL  155



>gb|KHG03636.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=276

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  DHKFT+TT S TGVAITS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDT S LYTTITVD+PAPGLK I SF APDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRAPDQRSGKVELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+ SGV G N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNF  155



>gb|AAB38498.1| porin [Mesembryanthemum crystallinum]
Length=276

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLYRDY  D KF+ITTYS TGVAITSSG KKG+L +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLYRDYQTDQKFSITTYSPTGVAITSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L TTITVDE APGLKTI+SF  PDQ+SGK+ELQYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLLTTITVDEAAPGLKTILSFRVPDQRSGKLELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LA GTDVSFD+ TG F
Sbjct  121  VGLTANPIVNFSGVLGTNLLAFGTDVSFDSKTGNF  155



>ref|XP_007215668.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
 gb|EMJ16867.1| hypothetical protein PRUPE_ppa008585mg [Prunus persica]
Length=326

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = +3

Query  21   PPSLLSLQLRC*LPEGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITS  200
            P   L L  +  L  G+MV GPGLY+DIGKKA+DLLY+DY +DHKFT+TTYS TGVAITS
Sbjct  37   PSRFLCLLFQSLL--GKMV-GPGLYTDIGKKARDLLYKDYQSDHKFTVTTYSPTGVAITS  93

Query  201  SGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKS  380
            SG KKGEL +ADVNTQLKNKN+TTD+KVDT+S L TT+TVD+PAPGLK I SF  PDQ+S
Sbjct  94   SGTKKGELFLADVNTQLKNKNVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRS  153

Query  381  GKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            GKVELQYLH+YAGISTSIGLTA+P+V+FSGV G N LALGTD+SFDT TG  
Sbjct  154  GKVELQYLHDYAGISTSIGLTANPIVNFSGVIGTNQLALGTDLSFDTKTGNL  205



>ref|XP_007153842.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
 gb|ESW25836.1| hypothetical protein PHAVU_003G069300g [Phaseolus vulgaris]
Length=276

 Score =   250 bits (639),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGK+ +DLL++DY  DHKFTITT ++TGV ITS+GV+KGEL +AD++T+L
Sbjct  1    MVKGPGLYTDIGKRTRDLLFKDYQNDHKFTITTQTSTGVEITSTGVRKGELYLADISTKL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNIT+D+KVDTNS L TTITVDEPAPGLK I SF+ PDQKSGKVELQYLHEYAGISTS
Sbjct  61   KNKNITSDIKVDTNSSLRTTITVDEPAPGLKAIFSFIFPDQKSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN +A+GTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNNLVAVGTDLSFDTASGNF  155



>ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
 gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica]
Length=344

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   EGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  242
            E  MVKGPGLY DIGKKA+DLLY+DY +DHKFT+TTY++TGVAI+S+G++KG+L + DV+
Sbjct  66   ETIMVKGPGLYLDIGKKARDLLYKDYQSDHKFTVTTYTSTGVAISSTGIRKGDLYLGDVS  125

Query  243  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  422
            TQLKNKNITTD+KVDT+S L TTIT+DEPAPGLK I SF+ PDQ+SGKVELQY HEYAGI
Sbjct  126  TQLKNKNITTDVKVDTDSNLRTTITIDEPAPGLKAIFSFIVPDQRSGKVELQYQHEYAGI  185

Query  423  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            ST IGLTA+P+V+FSGV GNN L+LGTD+SFDTA+G F
Sbjct  186  STGIGLTANPIVNFSGVVGNNLLSLGTDLSFDTASGNF  223



>ref|NP_001275154.1| mitochondrial outer membrane protein porin of 34 kDa [Solanum 
tuberosum]
 sp|P42055.2|VDAC1_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 34 
kDa; AltName: Full=POM 34; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC [Solanum tuberosum]
 emb|CAA56599.1| 34 kDA porin [Solanum tuberosum]
Length=276

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY +DHKF+ITTYS TGV ITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N +ALGTDVSFDT TG F
Sbjct  121  VGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDF  155



>ref|XP_004233349.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY +DHKF+ITTYS TGV ITSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L+TTITVDE APGLKTI+SF  PDQ+SGK+E+QYLH+YAGI TS
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N +ALGTDVSFDT TG F
Sbjct  121  VGLTANPIVNFSGVVGTNIVALGTDVSFDTKTGDF  155



>gb|KJB33661.1| hypothetical protein B456_006G024700 [Gossypium raimondii]
Length=276

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  DHKFT+TT S TGVAITS+G KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDHKFTLTTSSPTGVAITSAGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDT S LYTTITVD+PAPGLK I SF  PDQ+SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNVTTDIKVDTYSNLYTTITVDQPAPGLKAIFSFRVPDQRSGKVELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+ SGV G N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNLSGVIGTNVLALGTDLSFDTKTGNF  155



>ref|NP_001241054.1| uncharacterized protein LOC100805016 [Glycine max]
 gb|ACU21099.1| unknown [Glycine max]
 gb|KHN31779.1| Mitochondrial outer membrane protein porin of 36 kDa [Glycine 
soja]
Length=276

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFTITTY++TGV ITS+GV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTYTSTGVEITSTGVRKGEIYLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L T ITVDEPAPGLKTI SF  PDQKSGKVELQY HEYAGISTS
Sbjct  61   KNKNITTDVKVDTNSNLRTIITVDEPAPGLKTIFSFNFPDQKSGKVELQYQHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GNN +A+GTD+SFDT +G F
Sbjct  121  IGLTANPVVNFSGVVGNNLVAVGTDLSFDTTSGNF  155



>ref|XP_008379329.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial outer membrane 
protein porin of 34 kDa-like [Malus domestica]
 ref|XP_009342873.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Pyrus x bretschneideri]
Length=275

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY+DIGKKA+DLLYRDY +DHKFTITT+S TGVAITSSG KKGEL +ADVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYRDYQSDHKFTITTFSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            N+TTD+KVDT+S L TTITVD+PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S+GL
Sbjct  63   NVTTDVKVDTDSNLSTTITVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TA+P+V+FSGV G N LALGTD+SFDT TG  
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNL  154



>gb|KDP21225.1| hypothetical protein JCGZ_21696 [Jatropha curcas]
Length=276

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  DHKFT TTY+A GVAITS+G+KKGEL +ADV++QL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQGDHKFTFTTYTAAGVAITSTGIKKGELFLADVSSQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTIT+D+ APGLKTI SF  PDQ+SGKV+LQY HEY+GIST 
Sbjct  61   KNKNITTDVKVDTNSNLFTTITIDDLAPGLKTIFSFKIPDQRSGKVDLQYQHEYSGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GN+T+ALGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVVGNSTIALGTDLSFDTASGNF  155



>gb|AFK40985.1| unknown [Lotus japonicus]
Length=276

 Score =   248 bits (633),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGK+A+DLL++DY +D KFTITTYS TGVAITSSG++KGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKRARDLLFKDYHSDQKFTITTYSPTGVAITSSGIEKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTDLKVDT+S L+TT+TVDEPAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDLKVDTDSNLFTTVTVDEPAPGLKAIFSFRVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P+V+FSGV G N  A+GTD+SFDT  G+ 
Sbjct  121  VGLTPNPIVNFSGVVGTNARAVGTDLSFDTKIGEL  155



>ref|XP_010550070.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY +D KF+ITTYS TGVAITS+G+KKG+L +ADV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQSDQKFSITTYSPTGVAITSTGIKKGDLFLADVATQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KV T+S L TTITVDEPAPGLK+I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G+N LALGTDVSFDT TG F
Sbjct  121  IGLTANPVVNFSGVVGSNVLALGTDVSFDTKTGNF  155



>gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea]
Length=276

 Score =   248 bits (632),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLY+DY +D KFT+TTYS TGV +TSSG +KG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTRKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L+TTITVDEPAPGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLFTTITVDEPAPGLKTILSFKVPDQRSGKLELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV GNN  ALG+D+SFDT  G
Sbjct  121  VGLTANPIVNFSGVLGNNAFALGSDLSFDTKEG  153



>ref|XP_007139603.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
 gb|ESW11597.1| hypothetical protein PHAVU_008G043800g [Phaseolus vulgaris]
Length=276

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLL++DY +D KFT+TTYS TGVAITSSG +KGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGEL  155



>ref|XP_011085779.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   246 bits (629),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLY+DY +D KFT+TTYS TGV +TS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSTGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+KN+TTD+KVDT+S L+TT+TVDEP PGLKTI+SF  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV GNN LALG+DVSFDT  G F
Sbjct  121  VGLTANPIVNFSGVVGNNKLALGSDVSFDTKEGAF  155



>ref|XP_011085778.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLY+DY +D KFT+TTYS TGV +TSSG KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTTYSPTGVTLTSSGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+KNITTD+KVDTNS L+TT+TVDEP PGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS++
Sbjct  61   KHKNITTDIKVDTNSNLHTTVTVDEPTPGLKTILSFRVPDQRSGKLELQYLHDYAGISSN  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV GNN +ALG+DVSFDT  G F
Sbjct  121  VGLTANPIVNFSGVVGNNKVALGSDVSFDTKEGAF  155



>gb|AAY82249.1| mitochrondrial voltage-dependent anion-selective channel [Phaseolus 
coccineus]
Length=276

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLL++DY +D KFT+TTYS TGVAITSSG +KGEL +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTVTTYSPTGVAITSSGTRKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVVGTNILALGADLSFDTKIGEL  155



>gb|KGN47800.1| hypothetical protein Csa_6G404150 [Cucumis sativus]
Length=342

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +3

Query  57   LPEGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVAD  236
            LP   M KGPGLYSDIGKKA+DLLY+DY +DHKFT+TTY++ GVAI+S+G+KKGE+ +AD
Sbjct  62   LPGKAMGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLAD  121

Query  237  VNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYA  416
            V+TQLKN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYA
Sbjct  122  VSTQLKNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYA  181

Query  417  GISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            GIST IGLTASP+V+F+GV GN+ L+LGTD+SFDTA+G
Sbjct  182  GISTGIGLTASPIVNFAGVIGNDKLSLGTDLSFDTASG  219



>gb|KHN11584.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAIT+SG +K EL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGEL  155



>ref|XP_008230727.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Prunus mume]
Length=275

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY+DIGKKA+DLLY+DY +D KFT+TTYS TGVAITSSG KKGEL +ADVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDQKFTVTTYSPTGVAITSSGTKKGELFLADVNTQLKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            N+TTD+KVDT+S L TT+TVD+PAPGLK I SF  PDQ+SGKVELQYLH+YAGISTS+GL
Sbjct  63   NVTTDIKVDTDSNLSTTVTVDQPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISTSVGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TA+P+V+FSGV G N LALGTD+SFDT TG  
Sbjct  123  TANPIVNFSGVIGTNQLALGTDLSFDTKTGNL  154



>ref|XP_010524325.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Tarenaya hassleriana]
Length=276

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFTITTYS TGVAITS+G KKG++ +ADV TQL
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQNDQKFTITTYSPTGVAITSTGTKKGDVFLADVATQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KV T+S L TTITVDEPAPGLK+I SF  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDIKVGTDSTLLTTITVDEPAPGLKSIFSFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTDVSFDT TG F
Sbjct  121  IGLTANPIVNFSGVVGTNVLALGTDVSFDTKTGNF  155



>ref|XP_004146750.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
 ref|XP_004162535.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis sativus]
Length=276

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY +DHKFT+TTY++ GVAI+S+G+KKGE+ +ADV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTSGGVAISSTGIKKGEIFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASP+V+F+GV GN+ L+LGTD+SFDTA+G  
Sbjct  121  IGLTASPIVNFAGVIGNDKLSLGTDLSFDTASGNI  155



>gb|ACU20122.1| unknown [Glycine max]
Length=276

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAIT+SG +K EL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGEL  155



>ref|XP_008456460.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cucumis melo]
Length=276

 Score =   245 bits (625),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY +DHKFT+TTY+A GVAI+S+GVKKG++ +ADV+TQL
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQSDHKFTVTTYTAGGVAISSTGVKKGDIFLADVSTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN NITTD+KVDT+S ++TT+T+DEPAPGLKTI SF  PDQ+SGKVELQY HEYAGIST 
Sbjct  61   KNNNITTDVKVDTHSNVHTTVTIDEPAPGLKTIFSFRVPDQRSGKVELQYQHEYAGISTG  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASP+V+F+GV GN  L+LGTD+SFDTA+G  
Sbjct  121  IGLTASPIVNFAGVIGNEKLSLGTDLSFDTASGNI  155



>emb|CAN67632.1| hypothetical protein VITISV_019646 [Vitis vinifera]
Length=175

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY +DHK TIT+ S TGVAITSSG KKG++ VADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+K+DT+S L+ T+TVDEPAPGLK+I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSG  G N +ALGTD+SFDT +G F
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNF  155



>ref|XP_009779190.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana sylvestris]
Length=276

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLYRDY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVG  153



>ref|XP_004234781.2| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Solanum lycopersicum]
Length=276

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKK +DLLYRDY  DHKFTITTYSATGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSATGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNLTTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAG  153



>dbj|BAF95070.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLYRDY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAKLEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVG  153



>ref|NP_001238377.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
 dbj|BAG09368.1| peroxisomal voltage-dependent anion-selective channel protein 
[Glycine max]
Length=276

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFDT  G+ 
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDTKIGEL  155



>ref|XP_006842115.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
 gb|ERN03790.1| hypothetical protein AMTR_s00078p00100600 [Amborella trichopoda]
Length=276

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYS+IGKKA+DLLY+DY +D KF +TTY++TGVAITSSG KKG+L +ADV TQL
Sbjct  1    MGKGPGLYSEIGKKARDLLYKDYHSDQKFILTTYTSTGVAITSSGTKKGDLFLADVTTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L TTITVDE APGLKTI S + PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNVTTDIKVDTNSNLSTTITVDEAAPGLKTIFSCIFPDQRSGKVELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV GN T ALGTDV+FDTAT K 
Sbjct  121  IGLTATPIVNFSGVLGNETFALGTDVAFDTATSKL  155



>ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=276

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY  DHKFT+TTY++TGVAITS+G+KKGE+ + D+ +QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQGDHKFTVTTYTSTGVAITSTGIKKGEIYLGDITSQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S + TTITVDEPAPGLKTI SF  PDQ+SGKVELQY HE+AGISTS
Sbjct  61   KNKNITTDIKVDTSSNVSTTITVDEPAPGLKTIFSFKIPDQRSGKVELQYQHEHAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G++ +ALGTD+SFDTA+G F
Sbjct  121  IGLTANPIVNFSGVIGSSAVALGTDLSFDTASGNF  155



>ref|XP_011098570.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Sesamum indicum]
Length=276

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLYRDY +DHKFTITTYS TGV +TS+G+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQSDHKFTITTYSPTGVTLTSTGIKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+KN+TTD+KVDT+S L TT+TVDEPAPGLKTI+SF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KHKNVTTDIKVDTSSNLLTTVTVDEPAPGLKTILSFRVPDQRSGKLELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FS V G+N LA+G+DVSFD+  G
Sbjct  121  VGLTANPIVNFSAVLGSNKLAVGSDVSFDSKEG  153



>emb|CDP02196.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKK +DLLY+D+ +DHKF+ITT S TGVA+TSSG KKG+L  ADVN QL
Sbjct  1    MAKGPGLYTEIGKKVRDLLYKDFQSDHKFSITTCSPTGVAVTSSGTKKGDLFWADVNAQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD KVDTNS L+T +T+DEP PGLKTI SF  PDQ+SGK+ELQYLH+YAGISTS
Sbjct  61   KNKNITTDFKVDTNSNLFTAVTIDEPVPGLKTIFSFRVPDQRSGKLELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+++FSGV G N LALGTDVSFDT TG
Sbjct  121  VGLTANPIINFSGVVGTNALALGTDVSFDTKTG  153



>ref|XP_003552508.1| PREDICTED: outer plastidial membrane protein porin-like isoform 
1 [Glycine max]
 gb|KHN13654.1| Outer plastidial membrane protein porin [Glycine soja]
Length=276

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFD+  G+ 
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGEL  155



>gb|AAQ87019.1| VDAC1.1 [Lotus japonicus]
 gb|AFK40743.1| unknown [Lotus japonicus]
Length=276

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLL++DY +D KFTITT+S TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTI V++PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALG D++FDT  G+ 
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIGEL  155



>ref|XP_004514771.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like 
[Cicer arietinum]
Length=276

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFT+TT + +GV ITSSGV+KGE+ +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTVTTQTLSGVEITSSGVRKGEIFLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L TTITVDEPAPGLKTI SF+ PDQ S KVELQY HEY GI+TS
Sbjct  61   KNKNITTDIKVDTNSNLLTTITVDEPAPGLKTIFSFIFPDQNSAKVELQYQHEYVGINTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTASP+V+FS V GNN +++G+DVSFDTA+G F
Sbjct  121  IGLTASPIVNFSSVIGNNLVSVGSDVSFDTASGNF  155



>gb|AIL25718.1| voltage-dependent anion channel [Nicotiana tabacum]
Length=276

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLYRDY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PDQ S ++E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDQSSAELEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N L+LGTD+SFDT  G
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDLSFDTKVG  153



>gb|ACU24178.1| unknown [Glycine max]
Length=276

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLL++DY +D KFTITTYS TGVAIT+SG +K EL +ADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLFKDYHSDQKFTITTYSPTGVAITASGTRKSELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITV+EPAPGLK I SF  PDQ+SGKVE+QYLH+YAGISTS
Sbjct  61   KNKNITTDIKVDTDSNLFTTITVNEPAPGLKAIFSFKVPDQRSGKVEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG D+SFD+  G+ 
Sbjct  121  VGLTANPIVNFSGVIGTNVLALGADLSFDSKIGEL  155



>gb|KJB11403.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  155



>gb|KJB11402.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=276

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG F
Sbjct  121  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  155



>gb|ABC01904.1| 34 kDa outer mitochondrial membrane protein porin-like protein 
[Solanum tuberosum]
Length=276

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKK +DLLYRDY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAG  153



>ref|XP_006361834.1| PREDICTED: uncharacterized LOC102577832 [Solanum tuberosum]
Length=276

 Score =   243 bits (620),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKK +DLLYRDY  DHKFTITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLYRDYQTDHKFTITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L  T+TVDE APGLKTI S   PDQ S K+ELQYLH+YAGI TS
Sbjct  61   KNKNITTDIKVDTNSNLLATVTVDEAAPGLKTIFSCRIPDQSSAKMELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N LALGTDVSFDT  G
Sbjct  121  VGLTANPIVNFSGVLGTNVLALGTDVSFDTKAG  153



>gb|KHG01383.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
 gb|KHG16984.1| Mitochondrial outer membrane porin of 36 kDa [Gossypium arboreum]
Length=270

 Score =   242 bits (618),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 6/155 (4%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G KKGELL+AD++T+L
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDYQADHKFTLTTYTSNGVAITSTGTKKGELLLADISTEL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITT      N KL+ T+TVDEPAPGLKTI SF+APDQ+SGKVELQY HEYAGISTS
Sbjct  61   KNKNITT------NVKLFATVTVDEPAPGLKTIFSFIAPDQRSGKVELQYQHEYAGISTS  114

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+PLV+FSGV GNN++ +GTD+SFDTA+G F
Sbjct  115  IGLTANPLVNFSGVVGNNSVTVGTDLSFDTASGNF  149



>gb|AFK39621.1| unknown [Lotus japonicus]
Length=276

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLL++DY +D KFTITT+S TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFTITTFSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTI V++PAPGLK I SF  PDQ+SGKVELQYLH+YAGIS+S
Sbjct  61   KNKNITTDIKVDTDSNLFTTIAVNDPAPGLKAIFSFKVPDQRSGKVELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            IGLTA+P+V+FSGV G N LALG D++FDT  G
Sbjct  121  IGLTANPIVNFSGVIGTNVLALGADLTFDTKIG  153



>ref|XP_011005064.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Populus euphratica]
Length=274

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYS+IGKKA+DLLY+DY  DHKFT+ T S TGV ITSSG KKG+LL ADVNTQL
Sbjct  1    MVKGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+KNITTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVE+QYLH+YA +S+S
Sbjct  61   KSKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT +P+V+FSGV G N  +LGTD+SFDT TG F
Sbjct  121  IGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDF  155



>ref|XP_002282471.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Vitis vinifera]
 emb|CAN61274.1| hypothetical protein VITISV_039065 [Vitis vinifera]
 emb|CBI22157.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY +DHK TIT+ S TGVAITSSG KKG++ VADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQSDHKLTITSCSPTGVAITSSGTKKGDIFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+K+DT+S L+ T+TVDEPAPGLK+I +F  PDQ+SGKVELQYLH+YAGISTS
Sbjct  61   KNKNITTDVKIDTSSNLFVTVTVDEPAPGLKSIFNFKVPDQRSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSG  G N +ALGTD+SFDT +G F
Sbjct  121  IGLTANPIVNFSGTIGTNVVALGTDLSFDTKSGNF  155



>ref|XP_002324035.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
 gb|ABK94151.1| unknown [Populus trichocarpa]
 gb|EEF04168.1| hypothetical protein POPTR_0017s11430g [Populus trichocarpa]
Length=274

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MV GPGLYS+IGKKA+DLLY+DY  DHKFT+ T S TGV ITSSG KKG+LL ADVNTQL
Sbjct  1    MVNGPGLYSEIGKKARDLLYKDYQTDHKFTLNTSSPTGVTITSSGTKKGDLLAADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDT+S L+TTITVDEPAPGLKTI SF  PDQ+SGKVE+QYLH+YA +S+S
Sbjct  61   KNKNITTDIKVDTSSNLFTTITVDEPAPGLKTIFSFKVPDQRSGKVEIQYLHDYAAVSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P+V+FSGV G N  +LGTD+SFDT TG F
Sbjct  121  VGLTVNPIVNFSGVIGTNVASLGTDLSFDTKTGDF  155



>ref|XP_009596455.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Nicotiana tomentosiformis]
Length=276

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLLYRDY  DHKF ITTYS TGVAITSSG+KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLYRDYQTDHKFAITTYSPTGVAITSSGLKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L  T+TVDE APGLKTI+SF  PD  S K+E+QYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLLATVTVDEAAPGLKTILSFRIPDHSSAKLEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G N L+LGTDVSFDT  G
Sbjct  121  LGLTANPIVNFSGVVGTNLLSLGTDVSFDTKVG  153



>sp|P42054.2|VDAC_PEA RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Pisum sativum]
 emb|CAA80988.1| Porin [Pisum sativum]
Length=276

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGKKA+DLLY+DY +D KFTI+TYS TGVAITSSG KKGEL + DVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNS L+TTITV+EPAPG+K I+SF  P+Q SGKVELQYLHEYAGIS+S
Sbjct  61   KNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GL A+P+V+FS V G N LA G D+SFDT  G+ 
Sbjct  121  VGLKANPIVNFSSVIGTNALAFGADISFDTKLGEL  155



>gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata]
Length=276

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLL +DY +D KFT+TTYS TGV +TSSG KKGEL +ADVNTQ 
Sbjct  1    MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTTYSPTGVTLTSSGTKKGELFLADVNTQF  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDT+S L+TTITVDE  PGLKTI+SF APDQ+SGK+ELQYLH+YAG+S+S
Sbjct  61   KNKNVTTDIKVDTSSNLFTTITVDELTPGLKTILSFKAPDQRSGKLELQYLHDYAGLSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+F+GV GNN LALG+DVSFDT  G F
Sbjct  121  IGLTANPVVNFAGVLGNNKLALGSDVSFDTKEGAF  155



>ref|XP_010033217.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Eucalyptus grandis]
 gb|KCW52798.1| hypothetical protein EUGRSUZ_J02133 [Eucalyptus grandis]
Length=276

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKAKDLLY+DY +DHKFTITT S TGV ITS+  KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYSDIGKKAKDLLYKDYQSDHKFTITTSSVTGVTITSAATKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L T ITVDEP PGLKTI SF  PDQ+SG++ELQYLH+YAGISTS
Sbjct  61   KNKNVTTDVKVDTNSNLVTKITVDEPFPGLKTIFSFTVPDQRSGQIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+F+ V G+N L+LGTDVSFD+    F
Sbjct  121  VGLTANPVVNFAAVLGSNVLSLGTDVSFDSKASNF  155



>gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea]
Length=278

 Score =   240 bits (612),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
             VK PGLYSDIGKKA+DLLYRDY  DHKFT+T+Y++ GV+ITSS VKKG+ ++AD++ QL
Sbjct  3    FVKSPGLYSDIGKKARDLLYRDYGGDHKFTLTSYTSNGVSITSSAVKKGDSVLADISAQL  62

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD+KVDTNSK+ TTIT+DEPAPG+K I S  APDQKSGKVELQY HEYAGISTS
Sbjct  63   KNKNITTDVKVDTNSKVLTTITIDEPAPGVKAIFSITAPDQKSGKVELQYFHEYAGISTS  122

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + LTA P+V+FSGVAGN  +  GTDVSFDTATG F
Sbjct  123  LFLTAKPIVNFSGVAGNKNVFFGTDVSFDTATGNF  157



>ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa 
[Fragaria vesca subsp. vesca]
Length=276

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M  GPGLY++IGKKA+DLLY+DY +DHKFTITTYS TGVAITSSG KKG++ +ADV TQL
Sbjct  1    MANGPGLYTEIGKKARDLLYKDYQSDHKFTITTYSPTGVAITSSGTKKGDVFLADVTTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K +N+TTD+KVDT S L TTITVD+P PG+K I+SF  PDQ SGK ELQYLH+YAGISTS
Sbjct  61   KKQNVTTDIKVDTESNLLTTITVDQPCPGVKAILSFKVPDQNSGKAELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALGTDVSFDT +G F
Sbjct  121  VGLTANPVVNFSGVLGTNLLALGTDVSFDTKSGNF  155



>gb|KJB11404.1| hypothetical protein B456_001G256800 [Gossypium raimondii]
Length=275

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFT+TT S TG AITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTG-AITSAGTKKGDLFLADVNTQL  59

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K++N+TTD+KVDT+S L+TTITVDEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  60   KSRNVTTDIKVDTSSNLFTTITVDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  119

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG F
Sbjct  120  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  154



>ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLYRDY +D KFTITTYS TGVAITSSG KKGEL VADVNTQL
Sbjct  1    MAKGPGLYSDIGKKARDLLYRDYNSDQKFTITTYSPTGVAITSSGTKKGELFVADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN+NITTD+KVDT+S L TTITV+EPAPG+KT++SF  PDQ+SGKVE+QYLH+Y GI  S
Sbjct  61   KNRNITTDIKVDTDSNLSTTITVNEPAPGVKTVLSFRIPDQRSGKVEVQYLHDYFGIGAS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+++ SG  G N +ALG D+++DT  G+F
Sbjct  121  VGLTANPIINVSGTLGTNVIALGHDLTYDTKIGEF  155



>gb|KDP45473.1| hypothetical protein JCGZ_09722 [Jatropha curcas]
Length=274

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFTITTYS TGVAITS+G+KKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGLKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K  N TTD+KVDT+S L+TTITVDEPAPGLK I+SF  PDQ+SGK+E+QYLH+YA +S+S
Sbjct  61   KKNNFTTDVKVDTDSNLFTTITVDEPAPGLKAILSFKVPDQRSGKLEVQYLHDYAAVSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT +P+V+FSGV G+N ++LGTD+SFDT +G F
Sbjct  121  IGLTPNPIVNFSGVIGSNAVSLGTDLSFDTKSGNF  155



>ref|XP_008341536.1| PREDICTED: outer plastidial membrane protein porin-like [Malus 
domestica]
Length=275

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY+DIGKKA+DLLY+DY +D KFTITT+S TGVAIT+SG  KGEL + DVNTQLKNK
Sbjct  3    GPGLYTDIGKKARDLLYKDYQSDKKFTITTFSPTGVAITTSGTNKGELFLGDVNTQLKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            N+TTD+KVDT+S L TTITVD+PAPGLK I  F  PDQ+SGKVELQYLH+YAGIS+S+GL
Sbjct  63   NVTTDIKVDTDSNLSTTITVDQPAPGLKAIFCFKVPDQRSGKVELQYLHDYAGISSSVGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            TA+P+V+FSGV G N LALG D+SFDT TG
Sbjct  123  TANPIVNFSGVIGTNQLALGADLSFDTKTG  152



>gb|EYU34113.1| hypothetical protein MIMGU_mgv1a011597mg [Erythranthe guttata]
Length=276

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGK+A+DLL RDY +D KFT+TT S TGV +TS+G KKG+L +AD+NTQL
Sbjct  1    MGKGPGLYSDIGKRARDLLNRDYQSDQKFTLTTCSPTGVTLTSTGTKKGDLFLADINTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+KN+TTD KVDT S L+TT+T+DEPAPGLKTIISF  PDQ+SGK+ELQYLH+YAGIS+S
Sbjct  61   KHKNVTTDFKVDTGSNLFTTVTIDEPAPGLKTIISFKVPDQRSGKLELQYLHDYAGISSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV GNN  ++G+DVS+DT  G
Sbjct  121  VGLTANPIVNFSGVVGNNLFSVGSDVSYDTKEG  153



>ref|XP_004489166.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer 
arietinum]
Length=276

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLL++DY +D KF+ITTYS TGVAITSSG KKGEL +ADVNTQL
Sbjct  1    MAKGPGLYTDIGKKARDLLFKDYHSDQKFSITTYSPTGVAITSSGTKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDT S L+TTITV+EPAPG+K I+SF  PDQ SGKVELQYLH+YAG+S S
Sbjct  61   KNKNVTTDIKVDTESNLFTTITVNEPAPGVKAILSFKVPDQTSGKVELQYLHDYAGLSGS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
             GL A+P+V+ S V G N LA+G D+SFDT  G+ 
Sbjct  121  FGLKANPIVNLSSVVGTNVLAIGADLSFDTKLGEL  155



>gb|KEH19833.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFTITT +  GV ITS+GV+KGE  +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L TTITVDE  PGLKTI SF+ P+QKSGKVELQYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P V+ S V GNN +++G+DVSF+T++G  
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSL  155



>gb|ACJ85279.1| unknown [Medicago truncatula]
 gb|AFK33360.1| unknown [Medicago truncatula]
 gb|KEH19832.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=276

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLYSDIGK+A+DLL++DY  DHKFTITT +  GV ITS+GV+KGE  +ADV+T++
Sbjct  1    MVKGPGLYSDIGKRARDLLFKDYQNDHKFTITTQTLAGVEITSAGVRKGEAFLADVSTKV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+TTD+KVDTNS L TTITVDE  PGLKTI SF+ P+QKSGKVELQYLH+YAGISTS
Sbjct  61   KNKNVTTDIKVDTNSNLRTTITVDETVPGLKTIFSFIYPEQKSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P V+ S V GNN +++G+DVSF+T++G  
Sbjct  121  IGLTATPTVNISAVLGNNLVSVGSDVSFETSSGSL  155



>ref|XP_010670319.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   230 bits (586),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+DY  D KF+ITTYSATGVA+TS G K+G+L   DV+T+L
Sbjct  1    MAKGPGLYTDIGKKARDLLYKDYQTDQKFSITTYSATGVALTSCGTKEGDLFFGDVSTKL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K  NITTD+KVDTNS L TTITVD  APGLKTI+SF  PDQ+SGK+ELQYLH+Y G+ TS
Sbjct  61   KKNNITTDIKVDTNSNLVTTITVDGAAPGLKTILSFKVPDQRSGKLELQYLHDYVGVCTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +G TA+P+V+FSGV G N +ALGTDVSFDT TG F
Sbjct  121  VGATANPIVNFSGVIGTNMVALGTDVSFDTKTGNF  155



>gb|ABK24200.1| unknown [Picea sitchensis]
Length=276

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKK +DLL +DY  D KF+ T+Y++TG+A TS+G+KKGE  + D+NTQL
Sbjct  1    MGKGPGLYSDIGKKTRDLLNKDYNFDQKFSFTSYTSTGLAFTSTGIKKGEFFLGDLNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN N+TTD+KVDT+S L+ T+T+DEPAPGLKTI+SF  PDQ+SGKVELQYLH+YAG+STS
Sbjct  61   KNNNVTTDIKVDTSSNLFATVTIDEPAPGLKTILSFTVPDQRSGKVELQYLHDYAGVSTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT SP+  FSGV GN+T ++G +VSFDTA+G F
Sbjct  121  IGLTPSPITHFSGVIGNDTFSVGGEVSFDTASGNF  155



>gb|AFK34190.1| unknown [Medicago truncatula]
 gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=278

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 2/157 (1%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY  D KFT+TTYS TG+A+T+S  KKGEL +AD+NTQL
Sbjct  1    MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTTYSPTGIALTASSTKKGELFLADINTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQ--KSGKVELQYLHEYAGIS  425
            K+KN+TTD+KVDT+S L+TTITV EPAPGLKTI+SF  P+   KSGK E+QYLH+YAGIS
Sbjct  61   KHKNVTTDIKVDTDSNLFTTITVTEPAPGLKTILSFRIPEPELKSGKAEVQYLHDYAGIS  120

Query  426  TSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
             SIGLTA+P+ +FSGV GNN +ALG D+S+DT TG F
Sbjct  121  ASIGLTANPVANFSGVIGNNVVALGGDLSYDTKTGVF  157



>emb|CAJ42303.1| VDAC-like porin [Plantago major]
Length=250

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGK+A+DLLY+DY  DHKFT+TT S TGV +TS+G KKG+L +AD+ TQL
Sbjct  22   MGKGPGLYTEIGKRARDLLYKDYQTDHKFTLTTTSPTGVTLTSAGTKKGDLFLADITTQL  81

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITTD KVDT+S L TTIT+DEP PG KTI+SF  PDQ+SGK+ELQYLH+YAGI+TS
Sbjct  82   KNKNITTDFKVDTSSNLLTTITIDEPCPGTKTILSFKVPDQRSGKLELQYLHDYAGITTS  141

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            +GLTA+P+V+FSGV G  TLA G D+SFDT  G
Sbjct  142  VGLTANPIVNFSGVLGTKTLAAGADLSFDTKEG  174



>ref|XP_002517470.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
 gb|EEF45012.1| voltage-dependent anion-selective channel, putative [Ricinus 
communis]
Length=274

 Score =   228 bits (580),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFTITTYS TGVAITS+GVKKGEL +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTITTYSPTGVAITSTGVKKGELFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN+TTD+KVDT+S L+TT TVDE APGLKTI+S   PDQ+SGK+E+QYLH+YA +S+S
Sbjct  61   KQKNVTTDIKVDTDSNLFTTTTVDELAPGLKTILSCKLPDQRSGKLEIQYLHDYAAVSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GL  +P V+FSGV G N ++LGT++SFDT +G F
Sbjct  121  VGLAPNPTVNFSGVIGTNVVSLGTELSFDTKSGNF  155



>gb|KHG10147.1| Mitochondrial outer membrane porin of 34 kDa [Gossypium arboreum]
Length=271

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 130/155 (84%), Gaps = 5/155 (3%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQL
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K++N+TTD+KVDT+S       +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+S
Sbjct  61   KSRNVTTDIKVDTSSN-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSS  115

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLTA+P+V+FSGV G N LALGTD+SFDT TG F
Sbjct  116  IGLTANPIVNFSGVLGTNVLALGTDISFDTKTGNF  150



>pir||B55017 porin, plastid - garden pea
Length=275

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGKKA+DLLY+DY +D KFTI+TYS TGVAITSSG KKG L + DVNTQL
Sbjct  1    MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGFLELGDVNTQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKNITT +KVDTNS L+TTITV+EPAPG+K I+S   P+Q+SGK+E QYLHEYAG++ S
Sbjct  61   KNKNITTQIKVDTNSNLFTTITVNEPAPGVKAILSEKVPEQRSGKLEFQYLHEYAGVNAS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GL ++P+V+ SG  G+  L++G DVSFDTAT  F
Sbjct  121  VGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDF  155



>emb|CDY63765.1| BnaCnng42590D [Brassica napus]
Length=276

 Score =   225 bits (573),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D K ++TTYS+TGVAIT++G  KG+L V DV+TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVSTQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGGF  155



>ref|NP_001288964.1| mitochondrial outer membrane protein porin 3 [Brassica rapa]
 gb|ABB97031.1| unknown [Brassica rapa]
Length=276

 Score =   224 bits (572),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D K ++TTYS+TGVAIT++G  KG+L V DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDF  155



>emb|CDX85566.1| BnaA02g02470D [Brassica napus]
Length=276

 Score =   224 bits (572),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D K ++TTYS+TGVAIT++G  KG+L V DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKLSVTTYSSTGVAITTTGTNKGDLFVGDVTTQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGI TS
Sbjct  61   KNKNFTADIKVATDSSLLTTFTYDEATPGLKAIVSAKVPDQKSGKVELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTASP+V+FSGV GNN LALGTDVSF+T +G F
Sbjct  121  VGLTASPIVNFSGVVGNNVLALGTDVSFNTQSGDF  155



>gb|KFK37589.1| hypothetical protein AALP_AA3G002700 [Arabis alpina]
Length=276

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+D+GKKA+DL+Y+D+ +D KF+I+TYS TGVAITS+G+KKGELLV DV  Q 
Sbjct  1    MVKGPGLYTDVGKKARDLIYKDHNSDQKFSISTYSPTGVAITSTGIKKGELLVGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLVTATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNALAIGTDVSFDTKSGNF  155



>gb|KHN45480.1| Mitochondrial outer membrane protein porin of 34 kDa [Glycine 
soja]
Length=267

 Score =   222 bits (566),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  120  DLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSK  299
            DLL++DY +D KFTITTYS TGVAITSSG KKG+L VADVNTQLKNKNITTD+KVDT S 
Sbjct  8    DLLFKDYHSDQKFTITTYSPTGVAITSSGTKKGDLFVADVNTQLKNKNITTDIKVDTGSN  67

Query  300  LYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAG  479
            L+TTITV+EPAPGLKTI SF  PDQ+SGKVE+QYLH+YAGISTS+GLTA+P+V+FSGV G
Sbjct  68   LFTTITVNEPAPGLKTIFSFRVPDQRSGKVEVQYLHDYAGISTSVGLTANPIVNFSGVVG  127

Query  480  NNTLALGTDVSFDTATGKF  536
             N LALGTDVSFDT  G+ 
Sbjct  128  TNVLALGTDVSFDTKIGEL  146



>ref|XP_006298185.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31083.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=309

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   EGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  242
            E  MVKGPGLY++IGKKA+DLLYRD+ +D KF+ITTYS  GVAITSSG KKG+LL+ DV 
Sbjct  31   EATMVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVA  90

Query  243  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  422
             Q + KN+TTD KV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGI
Sbjct  91   FQSRQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGI  150

Query  423  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            STS+GLT +P V+FSGV G N LA+GTDVSFDT +G F
Sbjct  151  STSMGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNF  188



>ref|XP_010463547.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLYRD+ +D KF+ITTYS  GVAITSSG KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNF  155



>ref|XP_010485517.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Camelina sativa]
Length=276

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 129/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLYRD+ +D KF+ITTYS  GVAITSSG KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSSGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN+TTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLH+YAGISTS
Sbjct  61   KQKNVTTDLKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNF  155



>ref|XP_010453637.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT TVDEP PG+K I++   PDQKSGK+ELQYLH+YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILTAKLPDQKSGKLELQYLHDYAGIATS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT SP V+FSGV G N LALGTDVSF+T +G F
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNF  155



>emb|CDX91952.1| BnaC03g32540D [Brassica napus]
Length=276

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGKK +DLLY+D+ +DHK +ITT+S  GVAITS+G KKG+LL+ DV  QL
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVTFQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNF  155



>emb|CDY28690.1| BnaCnng05760D [Brassica napus]
Length=276

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+D+ +D K +ITTYS  GVAITS+G KKGE L+ DV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV GNN LALGTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSF  155



>ref|XP_010420161.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Camelina 
sativa]
Length=276

 Score =   220 bits (560),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT TVDEP PG+K I+S   PDQKSGK+ELQY H+YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTVDEPTPGVKAILSAKLPDQKSGKLELQYFHDYAGIATS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT SP V+FSGV G N LALGTDVSF+T +G F
Sbjct  121  IGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNF  155



>gb|AAM65525.1| putative porin [Arabidopsis thaliana]
Length=276

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            + KNITTDLKV T+S    T TVDE APGL++I SF  PDQ SGKVELQYLHEYAGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G+N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNF  155



>ref|NP_186777.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
 sp|Q9SRH5.3|VDAC1_ARATH RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=AtVDAC1; Short=VDAC-1 [Arabidopsis thaliana]
 gb|AAF03498.1|AC010676_8 putative porin [Arabidopsis thaliana]
 gb|AAK59817.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AAM47472.1| AT3g01280/T22N4_9 [Arabidopsis thaliana]
 gb|AEE73632.1| voltage dependent anion channel 1 [Arabidopsis thaliana]
Length=276

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            + KNITTDLKV T+S    T TVDE APGL++I SF  PDQ SGKVELQYLHEYAGISTS
Sbjct  61   RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G+N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNF  155



>ref|XP_010492333.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Camelina sativa]
Length=276

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT TVDEP PG+K I+S   PDQKSGK+ELQYLH+YAGISTS
Sbjct  61   KNKNFTADIKVSTDSSLVTTFTVDEPTPGVKAILSARLPDQKSGKLELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT SP V+FSGV G N LALGTDVSF+T +G F
Sbjct  121  VGLTGSPTVNFSGVVGTNVLALGTDVSFETDSGNF  155



>ref|XP_010512938.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Camelina 
sativa]
Length=276

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLYRD+ +D KF+ITTYS  GVAITS+G KKG++L+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDHNSDQKFSITTYSPAGVAITSTGTKKGDVLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            + KN+TTD KV T+S +  T TVDE APGLK+I SF APDQ SGK+E+QYLHEYAGISTS
Sbjct  61   RQKNVTTDFKVCTDSTVLITATVDEAAPGLKSIFSFKAPDQNSGKIEVQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA+GTD+SFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDISFDTKSGNF  155



>gb|AAW22621.1| outer mitochondrial membrane protein porin 1 [Brassica napus]
Length=276

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG Y+DIGKKA+DLLY+D+ +D K +ITT+S  GVAITS+G KKG+ L+ DV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LALGTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNF  155



>ref|XP_009131920.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Brassica 
rapa]
Length=276

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+D+ +D K +ITTYS  GVAITS+G KKGE L+ DV  QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDVVFQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV GNN LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGNNALAVGTDVSFDTKSGNF  155



>emb|CDY66736.1| BnaCnng52100D [Brassica napus]
Length=276

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG Y+DIGKKA+DLLY+D+ +D K +ITT+S  GVAITS+G KKG+ L+ DV+ QL
Sbjct  1    MGKGPGRYTDIGKKARDLLYKDHNSDQKLSITTHSPAGVAITSTGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDLKV T+S +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDSTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LALGTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVVGTNVLALGTDVSFDTKSGNF  155



>ref|XP_006408480.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
 gb|ESQ49933.1| hypothetical protein EUTSA_v10021076mg [Eutrema salsugineum]
Length=341

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   EGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVN  242
            E +MVKGPGLY+DIGKKA+DLLY+D+ +D K +ITTYS  GVAITS+G KKG+LL+ DV 
Sbjct  63   EAKMVKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGDLLLGDVA  122

Query  243  TQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGI  422
             Q K KNITTD KV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGI
Sbjct  123  FQSKQKNITTDFKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGI  182

Query  423  STSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            STS+GLT +P V+FSGV G+N +ALGTDVSFDT +G F
Sbjct  183  STSMGLTQNPTVNFSGVIGSNVVALGTDVSFDTKSGNF  220



>ref|XP_009125035.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKA+DLLY+D+ +D K +ITTYS  GVAITS+G KKGE L+ D   QL
Sbjct  1    MGKGPGLYTDIGKKARDLLYKDHNSDQKLSITTYSPAGVAITSTGTKKGESLLGDGGFQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTD KV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDFKVSTDNTVLITATVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV GNN LALGTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVVGNNLLALGTDVSFDTKSGSF  155



>ref|XP_006400027.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
 gb|ESQ41480.1| hypothetical protein EUTSA_v10014354mg [Eutrema salsugineum]
Length=276

 Score =   217 bits (553),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D K +ITTYSA+GVAIT+SG  KG+L +ADV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSASGVAITTSGTNKGDLFLADVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNK  T D+KV T+S L TT T DE  PGLK I+S   PDQKSGKVELQYLH+YAGISTS
Sbjct  61   KNKKFTADIKVATDSSLLTTFTYDEATPGLKAILSAKLPDQKSGKVELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G N LALG DVSF+T +G F
Sbjct  121  VGLTANPIVNFSGVVGTNVLALGADVSFNTESGNF  155



>ref|XP_002884286.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60545.1| hypothetical protein ARALYDRAFT_477400 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+D+ +D KF+ITT+S  GVAITS+G KKG+LL+ DV  Q 
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            + KNITTDLKV T+S +  T TVDE APGLK+I SF  PDQ SGK+ELQYLH+YAGISTS
Sbjct  61   RQKNITTDLKVCTDSTVLITATVDEAAPGLKSIFSFKVPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA+GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAVGTDVSFDTKSGNF  155



>gb|AAM62480.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
Length=274

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLYRDY  D KF++TTYS+TGVAIT++G  KG L + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YAGISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +G TA+P+V+FSGV G N L+LGTDV+++T +G F
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNF  155



>ref|XP_009134621.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 127/155 (82%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGKK +DLLY+D+ +DHK +ITT+S  GVAITS+G KKG+LL+ DV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLYKDHNSDHKLSITTHSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNF  155



>ref|XP_003621109.1| Outer plastidial membrane protein porin [Medicago truncatula]
 gb|AES77327.1| porin/voltage-dependent anion-selective channel protein [Medicago 
truncatula]
Length=277

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPGLY+DIGKKA+DLL++DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDT  521
            L A+P+V+ SGV G N LA G D+S+DT
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDT  151



>gb|AFK38338.1| unknown [Medicago truncatula]
Length=277

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPGLY+DIGKKA+DLL++DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTDIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGTKKGELFVGDVNTQLKN  63

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDT  521
            L A+P+V+ SGV G N LA G D+S+DT
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDT  151



>ref|XP_002873707.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49966.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
lyrata subsp. lyrata]
Length=276

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YA ISTS
Sbjct  61   KNKNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAAISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +G TASP+V+FSGV G N LALGTDV+F+T +G F
Sbjct  121  VGFTASPIVNFSGVVGTNVLALGTDVAFNTESGNF  155



>ref|XP_009147408.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Brassica rapa]
Length=276

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKAKDLLY+D+ +D KF+ITT S  GV ITSSG KKG+ L+ DV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDLKV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FS V G N LA GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNF  155



>emb|CDY68122.1| BnaA05g37480D [Brassica napus]
Length=276

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY+DIGKKAKDLLY+D+ +D KF+ITT S  GV ITSSG KKG+ L+ DV+ QL
Sbjct  1    MGKGPGLYTDIGKKAKDLLYKDHNSDQKFSITTQSPAGVGITSSGTKKGDSLLGDVSLQL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDLKV T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLHEYAGISTS
Sbjct  61   KQKNITTDLKVSTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHEYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FS V G N LA GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSAVMGTNVLAAGTDVSFDTKSGNF  155



>gb|KFK25745.1| hypothetical protein AALP_AA8G154100 [Arabis alpina]
Length=276

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  DHK T+TT S TGV IT++G+ KG L V DV TQ+
Sbjct  1    MAKGPGLYTEIGKKARDLLYKDYQGDHKLTVTTSSETGVVITTTGINKGNLFVGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T DLKV T+S L TT+T DE APGLKTI+S   PDQKSGK+ELQYLH+YAGI TS
Sbjct  61   KNKNFTADLKVATDSSLLTTLTYDEAAPGLKTILSAKLPDQKSGKLELQYLHDYAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P V+F+GV G N LALGTD SF+T TG  
Sbjct  121  VGLTANPTVNFAGVVGTNILALGTDASFNTETGNL  155



>gb|ACJ85253.1| unknown [Medicago truncatula]
Length=277

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPGLY++IGKKA+DLL++DY +D KFT++TYS TGVAITSSG KKGEL V DVNTQLKN
Sbjct  4    KGPGLYTNIGKKARDLLFKDYNSDQKFTVSTYSPTGVAITSSGAKKGELFVGDVNTQLKN  63

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN T D+KVDT S L+TTITV EPAPG+K IIS   PD  SGKVELQYLH+YAGIS +IG
Sbjct  64   KNYTADIKVDTESNLFTTITVTEPAPGVKAIISCKVPDPASGKVELQYLHDYAGISGNIG  123

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDT  521
            L A+P+V+ SGV G N LA G D+S+DT
Sbjct  124  LKANPVVNLSGVFGTNALAFGGDISYDT  151



>ref|NP_197013.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 ref|NP_001190314.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 sp|Q9SMX3.3|VDAC3_ARATH RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Protein HYPERSENSITIVE RESPONSE 2; Short=Athsr2; 
AltName: Full=Voltage-dependent anion-selective channel protein 
3; Short=AtVDAC3; Short=VDAC-3 [Arabidopsis thaliana]
 emb|CAA10363.1| voltage-dependent anion-selective channel protein [Arabidopsis 
thaliana]
 emb|CAC01828.1| voltage-dependent anion-selective channel protein hsr2 [Arabidopsis 
thaliana]
 gb|AAL36247.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AAM67451.1| putative voltage-dependent anion-selective channel protein hsr2 
[Arabidopsis thaliana]
 gb|AED92115.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
 gb|AED92116.1| voltage dependent anion channel 3 [Arabidopsis thaliana]
Length=274

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLYRDY  D KF++TTYS+TGVAIT++G  KG L + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KN N T D+KV T+S L TT+T DEPAPGLK I+    PD KSGK E+QY H+YAGISTS
Sbjct  61   KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +G TA+P+V+FSGV G N L+LGTDV+++T +G F
Sbjct  121  VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNF  155



>emb|CDX74294.1| BnaA03g27530D [Brassica napus]
Length=276

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY+DIGKK +DLL++D+ +DHK +ITT S  GVAITS+G KKG+LL+ DV   L
Sbjct  1    MVKGPGLYTDIGKKVRDLLFKDHNSDHKLSITTQSPAGVAITSTGTKKGDLLLGDVGFLL  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KNITTDL+V T++ +  T TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS
Sbjct  61   KQKNITTDLRVCTDNTVLITATVDEAAPGLKSIFSFRAPDQNSGKIELQYLHDYAGISTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT +P V+FSGV G N LA GTDVSFDT +G F
Sbjct  121  MGLTQNPTVNFSGVIGTNVLAAGTDVSFDTKSGNF  155



>gb|KJB30017.1| hypothetical protein B456_005G139100 [Gossypium raimondii]
Length=255

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 21/155 (14%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLYSDIGKKA+DLLY+DY ADHKFT+TTY++ GVAITS+G+KKGELL+AD     
Sbjct  1    MGKGPGLYSDIGKKARDLLYKDYQADHKFTVTTYTSNGVAITSTGIKKGELLLAD-----  55

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
                            L+ T+TVDEPAPGLKTI SF+ PDQ+SGKVELQY HEYAGISTS
Sbjct  56   ----------------LFATVTVDEPAPGLKTIFSFIVPDQRSGKVELQYQHEYAGISTS  99

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGL A+PLV+FSGV GNN +++GTD+SFDT +G F
Sbjct  100  IGLNANPLVNFSGVVGNNCVSVGTDLSFDTGSGNF  134



>ref|XP_006286537.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
 gb|EOA19435.1| hypothetical protein CARUB_v10001678mg [Capsella rubella]
Length=276

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MVKGPGLY++IGKKA+DLLY+DY  D KF++TTYS+TGVAIT++G  KG + + DV TQ+
Sbjct  1    MVKGPGLYTEIGKKARDLLYKDYQGDQKFSVTTYSSTGVAITTTGTNKGSVFLGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV T+S L TT T+DEP PG+K I S   PDQKSGK ELQYL++YAGI+TS
Sbjct  61   KNKNFTADIKVSTDSSLLTTFTLDEPTPGVKAIFSAKLPDQKSGKFELQYLNDYAGIATS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + LT SP+V+FSGV G N +ALGTDVSF+T +G F
Sbjct  121  LSLTGSPIVNFSGVVGTNVVALGTDVSFETESGNF  155



>ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLY+DY+ D KFT+TTY++ GVAIT+SG KK E +  ++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++  IG
Sbjct  62   NITVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G   L++G DVSFDTA+G F
Sbjct  122  LTANPIVNLSGVVGTKALSVGADVSFDTASGNF  154



>ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLYRDY+ D KFT+TTY+++GVAIT+SG KK E +  ++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYRDYLTDQKFTVTTYTSSGVAITASGTKKNEFIFGEIQSQLKKK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K ++ S L TT+TVDE A PGL+TI SFV P+Q+SGKVELQYLH+YAG++TSIG
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLRTIFSFVVPEQRSGKVELQYLHDYAGVNTSIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G    A+G DVSFDTA+G F
Sbjct  122  LTANPIVNLSGVFGTKGFAVGADVSFDTASGNF  154



>emb|CDY59668.1| BnaCnng35410D [Brassica napus]
Length=276

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D K +ITTYS+TGV+IT+SG  KG+L V DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVSITTSGTNKGDLFVGDVATQV  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV ++S + TT T DE  PGLKTI+S   PDQKS KVELQYLH +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKTIVSAKVPDQKSAKVELQYLHPHAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNF  155



>ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLY+DY+ D KFT+TTY++TGVAIT+SG KK E +  ++ +QLK K
Sbjct  2    GPGLYSEIGKKARDLLYKDYLTDQKFTVTTYTSTGVAITASGTKKTEFIFGEIQSQLKKK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K ++ S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++TSIG
Sbjct  62   NITVDVKANSESNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNTSIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ S V G    A+G DVSFDTA+G F
Sbjct  122  LTANPIVNISSVFGTKAFAVGADVSFDTASGNF  154



>ref|XP_008775594.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=275

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IG+KA+DLLY+DY+ D KFT+TTY++ GVAIT+SG KK E +  ++ +QLKNK
Sbjct  2    GPGLYSEIGRKARDLLYKDYLTDQKFTVTTYTSNGVAITASGTKKNEFIFGEIQSQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NI+ D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++  IG
Sbjct  62   NISVDVKANSDSNLLTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDYAGVNAGIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G   L++G DVSFDTA+G F
Sbjct  122  LTANPIVNLSGVVGTRGLSVGADVSFDTASGNF  154



>ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Phoenix dactylifera]
Length=276

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLY+DY  D KFT+ TY+A GVAIT+SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSEIGKKARDLLYKDYHTDQKFTVATYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K +++S L TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH++ G++ SIG
Sbjct  62   NITVDVKANSDSNLSTTVTVDELATPGLKTIFSFVVPDQRSGKVELQYLHDHGGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G + +A+G DVSFDTA G F
Sbjct  122  LTANPIVNLSGVVGTDAVAVGADVSFDTANGDF  154



>gb|KHG07129.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=344

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +3

Query  102  IGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLK  281
            IGKKA+DLLY+DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQLK++N+TTD+K
Sbjct  84   IGKKARDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIK  143

Query  282  VDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVS  461
            VDT+S       +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+
Sbjct  144  VDTSSN-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVN  198

Query  462  FSGVAGNNTLALGTDVSFDTATGKF  536
            FSGV G N LALGTD+SFDT TG F
Sbjct  199  FSGVLGTNVLALGTDISFDTKTGNF  223



>gb|AAS48868.1| voltage-dependent anion-selective channel [Brassica rapa subsp. 
pekinensis]
 emb|CDY69321.1| BnaA10g29750D [Brassica napus]
Length=276

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D K +ITTYS+TGVAIT+SG  KG+L + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITTYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV ++S + TT T DE  PGLK I+S   PDQKS KVELQY+H +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNF  155



>ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLYRDY  DHKFT+TT ++ GVAIT++G +K +L+  ++ +Q+KNK
Sbjct  2    GPGLYSEIGKKARDLLYRDYQTDHKFTVTTCTSNGVAITATGTRKNDLIFGEIQSQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K +++S + TT+TVDE A PGLKTI SFV PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  62   NVTFDVKTNSDSNVTTTVTVDELATPGLKTIFSFVIPDQRSGKVELQYLHDYAGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G+  +++G DV+FDTATG F
Sbjct  122  LTANPVVNLSGVVGSKNVSVGADVAFDTATGNF  154



>ref|NP_001288856.1| mitochondrial outer membrane protein porin 3-like [Brassica rapa]
 gb|AAS21632.1| voltage-dependent anion-selective channel protein [Brassica rapa]
Length=276

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGLY++IGKKA+DLLY+DY  D K +IT YS+TGVAIT+SG  KG+L + DV TQ+
Sbjct  1    MGKGPGLYTEIGKKARDLLYKDYQGDQKLSITAYSSTGVAITTSGTNKGDLFLGDVVTQI  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN T D+KV ++S + TT T DE  PGLK I+S   PDQKS KVELQY+H +AGI TS
Sbjct  61   KNKNFTADIKVASDSSILTTFTYDEATPGLKAIVSAKVPDQKSAKVELQYMHPHAGICTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLTA+P+V+FSGV G + LALGTDVSFDT +G F
Sbjct  121  VGLTANPVVNFSGVIGTSVLALGTDVSFDTESGNF  155



>ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Elaeis guineensis]
Length=275

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGK+A+DLLY+DY  D KFT+TTY+A GVAIT+SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSEIGKQARDLLYKDYQTDQKFTVTTYTANGVAITASGTKKNELIFGEIQSQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K  ++S L T + VDE A PGLKTI SFV PDQ+SG+VELQY H++AG++ SIG
Sbjct  62   NITVDVKAGSDSNLSTKVAVDELATPGLKTIFSFVLPDQRSGQVELQYQHDHAGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+VS SGV G N +A+G DVSFDTA G F
Sbjct  122  LTANPIVSLSGVVGTNAVAVGADVSFDTAVGDF  154



>ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLY+DY  DHKFT+TT +A GVAIT+SG +K +++  ++ +Q+KN 
Sbjct  2    GPGLYSEIGKKARDLLYKDYQTDHKFTVTTCTANGVAITASGTRKNDIIFGEIQSQIKNN  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K +++S + TT+T++E A PGLKTI SFV PDQ+SGKVEL YLH+YAG++ SIG
Sbjct  62   NITFDVKTNSDSNVTTTVTINELATPGLKTIFSFVIPDQRSGKVELHYLHDYAGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+FSGV G+ T+++G DV+FDTATG F
Sbjct  122  LTANPVVNFSGVVGSKTVSVGADVAFDTATGNF  154



>ref|XP_006660565.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Oryza brachyantha]
Length=274

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY +IGKKA+DLLYRDY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQYLH+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYLHDYAGVSASIGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TA+P+V+ S V G   LA+G DVS DTATG  
Sbjct  123  TANPVVNLSSVFGTKALAVGADVSLDTATGNL  154



>gb|KHG07130.1| Mitochondrial outer membrane protein porin of 34 kDa [Gossypium 
arboreum]
Length=258

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 5/140 (4%)
 Frame = +3

Query  117  KDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNS  296
            KDLLY+DY  D KFT+TT S TGVAITS+G KKG+L +ADVNTQLK++N+TTD+KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTSSPTGVAITSAGTKKGDLFLADVNTQLKSRNVTTDIKVDTSS  62

Query  297  KLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVA  476
                   +DEPAPGLK I  F  PDQ+SGK+ELQYLHEYAGIS+SIGLTA+P+V+FSGV 
Sbjct  63   N-----AIDEPAPGLKAIFGFRVPDQRSGKIELQYLHEYAGISSSIGLTANPIVNFSGVL  117

Query  477  GNNTLALGTDVSFDTATGKF  536
            G N LALGTD+SFDT TG F
Sbjct  118  GTNVLALGTDISFDTKTGNF  137



>gb|EAZ08792.1| hypothetical protein OsI_31052 [Oryza sativa Indica Group]
Length=274

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY +IGKKA+DLLYRDY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TASP+V+ S V G   LA+G DVS DTATG  
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNL  154



>gb|EAZ44453.1| hypothetical protein OsJ_29066 [Oryza sativa Japonica Group]
Length=274

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY +IGKKA+DLLYRDY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TASP+V+ S V G   LA+G DVS DTATG  
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNL  154



>sp|P46274.1|VDAC1_WHEAT RecName: Full=Mitochondrial outer membrane porin; AltName: Full=Voltage-dependent 
anion-selective channel protein; Short=VDAC 
[Triticum aestivum]
 emb|CAA54788.1| voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS IGKKAKDLLYRDY  DHKFT+TTY+A G AIT++  KK +L V ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGKVELQYLH+YAGI+ SIG
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SG  G + LA+G DVS DTAT  F
Sbjct  123  LTANPVVNLSGAFGTSALAVGADVSLDTATKNF  155



>ref|NP_001062983.1| Os09g0361400 [Oryza sativa Japonica Group]
 sp|Q6K548.3|VDAC1_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 1; AltName: 
Full=Voltage-dependent anion-selective channel protein 
1; Short=OsVDAC1 [Oryza sativa Japonica Group]
 emb|CAB82853.1| voltage-dependent anion channel [Oryza sativa]
 dbj|BAD23330.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAF24897.1| Os09g0361400 [Oryza sativa Japonica Group]
 dbj|BAG87823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87525.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY +IGKKA+DLLYRDY  DHKFT+TTY++ GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            NIT D+K +++S + TT+TVDE  PGLK+I+SF  PDQ+SGK ELQY H+YAG+S SIGL
Sbjct  63   NITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGL  122

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TASP+V+ S V G   LA+G DVS DTATG  
Sbjct  123  TASPVVNLSSVFGTKALAVGADVSLDTATGNL  154



>gb|KDO82799.1| hypothetical protein CISIN_1g0238541mg, partial [Citrus sinensis]
Length=162

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  AITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAP  368
            AITSSGVKKGEL +ADV+TQLKNKNITTD+KVDTNS L+TTITVDEPAPGLK+I SF+ P
Sbjct  28   AITSSGVKKGELFLADVSTQLKNKNITTDVKVDTNSNLFTTITVDEPAPGLKSIFSFIVP  87

Query  369  DQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            DQ+SGKVELQY HEYAGIST IG TA+P+V+FSGV GNN++ALGTD+SFDTATG F
Sbjct  88   DQRSGKVELQYQHEYAGISTGIGFTANPIVNFSGVVGNNSVALGTDLSFDTATGNF  143



>ref|XP_004956656.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Setaria italica]
Length=276

 Score =   201 bits (512),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLYRDY  DHKFT+TTY++ GVA+T++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTSNGVAVTATSTKKADLIIGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K +++S + TT+T+DE A PGLK I+SF  PDQ+SGK ELQYLH+YAG++ SIG
Sbjct  63   NITVDVKANSDSNVITTVTIDEVATPGLKAILSFAVPDQRSGKFELQYLHDYAGVNASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +TA+P+V+ SG  G   LA+G D+S DTATG F
Sbjct  123  MTANPIVNLSGSFGTKALAVGADISLDTATGNF  155



>ref|XP_002460110.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
 gb|EER96631.1| hypothetical protein SORBIDRAFT_02g022910 [Sorghum bicolor]
Length=276

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK KDLLY+DY  DHKFT+TTY++ GVA+T+S  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYAEIGKKTKDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NIT D+K ++ S + TT+TVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NITVDVKANSESNIITTVTVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ S   G   LA+G DVS DTATG  
Sbjct  123  LTANPVVNLSAAFGTKALAVGADVSLDTATGNL  155



>ref|XP_009403419.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=273

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYSD+ K+A+DLLY+DY  D KFTITT +  GV+IT+SG KK EL+  ++ +Q KN 
Sbjct  2    GPGLYSDVAKRARDLLYKDYQTDQKFTITTSTLNGVSITTSGTKKNELIFGELQSQWKNN  61

Query  261  NITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGL  440
            NI+ D+K  ++SK  TT+TVDE  PGL++I S + PDQ+SGKVELQYLH YAG++  IGL
Sbjct  62   NISVDVKATSDSKFATTVTVDELTPGLRSIFSVIIPDQRSGKVELQYLHNYAGVTAGIGL  121

Query  441  TASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            TA+P+V+ SGV G NT A+G DVSFDTATG F
Sbjct  122  TANPVVNLSGVVGTNTYAVGADVSFDTATGNF  153



>ref|XP_003578022.1| PREDICTED: mitochondrial outer membrane porin [Brachypodium distachyon]
Length=276

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLYRDY  DHKFT+TTY+A GVAIT++  KK +L+  ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYRDYQTDHKFTLTTYTANGVAITATSSKKADLIFGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S + TT+TVDE  APGLKTI SF  PDQ+SGK+ELQYLH+YAGI+ SIG
Sbjct  63   GVTVDVKANSASNVITTVTVDELAAPGLKTIFSFAIPDQRSGKLELQYLHDYAGINASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SG  G N LA+G DVS DTAT  F
Sbjct  123  LTANPVVNLSGSFGTNALAVGADVSLDTATKNF  155



>ref|NP_001105619.1| voltage-dependent anion channel protein1a [Zea mays]
 gb|AAD56651.1|AF178950_1 voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLY+DY  DHKFT+TTY++ GVA+T+S  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S + TTITVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ S   G   +ALG D+S DTATG  
Sbjct  123  LTANPVVNLSAAFGTKAVALGADISLDTATGNL  155



>ref|XP_009408829.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYSDIGKKA+DLLY+DY  D K T+TTY+  G+AI++SG KK EL+  ++ +QLKNK
Sbjct  2    GPGLYSDIGKKARDLLYKDYQTDQKVTLTTYTLNGIAISASGTKKNELIFGELQSQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            NI+ D+K  ++SKL TT+TVDE A PGL++I +F+ PDQ+ GKVELQYLH+Y G++ ++G
Sbjct  62   NISFDVKATSDSKLLTTVTVDELATPGLRSIFNFIIPDQQLGKVELQYLHDYVGVTAAVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SGV G N  ++G DVSFDTATG F
Sbjct  122  LTANPIVNLSGVVGTNVYSVGADVSFDTATGNF  154



>gb|ACF85328.1| unknown [Zea mays]
 gb|ACG42313.1| isochorismate synthase 1 [Zea mays]
 tpg|DAA39954.1| TPA: voltage-dependent anion channel protein 1a [Zea mays]
Length=276

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLY+DY  DHKFT+TTY++ GVA+T+S  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S + TTITVDE A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ SIG
Sbjct  63   NMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASIG  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ S   G   +A+G D+S DTATG  
Sbjct  123  LTANPVVNLSAAFGTKAVAVGADISLDTATGNL  155



>ref|XP_009393634.1| PREDICTED: mitochondrial outer membrane protein porin 1-like 
[Musa acuminata subsp. malaccensis]
Length=275

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY +IG+KA++LLYRDY  DHK T+TT ++ GV IT+SG +K +L+  ++ + +KNK
Sbjct  2    GPGLYFEIGRKARELLYRDYQTDHKVTVTTCTSNGVEITASGTRKNDLIFGEIQSHIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K +++S + TTIT+DE A PGLKTI SFV PDQ+SGKVE+QYLH+Y GI+ SIG
Sbjct  62   NVTFDVKTNSDSNVTTTITIDELASPGLKTIFSFVVPDQRSGKVEIQYLHDYTGINASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+V+ SG  G+ TL++G DV+FDT TGKF
Sbjct  122  LTANPVVNLSGAVGSKTLSVGADVAFDTTTGKF  154



>gb|ABK23226.1| unknown [Picea sitchensis]
Length=276

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+S+IGKKAKDLL RDY  D KFT+TT+S TG+A TS+GVKKGEL   D+NTQ 
Sbjct  1    MGKGPGLFSEIGKKAKDLLTRDYNYDQKFTVTTFSETGLAFTSTGVKKGELFSGDLNTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K +N T D+K+DTNS + TTIT+D+P P  KTI SF  PDQKSGKV+LQY H++ G+S+S
Sbjct  61   KYQNATVDVKIDTNSNILTTITLDQPIPNAKTIFSFKIPDQKSGKVDLQYFHDHVGLSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT +P+V  SG  G++ +++G +++FDTA+  F
Sbjct  121  IGLTPTPIVEVSGALGSDGISVGGEMAFDTASSTF  155



>tpg|DAA61162.1| TPA: voltage-dependent anion-selective channel protein [Zea mays]
Length=276

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLY+DY  DHKFT+TTYS+ GVA+T++  KK +L+ +++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S + TT+TV+E A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+ + S   G   LA+G ++SFD+ATG F
Sbjct  123  LTANPVANLSAAFGTKALAVGAEISFDSATGNF  155



>ref|NP_001104948.1| voltage-dependent anion channel protein1b [Zea mays]
 gb|AAD56652.1|AF178951_1 voltage-dependent anion channel protein 1b [Zea mays]
Length=276

 Score =   194 bits (492),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK +DLLY+DY  DHKFT+TTYS+ GVA+T++  KK +L+ +++++Q+KNK
Sbjct  3    GPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S + TT+TV+E A PGLKTI+SF  PDQ+SGKVELQYLH+YAG++ S+ 
Sbjct  63   NMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNASVS  122

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            LTA+P+ + S   G   LA+G ++SFD+ATG F
Sbjct  123  LTANPVANLSAGFGTKALAVGAEISFDSATGNF  155



>gb|EMS51310.1| Mitochondrial outer membrane porin [Triticum urartu]
Length=596

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS IGKKAKDLLYRDY  DHKFT+TTY+A G AIT++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGK-VELQYLHEYAGISTSI  434
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGK VELQYLH+YAGI+ SI
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGINASI  122

Query  435  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            GLTA+P+V+ SG  G + LALG DVS DTAT  F
Sbjct  123  GLTANPVVNLSGAFGTSALALGADVSLDTATKNF  156



>gb|EMS47295.1| Outer plastidial membrane protein porin [Triticum urartu]
Length=275

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  +P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>emb|CAA57646.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=275

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AGI+ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGINASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  +P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>emb|CDM83072.1| unnamed protein product [Triticum aestivum]
Length=275

 Score =   191 bits (486),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+AG++ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFAGVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  +P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>dbj|BAJ99489.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88464.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY    KFT+TT +  GVAIT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT TVDE A PGLK+I+S V PDQ+SGK+ELQYLHE+A ++ S+G
Sbjct  62   NLTVDIKANSESDLLTTFTVDEFATPGLKSILSLVVPDQRSGKLELQYLHEFASVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  SP+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPSPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>gb|EMT02908.1| Mitochondrial outer membrane porin [Aegilops tauschii]
Length=667

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS IGKKAKDLLYRDY  DHKFT+TTY+A G AIT++  KK +L++ ++ +Q+KNK
Sbjct  3    GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGAAITATSTKKADLILGEIQSQIKNK  62

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGK-VELQYLHEYAGISTSI  434
            NIT D+K ++ S + TTIT D+  APGLKTI+SF  PDQKSGK VELQYLH+YAGI+ SI
Sbjct  63   NITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVVELQYLHDYAGINASI  122

Query  435  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            GLTA+P+V+ SG  G + LA+G DVS DTAT  F
Sbjct  123  GLTANPVVNLSGAFGTSALAVGADVSLDTATKNF  156



>ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Oryza brachyantha]
Length=275

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KFT+TT ++ GVA+T++G +K E +  +++TQLKNK
Sbjct  2    APGLYADIGKKTRDLLYKDYGTHQKFTLTTCTSEGVAVTAAGTRKNESVFGELHTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+G
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SGV G+  L++G DV+FDTAT  F
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNF  154



>ref|NP_001043433.1| Os01g0588200 [Oryza sativa Japonica Group]
 sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: 
Full=Voltage-dependent anion-selective channel protein 
3; Short=OsVDAC3 [Oryza sativa Japonica Group]
 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group]
 dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group]
 gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group]
 gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group]
 dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=275

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 118/153 (77%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY   HKFT+TT +  GV IT++G +K E +  ++ TQLKNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYGTHHKFTLTTCTPEGVTITAAGTRKNESVFGELQTQLKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAGI+ S+G
Sbjct  62   KLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGINASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SGV G+  L++G DV+FDTAT  F
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVAFDTATSNF  154



>ref|XP_004969385.1| PREDICTED: mitochondrial outer membrane protein porin 3-like 
[Setaria italica]
Length=275

 Score =   188 bits (477),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  GVAIT++G +K E L  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSVTTCSPHGVAITAAGTRKNESLFGELHTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+I+S V PDQ+SGK+ELQYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSILSLVVPDQRSGKLELQYLHEYAGVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNSNPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium 
distachyon]
Length=275

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLYRDY    KFT+TT +  GVAIT++G +K E +  ++ TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYRDYCTHQKFTLTTCTPEGVAITAAGTRKNESIFGELQTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K ++ S L TT+TVDE   PGLK+I+S V PDQ+SGK+E QYLHE+AGI+ ++G
Sbjct  62   NLTVDVKANSESDLLTTVTVDEFGTPGLKSILSLVVPDQRSGKLEFQYLHEFAGINANVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  +P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPNPMVNLSGVFGSKELSVGVDVSFDTATSNF  154



>gb|KCW56275.1| hypothetical protein EUGRSUZ_I02018 [Eucalyptus grandis]
Length=260

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  192  ITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPD  371
            +TS+G KKGEL +ADVNTQLKNKNITTD+KVDT+S L+TTITVDEPAPGLK+I SF  PD
Sbjct  25   LTSTGTKKGELFLADVNTQLKNKNITTDIKVDTSSNLFTTITVDEPAPGLKSIFSFKVPD  84

Query  372  QKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            Q+SGK+ELQYLHE+AGIS+SIGLTA+P+V+FSGV G + LALGTDVSFDT +G F
Sbjct  85   QRSGKIELQYLHEHAGISSSIGLTANPIVTFSGVIGTSALALGTDVSFDTKSGDF  139



>ref|XP_002458065.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
 gb|EES03185.1| hypothetical protein SORBIDRAFT_03g026350 [Sorghum bicolor]
Length=275

 Score =   186 bits (472),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+I+S V PDQ+SGK ELQYLHEYAG++ SIG
Sbjct  62   KLTVDIKANSESDLLTTITVDELGTPGLKSILSLVVPDQRSGKFELQYLHEYAGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L  +P+V+ SGV G+  L++G DVSFDTAT  F
Sbjct  122  LNPNPMVNISGVFGSKALSVGVDVSFDTATSNF  154



>ref|XP_001779057.1| predicted protein [Physcomitrella patens]
 gb|EDQ56094.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 115/153 (75%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG Y+DIGKK KDLL +DY  D KF ITT + +G+A TS+G+K+GE    D+NTQ 
Sbjct  1    MGKGPGFYTDIGKKTKDLLNKDYTYDQKFVITTSTKSGLAFTSTGLKRGEAFTGDLNTQF  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+T D+KVDT S ++TTIT+DE APG K++ SF  PD KSGK+E+QY  +Y GI+ S
Sbjct  61   KNKNVTADVKVDTKSNIFTTITIDEFAPGAKSVFSFTIPDHKSGKLEIQYKQDYCGITGS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            IGL+ SP+V  +G  GN+  ++G +V+FD+A G
Sbjct  121  IGLSPSPIVEATGALGNDGFSVGGEVAFDSANG  153



>dbj|BAL41368.1| porin, partial [Arum maculatum]
Length=198

 Score =   182 bits (461),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +3

Query  126  LYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLY  305
            LY+DY  D KF  +T +A GVAITS+G KK +L+  ++ TQ+KNK +TTDLKV+++S L 
Sbjct  1    LYKDYQTDQKFVFSTCAANGVAITSTGTKKNDLIFGEIQTQIKNKGVTTDLKVNSDSTLL  60

Query  306  TTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNN  485
            TTITVDE AP  KTI+SFV PDQ+SGKVELQYLH+YAGI+ S GLTA+P+V+F+ V G N
Sbjct  61   TTITVDEIAPRFKTILSFVVPDQRSGKVELQYLHDYAGINASFGLTANPIVNFASVVGTN  120

Query  486  TLALGTDVSFDTATGKF  536
            TLA G D+SF+TATG F
Sbjct  121  TLAAGVDLSFNTATGDF  137



>gb|AFW83107.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   183 bits (465),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SG  G+  L++G DVSFDTAT  F
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDF  154



>ref|XP_001781995.1| predicted protein [Physcomitrella patens]
 gb|EDQ53219.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG+YSDIGKK KDLL +DY  D KF ITT + +G+A TS+GVK+GE    DVNT  
Sbjct  1    MGKGPGMYSDIGKKTKDLLNKDYTYDQKFVITTNTQSGLAFTSTGVKRGEGFSGDVNTSF  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            KNKN+T D+KVDT S ++ T+TVDE APG K++ +F  PD KSGK+EL Y  +Y GIS S
Sbjct  61   KNKNVTADVKVDTKSNIFATVTVDEFAPGAKSVFTFTIPDHKSGKLELLYKQDYCGISGS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            IGLT SP+V  +G  GN   ++G +++FDTA+G
Sbjct  121  IGLTPSPIVEATGALGNEGFSVGGELAFDTASG  153



>gb|ACG45954.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF +TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SG  G+  L++G DVSFDTAT  F
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTATSDF  154



>ref|NP_001278544.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF81491.1| unknown [Zea mays]
Length=275

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  GVAIT++G +K E +  +++TQ+KNK
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTSSPNGVAITAAGTRKNESIFGELHTQIKNK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ S+G
Sbjct  62   KLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SG  G+  L++G DVSFDTA+  F
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTASSDF  154



>sp|P42057.1|VDAC_MAIZE RecName: Full=Outer plastidial membrane protein porin; AltName: 
Full=Voltage-dependent anion-selective channel protein; Short=VDAC 
[Zea mays]
 emb|CAA51828.1| porin [Zea mays]
Length=277

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 117/156 (75%), Gaps = 1/156 (1%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            MV   GLY+DIGKK +DLLY+DY    KF +TT S  GVAIT++G +K E +  +++TQ+
Sbjct  1    MVVAVGLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQI  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGIST  428
            KNK +T D+K ++ S L TTITVDE   PGLK+II+ V PDQ+SGK+E QYLHEYAG++ 
Sbjct  61   KNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNA  120

Query  429  SIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            S+GL ++P+V+ SG  G+  L++G DVSFDTAT  F
Sbjct  121  SVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDF  156



>ref|XP_006298184.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
 gb|EOA31082.1| hypothetical protein CARUB_v10014234mg, partial [Capsella rubella]
Length=267

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 107/134 (80%), Gaps = 0/134 (0%)
 Frame = +3

Query  135  DYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTI  314
            D+ +D KF+ITTYS  GVAITSSG KKG+LL+ DV  Q + KN+TTD KV T+S +  T 
Sbjct  13   DHNSDQKFSITTYSPAGVAITSSGTKKGDLLLGDVAFQSRQKNVTTDFKVCTDSTVLITA  72

Query  315  TVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLA  494
            TVDE APGLK+I SF APDQ SGK+ELQYLH+YAGISTS+GLT +P V+FSGV G N LA
Sbjct  73   TVDEAAPGLKSIFSFKAPDQNSGKIELQYLHDYAGISTSMGLTQNPTVNFSGVIGTNVLA  132

Query  495  LGTDVSFDTATGKF  536
            +GTDVSFDT +G F
Sbjct  133  VGTDVSFDTKSGNF  146



>ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays]
 gb|ACF86667.1| unknown [Zea mays]
 tpg|DAA58725.1| TPA: outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   179 bits (453),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  G+AIT++G +K E    D++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+I++ V PDQ+SGK+ELQYLHEY G++ SIG
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SG  G+  L++G DVSFDT T  F
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTETSNF  154



>gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays]
Length=275

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
             PGLY+DIGKK +DLLY+DY    KF++TT S  G+AIT++G +K E    D++TQ+KN 
Sbjct  2    APGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKNN  61

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
             +T D+K ++ S L TTITVDE   PGLK+I++ V PDQ+SGK+ELQYLHEY G++ SIG
Sbjct  62   KLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASIG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L ++P+V+ SG  G+  L++G DVSFDT +  F
Sbjct  122  LNSNPMVNLSGAFGSKALSVGVDVSFDTESSNF  154



>gb|ADE77918.1| unknown [Picea sitchensis]
Length=276

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 114/155 (74%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+S+IGKKA+DLL +DY  D KF +TTYS  G+ ITS+G+ KG L   D++T  
Sbjct  1    MGKGPGLFSNIGKKARDLLTKDYSHDQKFAVTTYSEDGLGITSTGMNKGGLFCGDIDTHY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K +N T ++KVDTNS + TTIT+DE  PG KT++SF  PD+KSGK++ QY HE+ G+S+S
Sbjct  61   KYQNSTINVKVDTNSNISTTITIDEVLPGAKTVLSFKLPDEKSGKLDFQYSHEHVGLSSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GLT  P V FSG  G++   +G +V FDT++G F
Sbjct  121  VGLTPKPQVDFSGAIGSDVFTVGGEVGFDTSSGLF  155



>ref|XP_004969745.1| PREDICTED: mitochondrial outer membrane protein porin 4-like 
[Setaria italica]
Length=275

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 114/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYSDIGKKA+DLL +D+  D KFT+TTY++ G AIT++  KK E + +++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLNKDFHTDQKFTLTTYTSNGAAITAASTKKNEAIFSEIQAQLKQK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K  T+S L TT+TV+E   PGLK I++   P+Q +GK E+QYLH+YAGI+ S G
Sbjct  62   NVTVDVKATTDSLLLTTVTVEEFGVPGLKKIVTIPFPNQAAGKAEVQYLHDYAGINASFG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L + PLV+ SGV G   +A+G DV++DTATG F
Sbjct  122  LNSKPLVNLSGVFGTKAIAVGADVAYDTATGDF  154



>ref|NP_001056162.1| Os05g0536200 [Oryza sativa Japonica Group]
 sp|Q6L5I5.1|VDAC2_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 2; AltName: 
Full=Voltage-dependent anion-selective channel protein 
2; Short=OsVDAC2 [Oryza sativa Japonica Group]
 emb|CAC80850.1| voltage-dependent anion channel [Oryza sativa Japonica Group]
 gb|AAT39214.1| voltage-dependent anion-selective channel (VDAC) protein [Oryza 
sativa Japonica Group]
 dbj|BAF18076.1| Os05g0536200 [Oryza sativa Japonica Group]
 dbj|BAG92718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79592.1| hypothetical protein OsI_20774 [Oryza sativa Indica Group]
 gb|EEE64499.1| hypothetical protein OsJ_19349 [Oryza sativa Japonica Group]
Length=280

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  90   LYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNIT  269
            LYSDIGKKA+DLLYRDY  D KFT+TTY+A G AIT +G KK E + +++ +Q+KN N++
Sbjct  12   LYSDIGKKARDLLYRDYHTDQKFTLTTYAANGAAITVAGTKKNESIFSEIQSQVKNNNVS  71

Query  270  TDLKVDTNSKLYTTITV-DEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTA  446
             D+K  ++SKL TT TV D   PGLK I+S   P QKS K E+QYLH +AG++  +GL A
Sbjct  72   VDVKATSDSKLITTFTVHDLGTPGLKGILSIPFPYQKSAKAEVQYLHPHAGLNAIVGLNA  131

Query  447  SPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +PLVSFSGV G    A+GTDV+FDTATG F
Sbjct  132  NPLVSFSGVFGTGAFAVGTDVAFDTATGDF  161



>ref|XP_006845625.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
 gb|ERN07300.1| hypothetical protein AMTR_s00019p00217910 [Amborella trichopoda]
Length=275

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG +SDIGKKA+DLL RDY  D KFT+T  S  G+A+T++G+K+G+    D++TQ 
Sbjct  1    MAKGPGPFSDIGKKARDLLTRDYNYDEKFTLTMLSDNGLALTTTGLKRGQFFTGDLSTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+ N T D+KVDTN  + +TITV+E  P  KT +SF  PD KSGK+E+QYLH+ A I++S
Sbjct  61   KSGNTTVDVKVDTNCNITSTITVNEIFPSSKTALSFKIPDHKSGKLEVQYLHDRAAINSS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            IGLT +PL+ FS   GN  ++LG +V+FDTAT 
Sbjct  121  IGLTPTPLLEFSAAVGNGEVSLGGEVAFDTATA  153



>ref|XP_006655528.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Oryza brachyantha]
Length=281

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYS+IGKKA+DLLY+DY  + KFT+TTY+A G AIT +  +K E + +++ +QLKN 
Sbjct  10   GPGLYSEIGKKARDLLYKDYHTNQKFTLTTYAANGAAITVASTRKDEAMSSEIQSQLKNN  69

Query  261  NITTDLKVDTNSKLYTTITV-DEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K  ++S L TT TV D   PG K I+S   P QKS K E+QYLH +AG++  +G
Sbjct  70   NVTVDVKATSDSTLMTTFTVHDLCMPGTKGILSIPFPYQKSAKAEVQYLHPHAGLNACVG  129

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L+A+PLVSFSG  G    A+G DV+FDTATG F
Sbjct  130  LSANPLVSFSGAFGTRAFAVGADVTFDTATGDF  162



>ref|XP_002964960.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
 gb|EFJ33798.1| hypothetical protein SELMODRAFT_143103 [Selaginella moellendorffii]
Length=276

 Score =   171 bits (432),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPG++ DIGK+ KDLL RD+ +D KFT+T+ +++G+  TS G KKGE    +VNTQ 
Sbjct  1    MGKGPGMFGDIGKRTKDLLTRDFTSDQKFTVTSSTSSGITFTSFGNKKGEQFAGNVNTQF  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K  N+T ++KVDT S ++  IT DE A G KT+ +F  PD K GK++ QY+H+  G++TS
Sbjct  61   KTNNMTVNVKVDTESNIHGVITADEIAKGAKTVFTFTIPDNKCGKIKFQYVHDLFGLATS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT+SP+   S   GN+ +A+G ++SFDTA+GK 
Sbjct  121  IGLTSSPVADLSAALGNDVVAVGGELSFDTASGKL  155



>gb|KJB34748.1| hypothetical protein B456_006G081500 [Gossypium raimondii]
Length=219

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  117  KDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNS  296
            KDLLY+DY  D KFT+TT S TGVAITS+  KKG+L + +VNTQLK +N+T D+KVDT+S
Sbjct  3    KDLLYKDYQTDQKFTLTTISLTGVAITSARTKKGDLFLVNVNTQLKFRNVTIDIKVDTSS  62

Query  297  KLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVA  476
             L+TTITVDEPAP L  I  F  PDQ+S K+ELQYLHEY GIS+SIGLT +P+V+FS V 
Sbjct  63   NLFTTITVDEPAPVLNAIFGFGVPDQRSDKIELQYLHEYVGISSSIGLTVNPIVNFSAVL  122

Query  477  GNN  485
            G N
Sbjct  123  GTN  125



>ref|XP_002973372.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
 gb|EFJ25746.1| hypothetical protein SELMODRAFT_271012 [Selaginella moellendorffii]
Length=278

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPG +SD+GKK  DLLY+D+ AD +F++++ ++TG+  +S GVKKG++   D  T    
Sbjct  5    KGPGFWSDVGKKTGDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN+T D+KVDT SK+++T+ VD+ APG + I +F  PDQKSGK+ELQY H+YAG++ S+G
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTASVG  124

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L +SP+V  +   G+N + +G + +FDTA+G F
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNF  157



>ref|XP_002976531.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
 gb|EFJ22200.1| hypothetical protein SELMODRAFT_267998 [Selaginella moellendorffii]
Length=278

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 113/153 (74%), Gaps = 0/153 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPG +SD+GKK  DLLY+D+ AD +F++++ ++TG+  +S GVKKG++   D  T    
Sbjct  5    KGPGFWSDVGKKTSDLLYKDFSADQRFSLSSTTSTGLTFSSFGVKKGDVFDGDFTTTYVC  64

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN+T D+KVDT SK+++T+ VD+ APG + I +F  PDQKSGK+ELQY H+YAG++ S+G
Sbjct  65   KNVTVDVKVDTQSKIFSTVKVDDLAPGTRAIFNFSLPDQKSGKMELQYCHQYAGVTGSVG  124

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            L +SP+V  +   G+N + +G + +FDTA+G F
Sbjct  125  LASSPVVECTSAFGSNDVVIGGEAAFDTASGNF  157



>ref|XP_004961383.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Setaria italica]
Length=276

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 112/151 (74%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKKA+DLLY+DY  D KFT+TTY++ G AIT++  +K E + +++ +QLK++
Sbjct  5    GPGLYTEIGKKARDLLYKDYHTDQKFTLTTYASNGAAITAASTRKNEAIFSEIQSQLKHE  64

Query  261  NITTDLKVDTNSKLYTTITVDEPA-PGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K  + S + TT TV E   PGLK I+    P QKS K ELQYLH +AG++ S+G
Sbjct  65   NVTVDVKATSESNVTTTFTVHELGTPGLKAILCIPFPYQKSAKAELQYLHHHAGVAASVG  124

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATG  530
            L A+P+V+ SGV G  T+A+G D SFDT++G
Sbjct  125  LNANPVVNLSGVFGTKTIAVGADASFDTSSG  155



>ref|XP_010942794.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Elaeis guineensis]
Length=275

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = +3

Query  75   VKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLK  254
            +KGPGL+SDIGKKAKDLL +DY  D K TI+TYSA+GV +TS+ VKKG L   D+ TQ K
Sbjct  1    MKGPGLFSDIGKKAKDLLNKDYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYK  60

Query  255  NKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSI  434
             KN   D+KVDTNS + TT+T+ E  P  KTI SF  PD  SGK+E+QY H++A ++T++
Sbjct  61   YKNTLIDVKVDTNSNISTTLTLSEILPSTKTIASFKLPDYNSGKLEIQYFHDHASVATAV  120

Query  435  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
             L  SP+V  SG  G + +A G +  FDTA+G F
Sbjct  121  ALKQSPVVDLSGTIGVDGIAFGAEAGFDTASGTF  154



>ref|XP_008338437.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Malus 
domestica]
Length=276

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKAKDLL +DY +D KFTI+TYS  GVA+TS+ VKKG L + D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTISTYSDAGVALTSTAVKKGGLSIGDILTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNILTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHAAXTTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L  SP + FS   G  T+A G +  +DT +G F
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNF  155



>ref|XP_009354614.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
 ref|XP_009379335.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Pyrus 
x bretschneideri]
Length=276

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKAKDLL +DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A I+T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATITTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L  SP + FS   G  T+A G +  +DT +G F
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNF  155



>gb|KJB30164.1| hypothetical protein B456_005G132100 [Gossypium raimondii]
Length=335

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 3/129 (2%)
 Frame = +3

Query  159  TITTYSATGVAITSSGVKKGELLVADVNTQLKNKNITTDLKVDTNS---KLYTTITVDEP  329
             +  YS T VAIT +G+KK +L +ADVNTQLK +N+TTD+KVDT+S   +L+TTITVDEP
Sbjct  82   CLIVYSPTDVAITFAGMKKCDLFLADVNTQLKFRNVTTDIKVDTSSNGLQLFTTITVDEP  141

Query  330  APGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDV  509
            APGLKTI  F  PDQ+SGK++LQYL+EYA IS+SIGLT +P+V+FSGV G N LALGTD+
Sbjct  142  APGLKTIFGFKVPDQRSGKIKLQYLYEYARISSSIGLTTNPIVNFSGVFGTNVLALGTDI  201

Query  510  SFDTATGKF  536
            SF+   G F
Sbjct  202  SFNMKFGNF  210



>ref|XP_008787191.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Phoenix dactylifera]
Length=275

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = +3

Query  75   VKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLK  254
            +KGPGL+SDIGKKAKDLL + Y  D K TI+TYSA+GV +TS+ VKKG L   D+ TQ K
Sbjct  1    MKGPGLFSDIGKKAKDLLTKGYSCDQKLTISTYSASGVGLTSAAVKKGGLYSFDIGTQYK  60

Query  255  NKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSI  434
             KN   D+KVDT+S + TT+T+ E  P  KTI SF  PD  SGK+E+QY H++AG++T++
Sbjct  61   YKNTLVDVKVDTDSNVSTTLTMSEILPSTKTIASFKLPDYNSGKLEIQYFHDHAGVATAV  120

Query  435  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
             L  SP+V  SG  G + +A G +  FDTA+G F
Sbjct  121  ALKQSPVVDLSGTIGIHGIAFGAEAGFDTASGTF  154



>ref|XP_008354718.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Malus domestica]
 ref|XP_009362557.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Pyrus x bretschneideri]
Length=276

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKAKDLL +DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFTDIGKKAKDLLTKDYSSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDILTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT T++E  P  KTI SF APD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKAPDFNSGKLEVQYFHDHATFTTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L+ SP + FS   G  T+A G +  +DT +G F
Sbjct  121  VALSQSPAIDFSATIGTPTIAFGAEGGYDTTSGNF  155



>ref|XP_007205702.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
 gb|EMJ06901.1| hypothetical protein PRUPE_ppa009821mg [Prunus persica]
Length=276

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+SDIGKKAKDLL +DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT T++E  P  KTI SF  PD  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKIPDHNSGKLEVQYFHDHATFTTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L  SP + FS   G  T+A G +  +DT +G F
Sbjct  121  VALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNF  155



>ref|XP_003568015.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Brachypodium distachyon]
Length=278

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 3/155 (2%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLY++IGKK++DLLY+DY  D KFT+TT +A G  IT++  KK E +V+++ +QLK K
Sbjct  5    GPGLYTEIGKKSRDLLYKDYQTDQKFTLTTVAANGATITAASTKKNEAIVSEIQSQLKGK  64

Query  261  NITTDLKVDTNSKLYTTITVDEP-APGLKTIISFVAPDQK--SGKVELQYLHEYAGISTS  431
            N+T D+KV + S +  T+TV E   PGLK ++    P  K  SGK ELQYLH +AGI+ S
Sbjct  65   NVTVDVKVTSESSVIATVTVPELYTPGLKGMLCVPIPYNKSASGKAELQYLHAHAGINAS  124

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GL A+PLV+ SGV G   LA G DV+FDTA+G F
Sbjct  125  VGLNANPLVNLSGVLGTKDLAFGADVAFDTASGDF  159



>ref|XP_002458403.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
 gb|EES03523.1| hypothetical protein SORBIDRAFT_03g032840 [Sorghum bicolor]
Length=277

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +3

Query  81   GPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNK  260
            GPGLYSDIGKKA+DLL +D+  D KF +TTYS+ G  IT+S  KK E + +++  QLK K
Sbjct  2    GPGLYSDIGKKARDLLSKDFHTDQKFILTTYSSNGTVITASSTKKNESIFSEIQAQLKQK  61

Query  261  NITTDLKVDTNSKLYTTITVDE-PAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            N+T D+K +++S L TT+TV+E   PGLK  ++   P +  GK E+QYLH+YAGIS S G
Sbjct  62   NVTVDVKANSDSLLLTTVTVEELGVPGLKKTMTIPFPHRGFGKFEIQYLHDYAGISASAG  121

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + A PLV+ S V GN  +A G DV++DTAT  F
Sbjct  122  MNAKPLVNLSAVFGNKAIAAGADVAYDTATRDF  154



>ref|XP_008238010.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Prunus mume]
Length=276

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+SDIGKKAKDLL +DY +D KFT++TYS  GVA+TS+ VKKG L   D+ TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTKDYNSDQKFTVSTYSDAGVALTSTAVKKGGLSTGDIVTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT T++E  P  KTI SF  P+  SGK+E+QY H++A  +T+
Sbjct  61   KYKNTVVDVKVDTESNISTTFTINEIVPSTKTIASFKVPEYNSGKLEVQYFHDHATFTTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            I L  SP + FS   G  T+A G +  +DT +G F
Sbjct  121  IALNQSPAIDFSATIGTPTIAFGAEGGYDTTSGNF  155



>ref|XP_009150694.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
 ref|XP_009150695.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Brassica 
rapa]
Length=276

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+SDIGKKAKDLL RDY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLMRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+K+DT+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
              L  +PL+  +   G   ++ G +  +DT++  F
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTF  155



>ref|XP_006649363.1| PREDICTED: mitochondrial outer membrane protein porin 6-like 
[Oryza brachyantha]
Length=275

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGP  + +IGK+AKDLLY+DY  D KF++TT S +G+ +T++GVK  EL + D+ TQ 
Sbjct  1    MTKGPVPFLNIGKRAKDLLYKDYNFDQKFSLTTTSNSGLGLTATGVKIDELFIGDIQTQH  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K+   T D+K+D++S++ +T+TVDE   GLKT  SF  PDQKSGK++LQYLH+   ++++
Sbjct  61   KSGKTTVDVKIDSDSRVSSTVTVDEALTGLKTSFSFRVPDQKSGKLDLQYLHDRCALNST  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            IGLT++PLV  +   G N L++G +V FD+A+  F
Sbjct  121  IGLTSTPLVELAATFGTNELSVGAEVGFDSASASF  155



>emb|CDY08723.1| BnaA06g25010D [Brassica napus]
Length=276

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+SDIGKKAKDLL RDY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+K+DT+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIDTDSTVLTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
              L  +PL+  +   G   ++ G +  +DT++  F
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTF  155



>emb|CAA63968.1| pom30 [Solanum tuberosum]
Length=276

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKA+DLL +DY++D K +I+TYS TGVA+TS+ VKKG L   DV  Q 
Sbjct  1    MSKGPGLFADIGKKARDLLTKDYISDQKLSISTYSDTGVALTSTAVKKGGLSTGDVGAQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+KVDT S + TT+T+++ AP  KTI S   PD  SGK+E+QY H +A  ST+
Sbjct  61   KYKNTLIDVKVDTASNISTTLTLNDIAPSTKTIASLKFPDYSSGKLEVQYYHHHAAFSTA  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +GL  SP+V  S   G  T A+G + S++TA GK 
Sbjct  121  VGLKQSPIVDLSVTLGTPTFAIGAEASYETAEGKL  155



>ref|XP_004231921.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
 ref|XP_010316016.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Solanum lycopersicum]
Length=330

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 116/174 (67%), Gaps = 7/174 (4%)
 Frame = +3

Query  33   LSLQLRC*------LPEGEMVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAI  194
             SL L C       LPE +M KGPGL+SDIGKKA+D+L +DY++D K +I+TYS TGVA+
Sbjct  37   FSLSLCCFYETSIPLPE-KMSKGPGLFSDIGKKARDVLTKDYISDQKLSISTYSDTGVAL  95

Query  195  TSSGVKKGELLVADVNTQLKNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQ  374
            TS+ VKKG L   DV  Q K KN   D+KVDT S + TT+T+++ AP  KTI S   PD 
Sbjct  96   TSTAVKKGGLSTGDVGAQYKYKNTLIDVKVDTASNISTTLTLNDIAPSTKTIASLKFPDY  155

Query  375  KSGKVELQYLHEYAGISTSIGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
             SGK+E+QY H +A  ST++GL  +P+V  S   G  T A+G + S++TA GK 
Sbjct  156  SSGKLEVQYYHHHAAFSTAVGLKQNPIVDLSVTLGTPTFAIGAEASYETAEGKL  209



>ref|XP_006649583.1| PREDICTED: mitochondrial outer membrane protein porin 5-like 
[Oryza brachyantha]
Length=277

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 105/153 (69%), Gaps = 0/153 (0%)
 Frame = +3

Query  78   KGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKN  257
            KGPGL+SDIGK+AKDLL +DY  D K T++T S++GV +TS+ VKKG L   DVN+  K 
Sbjct  4    KGPGLFSDIGKRAKDLLTKDYTYDQKLTVSTVSSSGVGLTSTAVKKGGLYTLDVNSVYKY  63

Query  258  KNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTSIG  437
            KN   D+KVDT S + TT+TV +  P  K + S   PD  SGKVE+QY HE A  +T++G
Sbjct  64   KNTNVDIKVDTESNISTTLTVFDVLPSTKLVTSVKLPDYNSGKVEVQYFHENASFATAVG  123

Query  438  LTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            +  SP+V FSG AG   +A G +  FDTATGKF
Sbjct  124  MKPSPVVEFSGTAGAQGIAFGAEAGFDTATGKF  156



>ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane protein porin 2 [Vitis 
vinifera]
 emb|CAN75907.1| hypothetical protein VITISV_001975 [Vitis vinifera]
 emb|CBI33694.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKAKDLL RDY++D KFT++TYS TGVAITS+ VKKG L   DV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+K DT S + TT+T  E  P  KTI SF  PD  SGK+E+QY H++A ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L  SP V  S   G  ++A G +  +DT +G F
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCF  155



>ref|XP_010652706.1| PREDICTED: mitochondrial outer membrane protein porin 2-like 
[Vitis vinifera]
Length=276

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 105/155 (68%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL++DIGKKAKDLL RDY++D KFT++TYS TGVAITS+ VKKG L   DV  Q 
Sbjct  1    MSKGPGLFADIGKKAKDLLTRDYISDQKFTVSTYSDTGVAITSTAVKKGGLSTGDVAVQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+K DT S + TT+T  E  P  KTI SF  PD  SGK+E+QY H++A ++TS
Sbjct  61   KYKNSVIDVKADTGSNINTTLTFTEIIPSTKTIASFKFPDYNSGKLEVQYFHDHATLTTS  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            + L  SP V  S   G  ++A G +  +DT +G F
Sbjct  121  VALNQSPAVDLSVTIGTPSIAFGAEAGYDTTSGCF  155



>emb|CDY36497.1| BnaC03g48560D [Brassica napus]
Length=276

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 0/155 (0%)
 Frame = +3

Query  72   MVKGPGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQL  251
            M KGPGL+SDIGKKAKDLL RDY +DHKF+I+TYSA+GVA+TS+ +KKG +  ADV TQ 
Sbjct  1    MSKGPGLFSDIGKKAKDLLTRDYTSDHKFSISTYSASGVALTSTALKKGGVHAADVTTQY  60

Query  252  KNKNITTDLKVDTNSKLYTTITVDEPAPGLKTIISFVAPDQKSGKVELQYLHEYAGISTS  431
            K KN   D+K+ T+S + TT+T  E  P  K I+SF  PD  SGK+E+QY H++A ++ +
Sbjct  61   KYKNAVFDVKIHTDSTILTTVTFTEILPSTKAIVSFKVPDNSSGKLEVQYFHDHAAVTAT  120

Query  432  IGLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
              L  +PL+  +   G   ++ G +  +DT++  F
Sbjct  121  AALKQNPLIDITATLGTPVISFGAEAGYDTSSKTF  155



>emb|CAA57647.1| Voltage dependent anion channel (VDAC) [Triticum aestivum]
Length=273

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = +3

Query  84   PGLYSDIGKKAKDLLYRDYVADHKFTITTYSATGVAITSSGVKKGELLVADVNTQLKNKN  263
            P LY++IGKKA+DLL RDY    KFT TT +A G  ITSS  KK E ++AD+ TQ+K KN
Sbjct  1    PALYNNIGKKARDLLNRDYTTGQKFTFTTTAANGATITSSSTKKNEAILADLQTQVKIKN  60

Query  264  ITTDLKVDTNSKLYTTITVDEP-APGLKTIISFVAPDQKS--GKVELQYLHEYAGISTSI  434
             T D+K  ++S + TTITV E   PGLK ++S   P QKS  GK ELQYLH + GI+ S+
Sbjct  61   FTVDVKATSDSSVVTTITVPELYTPGLKGVLSLPFPYQKSTPGKAELQYLHPHLGINGSV  120

Query  435  GLTASPLVSFSGVAGNNTLALGTDVSFDTATGKF  536
            GL ++PLV+FSGV G    A G DV+FDTA+G F
Sbjct  121  GLNSNPLVNFSGVIGTKAFAFGVDVAFDTASGDF  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800