BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030P17

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           199   4e-58   Prunus mume [ume]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           197   2e-57   Solanum lycopersicum
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           197   2e-57   Malus domestica [apple tree]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           197   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             197   3e-57   Prunus persica
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      196   5e-57   Solanum tuberosum [potatoes]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           196   1e-56   Sesamum indicum [beniseed]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      194   3e-56   Nicotiana tomentosiformis
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      192   2e-55   Nicotiana sylvestris
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           190   1e-54   Fragaria vesca subsp. vesca
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      189   2e-54   Morus notabilis
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      189   2e-54   Cicer arietinum [garbanzo]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  186   3e-53   Medicago truncatula
gb|AFK49564.1|  unknown                                                 186   4e-53   Medicago truncatula
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      186   4e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      186   5e-53   Cucumis sativus [cucumbers]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           186   6e-53   Eucalyptus grandis [rose gum]
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           184   2e-52   Cucumis melo [Oriental melon]
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           184   3e-52   Vitis vinifera
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      183   5e-52   Populus euphratica
emb|CAN83418.1|  hypothetical protein VITISV_041351                     183   6e-52   Vitis vinifera
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     182   1e-51   Populus trichocarpa [western balsam poplar]
dbj|BAE71216.1|  putative NAD dependent epimerase                       180   6e-51   Trifolium pratense [peavine clover]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      180   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      177   1e-49   Solanum tuberosum [potatoes]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         176   4e-49   Jatropha curcas
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   4e-49   Nicotiana sylvestris
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             175   5e-49   Phaseolus vulgaris [French bean]
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   5e-49   Nicotiana tomentosiformis
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       174   6e-49   Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           174   8e-49   Phaseolus vulgaris [French bean]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             175   1e-48   Citrus clementina [clementine]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   174   1e-48   Citrus sinensis [apfelsine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   1e-48   Citrus sinensis [apfelsine]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             174   1e-48   
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      173   2e-48   Populus euphratica
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    172   5e-48   Theobroma cacao [chocolate]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    171   1e-47   Gossypium raimondii
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       170   4e-47   Gossypium hirsutum [American cotton]
emb|CDP21869.1|  unnamed protein product                                170   4e-47   Coffea canephora [robusta coffee]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      167   4e-46   Glycine max [soybeans]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    163   2e-44   Phoenix dactylifera
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      162   6e-44   Elaeis guineensis
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      161   8e-44   Elaeis guineensis
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       160   2e-43   Gossypium hirsutum [American cotton]
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      158   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    158   1e-42   Gossypium raimondii
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      157   2e-42   Phoenix dactylifera
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           147   9e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      146   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           144   3e-37   Tarenaya hassleriana [spider flower]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       144   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                                 144   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          142   5e-37   Amborella trichopoda
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             143   6e-37   Capsella rubella
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             142   7e-37   Arabidopsis lyrata subsp. lyrata
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    141   3e-36   Arabis alpina [alpine rockcress]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   4e-36   Brassica rapa
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      139   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   5e-36   Brassica rapa
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      140   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           140   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             140   7e-36   Eutrema salsugineum [saltwater cress]
emb|CDY18087.1|  BnaA01g23480D                                          139   8e-36   Brassica napus [oilseed rape]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    139   9e-36   Tarenaya hassleriana [spider flower]
emb|CDY64583.1|  BnaCnng44170D                                          139   1e-35   Brassica napus [oilseed rape]
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      134   9e-34   Solanum tuberosum [potatoes]
emb|CDX77481.1|  BnaA07g06190D                                          133   1e-33   
gb|EEC83914.1|  hypothetical protein OsI_29969                          130   2e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001062295.1|  Os08g0526100                                       130   2e-32   
emb|CDX85133.1|  BnaC07g07730D                                          130   3e-32   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           130   3e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDX92990.1|  BnaA03g37120D                                          128   1e-31   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      128   1e-31   Brassica rapa
ref|NP_001147328.1|  protein capI                                       127   2e-31   Zea mays [maize]
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          127   8e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      125   1e-30   Glycine max [soybeans]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      125   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY53207.1|  BnaC03g74010D                                          124   2e-30   Brassica napus [oilseed rape]
gb|EEC84839.1|  hypothetical protein OsI_31939                          123   7e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001063595.1|  Os09g0504000                                       123   7e-30   
dbj|BAJ86203.1|  predicted protein                                      123   8e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      120   9e-29   Setaria italica
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          119   1e-28   Sorghum bicolor [broomcorn]
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           120   4e-28   
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      117   5e-28   Solanum lycopersicum
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          116   2e-27   Sorghum bicolor [broomcorn]
dbj|BAJ99315.1|  predicted protein                                      115   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    114   8e-27   Glycine max [soybeans]
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    114   1e-26   
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             113   2e-26   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      113   3e-26   Brachypodium distachyon [annual false brome]
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              112   4e-26   Selaginella moellendorffii
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      112   7e-26   Setaria italica
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      111   1e-25   Oryza brachyantha
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              109   4e-25   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      108   9e-25   Zea mays [maize]
gb|ABK25339.1|  unknown                                                 106   7e-24   Picea sitchensis
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     105   1e-23   Populus trichocarpa [western balsam poplar]
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      103   9e-23   Brachypodium distachyon [annual false brome]
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      103   1e-22   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    103   1e-22   Zea mays [maize]
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             102   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    102   1e-22   
gb|KJB41101.1|  hypothetical protein B456_007G090500                    102   1e-22   Gossypium raimondii
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      102   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           102   2e-22   Nicotiana tomentosiformis
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           102   2e-22   Nicotiana tomentosiformis
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           102   2e-22   Nicotiana sylvestris
gb|EPS60141.1|  hypothetical protein M569_14661                         101   3e-22   Genlisea aurea
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       100   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           100   6e-22   Cucumis melo [Oriental melon]
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           100   7e-22   Nicotiana sylvestris
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           100   7e-22   
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      100   7e-22   
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                100   8e-22   Erythranthe guttata [common monkey flower]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      100   1e-21   Solanum tuberosum [potatoes]
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           100   1e-21   Sesamum indicum [beniseed]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    100   1e-21   Arabis alpina [alpine rockcress]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg           99.8    1e-21   Citrus clementina [clementine]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    99.4    2e-21   Cucumis sativus [cucumbers]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    99.4    2e-21   Cicer arietinum [garbanzo]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g           99.4    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         99.4    2e-21   Sesamum indicum [beniseed]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g           99.4    2e-21   Phaseolus vulgaris [French bean]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    99.4    2e-21   Solanum lycopersicum
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         99.4    2e-21   Nicotiana tomentosiformis
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         99.4    2e-21   Elaeis guineensis
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    99.0    2e-21   Glycine max [soybeans]
gb|ACN26174.1|  unknown                                               97.4    2e-21   Zea mays [maize]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         99.0    3e-21   Solanum lycopersicum
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    99.0    3e-21   Glycine max [soybeans]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    99.0    3e-21   Cicer arietinum [garbanzo]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         99.0    3e-21   Eucalyptus grandis [rose gum]
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g           99.0    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         99.0    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                         98.6    3e-21   Medicago truncatula
emb|CDX86716.1|  BnaA09g21060D                                        98.6    3e-21   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg           98.6    4e-21   Capsella rubella
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...  98.6    4e-21   Tarenaya hassleriana [spider flower]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                         98.2    5e-21   Medicago truncatula
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                  98.2    5e-21   Arabidopsis lyrata subsp. lyrata
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg              98.2    5e-21   Erythranthe guttata [common monkey flower]
emb|CDX94504.1|  BnaC09g23320D                                        98.2    5e-21   
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg           98.2    6e-21   Prunus persica
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    98.2    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                      98.2    6e-21   Medicago truncatula
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         97.8    7e-21   Nicotiana tomentosiformis
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg              97.8    8e-21   Erythranthe guttata [common monkey flower]
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         97.8    8e-21   Tarenaya hassleriana [spider flower]
ref|NP_001142515.1|  hypothetical protein                             97.8    9e-21   Zea mays [maize]
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    97.4    1e-20   Populus euphratica
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         97.4    1e-20   
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         97.4    1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         97.4    1e-20   Eucalyptus grandis [rose gum]
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         97.1    1e-20   Pyrus x bretschneideri [bai li]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                       97.1    2e-20   Jatropha curcas
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg           96.7    2e-20   Capsella rubella
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    96.7    2e-20   Solanum lycopersicum
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    96.7    2e-20   Nicotiana sylvestris
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g           96.7    2e-20   Phaseolus vulgaris [French bean]
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         96.7    2e-20   Malus domestica [apple tree]
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                  96.7    2e-20   
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    96.7    2e-20   Zea mays [maize]
emb|CDP21367.1|  unnamed protein product                              96.3    2e-20   Coffea canephora [robusta coffee]
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg           96.3    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    96.3    2e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         96.3    2e-20   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  96.7    2e-20   Elaeis guineensis
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    96.3    3e-20   
emb|CDO97699.1|  unnamed protein product                              96.3    3e-20   Coffea canephora [robusta coffee]
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    96.3    3e-20   Nicotiana sylvestris
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    96.3    3e-20   Setaria italica
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    96.3    3e-20   Nicotiana tomentosiformis
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    96.3    3e-20   
gb|ABR16292.1|  unknown                                               96.3    3e-20   Picea sitchensis
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         95.9    3e-20   Populus euphratica
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.9    3e-20   Phoenix dactylifera
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684           96.3    3e-20   
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630        95.9    3e-20   Sorghum bicolor [broomcorn]
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174            96.3    3e-20   
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein   95.9    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                    95.9    4e-20   Morus notabilis
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    95.9    4e-20   Populus euphratica
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         95.9    4e-20   Populus euphratica
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         95.9    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         95.9    4e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    95.9    4e-20   Glycine max [soybeans]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                       95.9    4e-20   Jatropha curcas
gb|KJB27036.1|  hypothetical protein B456_004G273500                  95.5    4e-20   Gossypium raimondii
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    95.9    4e-20   Solanum tuberosum [potatoes]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    95.9    4e-20   Solanum tuberosum [potatoes]
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         95.5    4e-20   Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg           95.5    5e-20   Prunus persica
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                     95.5    5e-20   Gossypium hirsutum [American cotton]
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  95.5    5e-20   
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    95.5    5e-20   Vitis vinifera
gb|KJB76605.1|  hypothetical protein B456_012G096800                  95.5    5e-20   Gossypium raimondii
gb|KJB27035.1|  hypothetical protein B456_004G273500                  95.5    6e-20   Gossypium raimondii
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.5    6e-20   Solanum tuberosum [potatoes]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.5    6e-20   Cicer arietinum [garbanzo]
gb|KJB24820.1|  hypothetical protein B456_004G162700                  95.5    6e-20   Gossypium raimondii
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                     95.5    6e-20   Gossypium hirsutum [American cotton]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                  95.5    6e-20   
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.5    6e-20   Solanum lycopersicum
ref|NP_001048359.1|  Os02g0791500                                     95.5    6e-20   
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.5    6e-20   Oryza brachyantha
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160        95.5    6e-20   Amborella trichopoda
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         95.5    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    95.1    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY04398.1|  BnaC02g28500D                                        95.1    6e-20   
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         95.1    6e-20   Cucumis melo [Oriental melon]
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  95.1    6e-20   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                     95.1    7e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    95.1    7e-20   Brassica rapa
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                 95.1    7e-20   Citrus sinensis [apfelsine]
ref|NP_001105911.1|  LOC732831                                        95.1    7e-20   Zea mays [maize]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                  94.7    7e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97356.1|  BnaA02g21470D                                        95.1    7e-20   
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                  95.1    8e-20   Zea mays [maize]
gb|AAK93670.1|  putative nucleotide sugar epimerase                   95.1    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         95.1    8e-20   Elaeis guineensis
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         94.7    9e-20   Tarenaya hassleriana [spider flower]
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                     94.7    9e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85817.1|  predicted protein                                    94.7    9e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg           94.7    9e-20   Citrus clementina [clementine]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                    94.7    9e-20   Morus notabilis
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         94.7    1e-19   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         94.7    1e-19   Phoenix dactylifera
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    94.4    1e-19   Vitis vinifera
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         94.4    1e-19   
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    94.4    1e-19   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                  94.0    1e-19   
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    94.4    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...  94.4    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         94.0    2e-19   Malus domestica [apple tree]
ref|XP_001769370.1|  predicted protein                                94.4    2e-19   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                     94.0    2e-19   Cucumis sativus [cucumbers]
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    94.0    2e-19   Glycine max [soybeans]
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    94.0    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    94.0    2e-19   Cucumis melo [Oriental melon]
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         94.0    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    94.0    2e-19   Brachypodium distachyon [annual false brome]
dbj|BAK06545.1|  predicted protein                                    94.0    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         94.0    2e-19   Fragaria vesca subsp. vesca
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         93.6    3e-19   Eucalyptus grandis [rose gum]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    93.6    3e-19   Nicotiana sylvestris
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         93.6    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920        93.6    3e-19   Sorghum bicolor [broomcorn]
emb|CDX72242.1|  BnaC07g42640D                                        93.2    3e-19   
emb|CDY70926.1|  BnaCnng70410D                                        93.2    3e-19   Brassica napus [oilseed rape]
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg           93.2    3e-19   Capsella rubella
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110        93.2    3e-19   Amborella trichopoda
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         93.2    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    93.2    3e-19   Camelina sativa [gold-of-pleasure]
emb|CDY39205.1|  BnaA03g50170D                                        93.2    3e-19   Brassica napus [oilseed rape]
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    93.2    3e-19   Brassica rapa
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                  93.2    3e-19   Arabis alpina [alpine rockcress]
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    93.2    3e-19   Nicotiana tomentosiformis
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    93.6    3e-19   Setaria italica
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                     93.2    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         93.2    3e-19   Brassica rapa
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    94.0    3e-19   Brachypodium distachyon [annual false brome]
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg           93.6    3e-19   
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                  93.2    4e-19   Arabidopsis lyrata subsp. lyrata
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...  93.2    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99954.1|  hypothetical protein OsI_21957                        93.2    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    92.4    6e-19   Citrus sinensis [apfelsine]
emb|CDY63064.1|  BnaAnng18570D                                        92.4    7e-19   Brassica napus [oilseed rape]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         92.4    8e-19   Brassica rapa
ref|XP_001767292.1|  predicted protein                                92.4    8e-19   
ref|XP_001761984.1|  predicted protein                                92.4    9e-19   
emb|CAN73016.1|  hypothetical protein VITISV_004388                   92.0    1e-18   Vitis vinifera
gb|KJB09908.1|  hypothetical protein B456_001G174300                  92.0    1e-18   Gossypium raimondii
gb|EPS72617.1|  hypothetical protein M569_02133                       92.0    1e-18   Genlisea aurea
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    90.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    92.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    91.7    1e-18   Sesamum indicum [beniseed]
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    92.0    1e-18   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg           91.3    2e-18   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    91.3    2e-18   
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like    91.3    2e-18   
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         91.3    2e-18   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                  91.3    2e-18   
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg           90.9    2e-18   
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    88.6    4e-18   
emb|CDX95646.1|  BnaC03g25270D                                        90.1    4e-18   
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    89.0    4e-18   
emb|CDY67756.1|  BnaA03g56770D                                        90.1    5e-18   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         90.1    5e-18   
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                  90.1    5e-18   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    90.1    5e-18   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030        90.5    6e-18   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    90.1    6e-18   
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         89.7    7e-18   
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    89.4    7e-18   
emb|CDP09891.1|  unnamed protein product                              89.4    9e-18   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1         89.0    1e-17   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative            89.0    1e-17   
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative            89.0    1e-17   
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg           89.0    1e-17   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         89.0    1e-17   
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         88.6    2e-17   
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    88.6    2e-17   
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    88.2    3e-17   
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    88.2    3e-17   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    88.2    3e-17   
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         88.2    3e-17   
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    88.2    3e-17   
ref|XP_001781238.1|  predicted protein                                87.4    3e-17   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    87.0    4e-17   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         87.4    4e-17   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                       87.4    4e-17   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    87.4    5e-17   
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         87.4    5e-17   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                     87.4    5e-17   
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg           87.4    5e-17   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                  87.0    6e-17   
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    87.0    6e-17   
emb|CAN60968.1|  hypothetical protein VITISV_008097                   87.0    6e-17   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g           87.0    6e-17   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630        87.0    6e-17   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                  86.3    1e-16   
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5         85.9    2e-16   
ref|XP_001754001.1|  predicted protein                                85.5    2e-16   
ref|XP_001759693.1|  predicted protein                                85.5    2e-16   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    85.5    3e-16   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         85.5    3e-16   
ref|XP_001751991.1|  predicted protein                                85.1    3e-16   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg              84.7    4e-16   
emb|CBI24539.3|  unnamed protein product                              83.2    4e-16   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    84.3    4e-16   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         84.0    9e-16   
ref|XP_001761086.1|  predicted protein                                84.0    1e-15   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    83.2    1e-15   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4         82.4    3e-15   
gb|KJB43946.1|  hypothetical protein B456_007G225300                  81.6    5e-15   
gb|KJB25649.1|  hypothetical protein B456_004G202200                  81.6    5e-15   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g           81.3    5e-15   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    81.3    5e-15   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    81.3    6e-15   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg           80.9    7e-15   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    80.9    8e-15   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    80.9    9e-15   
ref|NP_001049561.1|  Os03g0249500                                     80.5    2e-14   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                  80.1    2e-14   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...  79.7    2e-14   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                    79.7    3e-14   
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    3e-14   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.0    3e-14   
gb|EPS64795.1|  hypothetical protein M569_09984                       78.6    3e-14   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.0    4e-14   
ref|XP_001777338.1|  predicted protein                                79.3    4e-14   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    79.3    4e-14   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    79.3    4e-14   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    78.2    5e-14   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    78.6    6e-14   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                 78.6    6e-14   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg           78.6    6e-14   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like    77.8    7e-14   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                         78.2    8e-14   
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699            73.2    1e-13   
dbj|BAJ88176.1|  predicted protein                                    77.4    2e-13   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                       75.9    4e-13   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                      75.5    8e-13   
emb|CBI18845.3|  unnamed protein product                              73.2    9e-13   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like    74.3    2e-12   
gb|EPS73152.1|  hypothetical protein M569_01604                       73.6    2e-12   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    72.4    8e-12   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g           72.0    1e-11   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like    72.0    1e-11   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.6    2e-11   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.2    2e-11   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.2    2e-11   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.2    2e-11   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.2    2e-11   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...  71.2    2e-11   
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                  70.1    3e-11   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3         69.3    9e-11   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    69.3    9e-11   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    68.9    1e-10   
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    68.6    2e-10   
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                         67.8    2e-10   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938            67.8    3e-10   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                       68.2    3e-10   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183            67.4    3e-10   
ref|WP_038095738.1|  capsular biosynthesis protein CpsI               59.7    1e-08   
gb|AFW73830.1|  hypothetical protein ZEAMMB73_770166                  59.7    2e-08   
ref|WP_020559072.1|  NAD dependent epimerase/dehydratase              62.0    2e-08   
ref|WP_034152563.1|  UDP-glucuronate 5-epimerase                      62.0    2e-08   
ref|WP_007919479.1|  MULTISPECIES: nucleoside-diphosphate-sugar e...  62.0    2e-08   
ref|WP_038084328.1|  capsular biosynthesis protein CpsI               59.3    2e-08   
ref|WP_036997098.1|  UDP-glucuronate 5-epimerase                      61.2    3e-08   
ref|WP_010226857.1|  UDP-glucuronate 5'-epimerase                     61.2    3e-08   
ref|WP_042239280.1|  hypothetical protein                             61.2    4e-08   
ref|WP_042559766.1|  UDP-glucuronate 5-epimerase                      61.2    4e-08   
ref|WP_038369591.1|  UDP-glucuronate 5-epimerase                      61.2    4e-08   
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                         61.2    4e-08   
ref|WP_039386438.1|  hypothetical protein                             60.8    4e-08   
ref|WP_018983082.1|  NAD dependent epimerase/dehydratase              61.2    4e-08   
ref|WP_013179120.1|  epimerase                                        60.8    4e-08   
ref|WP_008084481.1|  nucleoside-diphosphate-sugar epimerase           60.8    5e-08   
ref|WP_018878551.1|  hypothetical protein                             58.9    5e-08   
ref|WP_018881841.1|  hypothetical protein                             58.9    6e-08   
ref|WP_034222141.1|  capsular biosynthesis protein CpsI               60.5    6e-08   
ref|WP_019645719.1|  hypothetical protein                             60.5    7e-08   
ref|WP_040972134.1|  protein CapI                                     60.5    7e-08   
ref|WP_026000466.1|  UDP-glucuronate 5-epimerase                      60.5    7e-08   
ref|WP_019592786.1|  hypothetical protein                             58.5    8e-08   
ref|WP_028097751.1|  hypothetical protein                             59.7    1e-07   
ref|WP_025109888.1|  UDP-glucuronate 5-epimerase                      59.7    1e-07   
ref|WP_003226284.1|  Nucleoside-diphosphate-sugar epimerase           59.7    1e-07   
ref|WP_043860609.1|  UDP-glucuronate 5-epimerase                      59.7    1e-07   
ref|WP_041066280.1|  UDP-glucuronate 5-epimerase                      59.7    1e-07   
gb|EZP26540.1|  UDP-glucuronate 5 -epimerase                          59.7    1e-07   
ref|WP_007961340.1|  nucleoside-diphosphate-sugar epimerase           59.7    1e-07   
ref|WP_038995062.1|  UDP-glucuronate 5-epimerase                      59.7    1e-07   
ref|WP_015094545.1|  UDP-glucuronate 5 -epimerase                     59.7    1e-07   
ref|WP_027611609.1|  UDP-glucuronate 5-epimerase                      59.7    1e-07   
ref|WP_039767768.1|  UDP-glucuronate 5-epimerase                      59.3    1e-07   
ref|WP_007973829.1|  nucleoside-diphosphate-sugar epimerase           59.3    1e-07   
ref|WP_042609498.1|  UDP-glucuronate 5-epimerase                      59.3    2e-07   
ref|WP_004088268.1|  Nucleoside-diphosphate-sugar epimerase           59.3    2e-07   
ref|WP_020852009.1|  NAD-dependent epimerase/dehydratase              58.9    2e-07   
ref|WP_039762794.1|  UDP-glucuronate 5-epimerase                      59.3    2e-07   
ref|WP_028622110.1|  UDP-glucuronate 5-epimerase                      59.3    2e-07   
ref|WP_031336424.1|  hypothetical protein                             58.9    2e-07   
ref|WP_038228294.1|  protein CapI                                     58.9    2e-07   
ref|WP_041478601.1|  UDP-glucuronate 5-epimerase                      59.3    2e-07   
ref|WP_008842667.1|  UDP-glucuronate 5'-epimerase                     59.3    2e-07   
ref|WP_009552387.1|  nucleoside-diphosphate-sugar epimerase           58.9    2e-07   
gb|KIA57531.1|  protein CapI                                          58.9    2e-07   
ref|WP_016774102.1|  NAD dependent epimerase/dehydratase              58.9    2e-07   
ref|WP_035038771.1|  protein CapI                                     58.9    2e-07   
ref|WP_024012453.1|  NAD dependent epimerase/dehydratase              58.9    2e-07   
ref|WP_039592788.1|  UDP-glucuronate 5-epimerase                      58.9    2e-07   
gb|AAF85078.1|AE004040_3  nucleotide sugar epimerase                  58.9    2e-07   
ref|WP_042129435.1|  UDP-glucuronate 5-epimerase                      58.9    2e-07   
ref|WP_018867566.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  58.5    2e-07   
ref|WP_007625500.1|  UDP-glucuronate 5'-epimerase                     58.9    2e-07   
ref|WP_018864896.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  58.5    3e-07   
ref|WP_042087871.1|  capsular biosynthesis protein CpsI               58.9    3e-07   
ref|WP_018881379.1|  NAD dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_019612082.1|  NAD dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_018176093.1|  NAD dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_019584594.1|  hypothetical protein                             57.0    3e-07   
ref|WP_018941321.1|  NAD dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_018144022.1|  NAD dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_027921354.1|  UDP-glucuronate 5-epimerase                      58.5    3e-07   
ref|WP_030142090.1|  UDP-glucuronate 5-epimerase                      58.5    3e-07   
ref|WP_010455617.1|  NAD-dependent epimerase/dehydratase              58.5    3e-07   
ref|WP_027289889.1|  hypothetical protein                             58.2    3e-07   
ref|WP_042729731.1|  UDP-glucuronate 5-epimerase                      58.5    4e-07   
ref|WP_019025549.1|  hypothetical protein                             57.0    4e-07   
ref|WP_013259566.1|  epimerase                                        58.2    4e-07   
ref|WP_008013136.1|  nucleoside-diphosphate-sugar epimerase           58.2    4e-07   
gb|KFA31426.1|  hypothetical protein KWS_0114945                      55.1    4e-07   
ref|XP_004345510.1|  UDP-glucuronat epimerase                         58.5    5e-07   
ref|WP_027312633.1|  capsular biosynthesis protein CpsI               57.8    5e-07   
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase              57.8    5e-07   
ref|WP_025212876.1|  UDP-glucuronate 5-epimerase                      57.8    5e-07   
ref|WP_018138355.1|  hypothetical protein                             57.0    5e-07   
ref|XP_002504144.1|  predicted protein                                58.2    5e-07   
ref|WP_007668664.1|  nucleotide sugar epimerase                       57.8    5e-07   
ref|WP_007948624.1|  nucleoside-diphosphate-sugar epimerase           57.8    5e-07   
ref|WP_018862514.1|  hypothetical protein                             57.0    5e-07   
gb|KJE95471.1|  UDP-glucuronat epimerase                              58.2    5e-07   
ref|WP_007900703.1|  nucleoside-diphosphate-sugar epimerase           57.8    5e-07   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI               57.8    5e-07   
ref|WP_004083453.1|  NAD-dependent epimerase/dehydratase              57.8    5e-07   
ref|WP_030132110.1|  UDP-glucuronate 5-epimerase                      57.8    6e-07   
ref|WP_004368982.1|  NAD-dependent epimerase/dehydratase              57.8    6e-07   
ref|WP_019024820.1|  hypothetical protein                             57.0    6e-07   
ref|WP_017165470.1|  NAD dependent epimerase/dehydratase              55.1    7e-07   
ref|WP_018868571.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  57.0    7e-07   
ref|WP_007292193.1|  capsular polysaccharide biosynthesis protein I   54.3    7e-07   
ref|WP_017938492.1|  NAD dependent epimerase/dehydratase              57.4    7e-07   
ref|WP_008073317.1|  nucleoside-diphosphate-sugar epimerase           57.4    7e-07   
ref|WP_027709070.1|  capsular biosynthesis protein CpsI               57.4    7e-07   
ref|WP_039446968.1|  protein CapI                                     55.1    8e-07   
ref|WP_019592126.1|  NAD dependent epimerase/dehydratase              57.0    8e-07   
ref|WP_026377125.1|  capsular biosynthesis protein CpsI               57.0    9e-07   
ref|WP_006202612.1|  NAD-dependent epimerase/dehydratase              57.0    9e-07   
ref|WP_017925880.1|  NAD dependent epimerase/dehydratase              57.0    9e-07   
ref|WP_020146287.1|  NAD dependent epimerase/dehydratase              57.0    9e-07   
ref|WP_019648522.1|  NAD dependent epimerase/dehydratase              57.0    9e-07   
gb|EPL07171.1|  NAD dependent epimerase/dehydratase family protein    57.0    9e-07   
ref|WP_020083694.1|  hypothetical protein                             57.0    9e-07   
ref|WP_013182875.1|  NAD-dependent epimerase                          57.0    1e-06   
ref|WP_018875225.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  57.0    1e-06   
ref|WP_018174687.1|  NAD dependent epimerase/dehydratase              57.0    1e-06   
ref|WP_044840054.1|  capsular biosynthesis protein CpsI               57.0    1e-06   
ref|WP_028941308.1|  UDP-glucuronate 5-epimerase                      57.0    1e-06   
ref|WP_018925579.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  57.0    1e-06   
ref|WP_012982031.1|  NAD-dependent epimerase/dehydratase              57.0    1e-06   
ref|WP_018994655.1|  NAD dependent epimerase/dehydratase              57.0    1e-06   
gb|KGK59727.1|  protein CapI                                          57.0    1e-06   
ref|WP_021132243.1|  nucleoside-diphosphate-sugar epimerase           57.0    1e-06   
ref|WP_044833801.1|  capsular biosynthesis protein CpsI               57.0    1e-06   



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSE  60

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            +HCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDP  144



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  5    MASPPDTSKTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  62

Query  261  SSGGGRRRALHTTGHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT H+LL+ A + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  63   TSEKSFNNNIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  122

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN+ YDP
Sbjct  123  SLALKKRGDGVLGLDNFNSYYDP  145



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 6/146 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            SHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDP  148



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 6/146 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            SHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDP  148



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 124/146 (85%), Gaps = 6/146 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            +HCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDP  144



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAAT-FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT H+LL++T + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  59   TSEKTFNNNIHTTTHNLLSSTIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN+ YDP
Sbjct  119  SLALKKRGDGVLGLDNFNSYYDP  141



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 118/141 (84%), Gaps = 4/141 (3%)
 Frame = +3

Query  84   AFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  263
            A PPDTSK +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +
Sbjct  10   ASPPDTSKTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSA  69

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                    +H+T H L +A +  GAAWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSL
Sbjct  70   DN----HHIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSL  125

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            ALKKRGDGVLGLDNFN+ YDP
Sbjct  126  ALKKRGDGVLGLDNFNSYYDP  146



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLA-  59

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            S        +HTT H+LL++ F  GGA+WEKQV+ SATP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVGSHS  119

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN+ YDP
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDP  142



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLA-  59

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            S        +HTT H+L+++ F  GGA+WEKQV+ S+TP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHS  119

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN+ YDP
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDP  142



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 6/146 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ 
Sbjct  3    MASPPDTSKTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSS  62

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            SS       LH T  + L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGF+G
Sbjct  63   SSDQNGSHRLHNT--NFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIG  120

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            SHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  121  SHCSLALKKRGDGVLGLDNFNSYYDP  146



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 118/145 (81%), Gaps = 5/145 (3%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ 
Sbjct  1    MASPPDTSKTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSS  60

Query  261  SSGG-GRRRALHTTGHSLLAATF--SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
            SS       + H   H+ L++ F   GGA WEKQV+ SATPRRQNG SVLVTGAAGFVGS
Sbjct  61   SSDTPNTHHSFH--HHNFLSSAFYGGGGATWEKQVRHSATPRRQNGFSVLVTGAAGFVGS  118

Query  432  HCSLALKKRGDGVLGLDNFNAXYDP  506
            HCSLALKKRGDGVLGLDNFN  YDP
Sbjct  119  HCSLALKKRGDGVLGLDNFNNYYDP  143



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 7/143 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSE  60

Query  261  SSGGGRRRALHTTGHS-LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            ++       LHT  HS  LA+ F GG AWE+QV+ SATPRR NG SVLVTGAAGFVGSHC
Sbjct  61   TAN----HHLHT--HSNFLASAFGGGGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHC  114

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGV+GLDNFN  YDP
Sbjct  115  SLALKKRGDGVVGLDNFNTYYDP  137



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 5/142 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGV+GLDNFN+ YDP
Sbjct  116  LALKKRGDGVIGLDNFNSYYDP  137



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 5/142 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   STN----HHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGV+GLDNFN+ YDP
Sbjct  116  LALKKRGDGVIGLDNFNSYYDP  137



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL  
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            SS       LH   + L +A +  GA WEKQV+ S+TPRR NG SVLVTGAAGFVG+HCS
Sbjct  59   SSDSPNHVPLHHHQNFLASAFYGNGATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCS  118

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLGLDNFN+ YDP
Sbjct  119  LALKKRGDGVLGLDNFNSYYDP  140



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ 
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLS-  62

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            S  G     LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFVG
Sbjct  63   SENGSSGNHLHTHRNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVG  122

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            SHCS+ALKKRGDGVLGLDNFN  YDP
Sbjct  123  SHCSMALKKRGDGVLGLDNFNNYYDP  148



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 119/144 (83%), Gaps = 6/144 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPD+SK +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ 
Sbjct  1    MAPPPDSSKTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSS  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            SS      A H    S L++TFS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   SSTSDH--APHR--RSFLSSTFSSAGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSH  116

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLALKKRGDGVLGLDNFN  YDP
Sbjct  117  CSLALKKRGDGVLGLDNFNDYYDP  140



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL-A  257
            MA PPDTSK  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL A
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLSA  63

Query  258  ESSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            E++  G    LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFV
Sbjct  64   ENASPGNH--LHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFV  121

Query  426  GSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GSHCS+ALKKRGDGVLGLDNFN  YDP
Sbjct  122  GSHCSMALKKRGDGVLGLDNFNNYYDP  148



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 9/144 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHS--LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +         H   H   L +A +  GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLALKKRGDGVLGLDNFN  YDP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDP  137



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 8/146 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  428
            +         H   H+ L+  F    +GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVG
Sbjct  61   NIPNHA----HPPHHNFLSTAFFTSSAGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVG  116

Query  429  SHCSLALKKRGDGVLGLDNFNAXYDP  506
            SHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  117  SHCSLALKKRGDGVLGLDNFNSYYDP  142



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 9/144 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHS--LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +         H   H   L +A +  GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLALKKRGDGVLGLDNFN  YDP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDP  137



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 9/147 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF-----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
            +         H   H+ L+  F      GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFV
Sbjct  61   NIPNHA----HLHHHNFLSTAFFTSSAGGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFV  116

Query  426  GSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GSHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  117  GSHCSLALKKRGDGVLGLDNFNSYYDP  143



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 5/142 (4%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
            ++          T    L + F GG AWE+QV+ SATPRR NG +VLVTGAAGFVGSHCS
Sbjct  61   TT-----SHHFHTHSHFLTSAFGGGGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCS  115

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGV+GLDNFN  YDP
Sbjct  116  LALKKRGDGVIGLDNFNNYYDP  137



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 5/143 (3%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +              + +A+ F G GA WEK+V+ S+TPRR NG SVLVTGAAGFVG+HC
Sbjct  61   NP----HHVHLHHHQNFIASAFYGNGATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHC  116

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            +LALKKRGDGVLGLDNFN+ YDP
Sbjct  117  ALALKKRGDGVLGLDNFNSYYDP  139



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            P DTSK  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   S  
Sbjct  5    PIDTSKEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSSEN  64

Query  270  GG-RRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                   +HTT H+LL+++F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+
Sbjct  65   SNPHHHNIHTTTHNLLSSSFYGGGAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSM  124

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            ALKKRGDGVLG+DNFN+ YDP
Sbjct  125  ALKKRGDGVLGIDNFNSYYDP  145



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 117/148 (79%), Gaps = 9/148 (6%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
            +      +  H   H+ L+  F       GG+AWEKQV+ SATPRR NG SVLVTGAAGF
Sbjct  61   NP---HHQNHHIHHHNFLSTAFFARSSSVGGSAWEKQVRHSATPRRPNGFSVLVTGAAGF  117

Query  423  VGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            VGSHCSLALKKRGDGVLG+DNFN  YDP
Sbjct  118  VGSHCSLALKKRGDGVLGIDNFNDYYDP  145



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            SS       +HTT H+LL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   SSENTSHHHIHTTTHNLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            S+ALKKRGDGVLG+DNFN+ YDP
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDP  141



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 8/137 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGVLGLDNFNA YDP
Sbjct  114  RGDGVLGLDNFNAYYDP  130



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  261  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +S       +HTT HSLL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   NSENTPHHHIHTTTHSLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            S+ALKKRGDGVLG+DNFN+ YDP
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDP  141



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   174 bits (442),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 8/137 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGVLGLDNFNA YDP
Sbjct  114  RGDGVLGLDNFNAYYDP  130



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 8/137 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGVLGLDNFNA YDP
Sbjct  114  RGDGVLGLDNFNAYYDP  130



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 15/157 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDP  157



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 15/157 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDP  157



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 15/157 (10%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  261  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  395
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  396  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDP  157



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PP TSK  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +ALKKRGDGVLGLDNFN+ YDP
Sbjct  121  IALKKRGDGVLGLDNFNSYYDP  142



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PP TSK  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +ALKKRGDGVLGLDNFN+ YDP
Sbjct  121  IALKKRGDGVLGLDNFNSYYDP  142



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 113/143 (79%), Gaps = 1/143 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL++
Sbjct  1    MPTPPDTSKTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSL-LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
            +         H +  S  L +   GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   NPHHVPPHQHHHSFLSTSLFSISPGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHC  120

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN  YDP
Sbjct  121  SLALKKRGDGVLGLDNFNNYYDP  143



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  266
             P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  1    MPTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60

Query  267  GGGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                      +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   HSAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHC  120

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGVLGLDNFN  YDP
Sbjct  121  SLALKKRGDGVLGLDNFNDYYDP  143



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 112/142 (79%), Gaps = 3/142 (2%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++ 
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTH  61

Query  270  GGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCS
Sbjct  62   SAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCS  121

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLGLDNFN  YDP
Sbjct  122  LALKKRGDGVLGLDNFNDYYDP  143



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            PPD SK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+  
Sbjct  6    PPDFSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSENP-  64

Query  270  GGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  446
                  +H T H+L ++ F G GA WEK+V+ SATPRR NG+SVLVTGAAGFVGSHCSLA
Sbjct  65   ----HHIHHTTHNLFSSAFYGSGAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLA  120

Query  447  LKKRGDGVLGLDNFNAXYDP  506
            LKKRGDGVLGLDNFN+ YDP
Sbjct  121  LKKRGDGVLGLDNFNSYYDP  140



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 112/139 (81%), Gaps = 4/139 (3%)
 Frame = +3

Query  90   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  269
            PPDTSK+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA    
Sbjct  20   PPDTSKSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLAPDF-  78

Query  270  GGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  449
                   H   HS   ++ S  A+WEKQV+ S+TPRR NG++VLVTGAAGFVGSHCSLAL
Sbjct  79   ---TSHRHLHSHSHFLSSSSSFASWEKQVRHSSTPRRPNGLTVLVTGAAGFVGSHCSLAL  135

Query  450  KKRGDGVLGLDNFNAXYDP  506
            KKRGDGVLGLDNFN+ YDP
Sbjct  136  KKRGDGVLGLDNFNSYYDP  154



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDTSKTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                    A H+    L + +  GGA WE++V+ SATPRR+ G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHPSAASA-HSHRSLLSSYSSYGGATWEREVRRSATPRRRGGLSVLVTGAAGFVGTHCS  119

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALK RGDGVLGLDNFN+ YDP
Sbjct  120  LALKXRGDGVLGLDNFNSYYDP  141



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 110/147 (75%), Gaps = 13/147 (9%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPD SK +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDNSKTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHS-----LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  425
                      H   HS       +++  GGAAWE++V+ SATP R  G+ VLVTGAAGFV
Sbjct  61   GH--------HPPAHSHRSLLSPSSSSYGGAAWEREVRRSATPHRPGGLFVLVTGAAGFV  112

Query  426  GSHCSLALKKRGDGVLGLDNFNAXYDP  506
            G+HCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  113  GTHCSLALKKRGDGVLGLDNFNSYYDP  139



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPLPDTSKTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                    A          ++  GGAAWE+ V+ SATPR   G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHLSPTSAHSHRSLLSSPSSSYGGAAWERNVRRSATPRHPGGLSVLVTGAAGFVGTHCS  120

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLGLDNFN+ YDP
Sbjct  121  LALKKRGDGVLGLDNFNSYYDP  142



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSH  120

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLALKKRGDGVLGLDNFN  YDP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDP  144



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA PPDTSK +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL  
Sbjct  1    MASPPDTSKTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPLLL  60

Query  261  SSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
             S      A  ++  SLL++  + GGAAWE++V+SSATPRR +G++VLVTGAAGFVG+HC
Sbjct  61   LSHYSANAAARSSHRSLLSSDVTYGGAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHC  120

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALKKRGDGV+GLDNFN+ YDP
Sbjct  121  SLALKKRGDGVVGLDNFNSYYDP  143



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  261  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGA GFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSH  120

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLALKKRGDGVLGLDNFN  YDP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDP  144



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 108/152 (71%), Gaps = 23/152 (15%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   DTSK +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MALLTDTSKTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL--  58

Query  261  SSGGGRRRALHTTGHSLLAAT----------FSGGAAWEKQVQSSATPRRQNGMSVLVTG  410
                         GH L AA+            GG+AWE+ V+ SATPRR  GM+VLVTG
Sbjct  59   -----------LAGHHLSAASAHSHRSLLSSSYGGSAWERDVRRSATPRRHGGMTVLVTG  107

Query  411  AAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            AAGFVG+HCSLALKKRGDGVLGLDNFN+ YDP
Sbjct  108  AAGFVGTHCSLALKKRGDGVLGLDNFNSYYDP  139



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 112/142 (79%), Gaps = 2/142 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA   D SK++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP    
Sbjct  1    MALSSDLSKSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYP--IT  58

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
             +      ++HTT     +  +  GA WEKQV+ S+TPRR NG S+LVTGAAGFVG+HCS
Sbjct  59   GNDAQNNASIHTTSRFFSSGFYGSGATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCS  118

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +ALKKRGDGVLGLDNFN  YDP
Sbjct  119  IALKKRGDGVLGLDNFNRYYDP  140



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 113/145 (78%), Gaps = 3/145 (2%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  257
            MA  PDTSK+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL 
Sbjct  1    MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPLL  60

Query  258  ESSGGGRRRALHTTGH-SLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                G    +   + H SLL++  + GGAAWE++V+ SATPR  +G++VLVTGAAGFVG+
Sbjct  61   LYHSGAAASSAAHSNHRSLLSSAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGT  120

Query  432  HCSLALKKRGDGVLGLDNFNAXYDP  506
            HCSLALKKRGDGV+GLDNFN+ Y+P
Sbjct  121  HCSLALKKRGDGVVGLDNFNSYYNP  145



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++SSK+I ASSKLLFRATL+VAL+L+  F +NYPPL+ SS   
Sbjct  8    DTSKTVKLERYNSYLRKIHSSKIINASSKLLFRATLLVALLLVLVFAVNYPPLSFSSSSD  67

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG    +++  GGAAWEK+V+ S+ PRR NG SVLVTGAAGFVGSHCS+
Sbjct  68   NHRLHRRSFLSTG-IFSSSSLGGGAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSI  126

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            ALKKRGDGVLGLDNFN  YDP
Sbjct  127  ALKKRGDGVLGLDNFNDYYDP  147



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLAL+KRGDGVLG DNFN  YDP
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDP  150



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLAL+KRGDGVLG DNFN  YDP
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDP  150



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +3

Query  114  KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  293
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+   P         RR L 
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYPTEV------RRRLS  62

Query  294  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            +T     A+   GG  WEKQV+ S+TPRR NG SVLVTGAAGFVGSH SLALKKRGDGVL
Sbjct  63   STSSFGAASARWGGPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVL  122

Query  474  GLDNFNAXYDP  506
            GLDNFN  YDP
Sbjct  123  GLDNFNDYYDP  133



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 8/145 (6%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                 RR+  +TG     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGS
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGS  127

Query  432  HCSLALKKRGDGVLGLDNFNAXYDP  506
            HCSL L+KRGDGVLG DNFN  YDP
Sbjct  128  HCSLYLRKRGDGVLGFDNFNDYYDP  152



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 113/144 (78%), Gaps = 7/144 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
                 RR+  +TG    S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CSLAL+KRGDGVLG DNFN  YDP
Sbjct  128  CSLALRKRGDGVLGFDNFNDYYDP  151



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 110/141 (78%), Gaps = 4/141 (3%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG    +++   GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH SL
Sbjct  68   AHHLHRRSFLSTGIFSSSSSLGEGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHASL  127

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            AL+KRGDGVLG DNFN  YDP
Sbjct  128  ALRKRGDGVLGFDNFNDYYDP  148



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 112/142 (79%), Gaps = 5/142 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +AL+KRGDGVLG DNFN  YDP
Sbjct  129  IALRKRGDGVLGFDNFNDYYDP  150



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 113/152 (74%), Gaps = 10/152 (7%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG------HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTG  410
            S         RR+  +TG       S  +++  GGAAWEK+V+ S+T +R  G+SVLVTG
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTG  122

Query  411  AAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            AAGFVGSHCSL L+KRGDGVLG DNFN  YDP
Sbjct  123  AAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDP  154



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
            RR  L T   S  +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  68   RRSFLSTGLFSSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  127

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGVLG DNFN  YDP
Sbjct  128  RGDGVLGFDNFNDYYDP  144



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  257
            MA PPDTSK+SKLERYNSY+ RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPPL 
Sbjct  2    MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPPLL  61

Query  258  ESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
             SS      + H+   SLL++   GG  WE+ V+ SA PRR +G+SVLVTGAAGFVG+HC
Sbjct  62   LSSSHYSSSSPHSNHRSLLSSGSYGGGYWERDVRRSAAPRRPDGLSVLVTGAAGFVGTHC  121

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            SLALK+RGDGV+GLDNFNA YDP
Sbjct  122  SLALKRRGDGVVGLDNFNAYYDP  144



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  417  GFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GFVGSHCSL L+KRGDGVLG DNFN  YDP
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDP  152



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 113/150 (75%), Gaps = 8/150 (5%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  261  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  417  GFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GFVGSHCSL L+KRGDGVLG DNFN  YDP
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDP  152



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 113/144 (78%), Gaps = 7/144 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDSRAAA  67

Query  276  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  434
                 RR+  +TG    S  +++ S GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSASLGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  435  CSLALKKRGDGVLGLDNFNAXYDP  506
            CS+ALKKRGDGVLG DNFN  YDP
Sbjct  128  CSIALKKRGDGVLGFDNFNDYYDP  151



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 112/142 (79%), Gaps = 5/142 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSPA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +AL+KRGDGVLG DNFN  YDP
Sbjct  129  IALRKRGDGVLGFDNFNDYYDP  150



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   139 bits (351),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+  G
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSSTDAG  67

Query  276  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  437
                 RR+  +TG   S  AA+  GG AWEK+       +  NG SVLVTGAAGFVGSHC
Sbjct  68   GHRVHRRSFLSTGIFSSSDAASLGGGPAWEKRXXXXXNXQYPNGFSVLVTGAAGFVGSHC  127

Query  438  SLALKKRGDGVLGLDNFNAXYDP  506
            S+ALKKRGDGVLG DNFN  YDP
Sbjct  128  SIALKKRGDGVLGFDNFNDYYDP  150



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 112/142 (79%), Gaps = 5/142 (4%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  276  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            +AL+KRGDGVLG DNFN  YDP
Sbjct  129  IALRKRGDGVLGFDNFNDYYDP  150



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 101/141 (72%), Gaps = 10/141 (7%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskl-iaasskllFRATLMVALILIFFFTINYPPLAES  263
            F  DT+K++KL+RYN+YIR+VNSS   IAASSKLL+R T+++  +LI  F INY     +
Sbjct  5    FSVDTNKSTKLDRYNTYIRKVNSSTKFIAASSKLLYRITILIFALLICSFIINYFLFVSN  64

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
            +     R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC+L
Sbjct  65   NSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCAL  115

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            ALKKRGDGV+G+DNFN+ YDP
Sbjct  116  ALKKRGDGVIGIDNFNSYYDP  136



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHL-  66

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
             RR+  +TG    +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  67   HRRSFLSTGLFSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  126

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGVLG DNFN  YDP
Sbjct  127  RGDGVLGFDNFNDYYDP  143



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 13/137 (9%)
 Frame = +3

Query  135  YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRA  287
            YI R+    L++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA
Sbjct  113  YIDRIGEKTLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRA  172

Query  288  LHTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
               + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ 
Sbjct  173  ASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRA  232

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGV+GLDNFN+ YDP
Sbjct  233  RGDGVVGLDNFNSYYDP  249



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 13/136 (10%)
 Frame = +3

Query  138  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  290
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  27   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  86

Query  291  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  87   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  146

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+GLDNFN+ YDP
Sbjct  147  GDGVVGLDNFNSYYDP  162



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  276  RRRALHTT--GHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  449
            RR  L T     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL
Sbjct  68   RRSFLSTGLFSSSSASSSLGGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIAL  127

Query  450  KKRGDGVLGLDNFNAXYDP  506
            +KRGDGVLG DNFN  YDP
Sbjct  128  RKRGDGVLGFDNFNDYYDP  146



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 13/136 (10%)
 Frame = +3

Query  138  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  290
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  26   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  85

Query  291  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  86   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  145

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+GLDNFN+ YDP
Sbjct  146  GDGVVGLDNFNSYYDP  161



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  444  ALKKRGDGVLGLDNFNAXYD  503
            AL+KRGDGVLG DNFN  YD
Sbjct  126  ALRKRGDGVLGFDNFNDYYD  145



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 109/140 (78%), Gaps = 7/140 (5%)
 Frame = +3

Query  96   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  275
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  276  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  444  ALKKRGDGVLGLDNFNAXYD  503
            AL+KRGDGVLG DNFN  YD
Sbjct  126  ALRKRGDGVLGFDNFNDYYD  145



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 20/152 (13%)
 Frame = +3

Query  102  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS-  266
            +K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S 
Sbjct  13   AKGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSF  72

Query  267  -----------GGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTG  410
                        G R  A H    SLL ++ S GGAAWEK+V+ SA P R  G+SVLVTG
Sbjct  73   HLSAGGGGGADDGARSSASH---RSLLMSSASYGGAAWEKEVRRSARPSRDGGISVLVTG  129

Query  411  AAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            AAGFVG+HCSLAL+ RGDGVLGLDNFN+ YDP
Sbjct  130  AAGFVGTHCSLALRARGDGVLGLDNFNSYYDP  161



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 83/119 (70%), Gaps = 13/119 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPL---------AESSGGGRRRALHTTGH-SLL---AATFS  329
            FRAT++  L L+  FT++YP L         A ++  G+ RA   + H SLL   AA   
Sbjct  189  FRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAY  248

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+ YDP
Sbjct  249  GGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDP  307



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 89/142 (63%), Gaps = 30/142 (21%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL RYNSY+RR+NS           F+      ++L+  +T+       
Sbjct  73   MASSPDTSKTIKLMRYNSYLRRLNS-----------FKLLKTSFILLLLLYTL-------  114

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                       +T H LL++ F G  AWE QV+ SA PRR +GMSVLVTGAAGFVGSHCS
Sbjct  115  -----------STHHLLLSSAFHG-PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCS  162

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            L+LKKRGDGVLGLDNFN+ YDP
Sbjct  163  LSLKKRGDGVLGLDNFNSYYDP  184



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 4/145 (3%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRR-VNsskliaasskllFRATLMVALILIFFFTINYPPL-  254
            MA PPDTSK SKLERYNSY+RR V+S+KLIAASS +LFRATL+ AL+LIF F ++ PPL 
Sbjct  1    MASPPDTSKASKLERYNSYLRRRVSSAKLIAASSYILFRATLLAALLLIFLFLLHSPPLL  60

Query  255  -AESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
             + S       + H +  S  +A + GGAAWE+ V+ SATPRR +G+SVLVTGAAGFVG+
Sbjct  61   FSGSHYYSSSHSNHRSLLSSSSAAY-GGAAWEQDVRRSATPRRADGLSVLVTGAAGFVGT  119

Query  432  HCSLALKKRGDGVLGLDNFNAXYDP  506
            HCSLALK+RGDGV+G+DNFNA YDP
Sbjct  120  HCSLALKRRGDGVVGVDNFNAYYDP  144



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 11/147 (7%)
 Frame = +3

Query  87   FPP----DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  254
             PP    DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL L+  F  NY PL
Sbjct  1    MPPSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALFLLLLFAFNYHPL  60

Query  255  AESSGGG----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
            ++S         RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGF
Sbjct  61   SDSRAAASHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGF  117

Query  423  VGSHCSLALKKRGDGVLGLDNFNAXYD  503
            VGSHCS+AL+KRGDGVLG DNFN  YD
Sbjct  118  VGSHCSIALRKRGDGVLGFDNFNDYYD  144



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 103/164 (63%), Gaps = 24/164 (15%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASSAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  246  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  374
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNA YDP
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDP  164



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 103/164 (63%), Gaps = 24/164 (15%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  246  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  374
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNA YDP
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDP  164



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (67%), Gaps = 10/145 (7%)
 Frame = +3

Query  102  SKNSKLERYNS-----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  266
            +K  KLERY S      +RR  SSK++AASS LLFRAT++  L L+  F ++YP L   S
Sbjct  18   AKGVKLERYASGGGALLMRRAGSSKIVAASSHLLFRATVLATLALVCLFAVHYPTLLSRS  77

Query  267  ---GGGRRRALHTTGHSLLAATFSG--GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  431
                        T+ H  L  + S   GAAWE++V+ SATPRR  GMSVLVTGAAGFVG+
Sbjct  78   FRLSAASSPPRPTSRHRNLLGSSSAYAGAAWEREVRRSATPRRDGGMSVLVTGAAGFVGA  137

Query  432  HCSLALKKRGDGVLGLDNFNAXYDP  506
            HC+LAL+ RGDGVLGLDNFNA Y+P
Sbjct  138  HCALALRARGDGVLGLDNFNAYYEP  162



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 102/150 (68%), Gaps = 15/150 (10%)
 Frame = +3

Query  102  SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLA----  257
            +K  KLERY S     +RR  S+K+++ASS LLFRAT++  L L+F FT++YP L     
Sbjct  13   AKGMKLERYASGGALMLRRATSAKIVSASSHLLFRATVLATLALVFLFTLHYPSLLFRSF  72

Query  258  -ESSGGGRRRALHTTGHSLLAATFS------GGAAWEKQVQSSATPRRQNGMSVLVTGAA  416
              S+GGG     H+  H  L  + S      GGAAWEK+++ SA P R  G+SVLVTGAA
Sbjct  73   HLSAGGGGPGGAHSASHRSLLMSSSSTSASYGGAAWEKEMRQSARPSRDGGISVLVTGAA  132

Query  417  GFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GFVG+HCSLALK RGDGV+GLDNFN+ YDP
Sbjct  133  GFVGTHCSLALKARGDGVVGLDNFNSYYDP  162



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 96/148 (65%), Gaps = 13/148 (9%)
 Frame = +3

Query  102  SKNSKLERYNSYIRRV-NsskliaasskllFRATLMVALILIFFFTINYPPL--------  254
            +K  KLER+   +RR   +  L++ASS LLFRAT++  L L+  F ++YP L        
Sbjct  10   AKGVKLERHAVLLRRAAGAKHLVSASSHLLFRATVLATLALVVLFAVHYPSLLSHSFTLS  69

Query  255  ---AESSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGF  422
               A  S   R R  H +     A++  G GAAWE++V+ SATPRR   +SVLVTGAAGF
Sbjct  70   AAPASPSSTPRSRHSHRSLLGSGASSSYGRGAAWEREVRRSATPRRDGALSVLVTGAAGF  129

Query  423  VGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            VG+HCSLAL+ RGDGV+GLDNFNA YDP
Sbjct  130  VGAHCSLALRARGDGVVGLDNFNAYYDP  157



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 99/162 (61%), Gaps = 25/162 (15%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  251
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGGALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  252  LAESS-------------GGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRR  380
            L   S             G  R  A H    SLLA+T +    G   W+K+++ SA P R
Sbjct  61   LLSRSFSLASDGSSSSVPGASRSHASH---RSLLASTSAAATYGSERWQKEIRRSAKPGR  117

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              G+SVLVTGA GFVG+HCSLALK RGDGV+GLDNFN+ YDP
Sbjct  118  DGGLSVLVTGAGGFVGAHCSLALKARGDGVVGLDNFNSYYDP  159



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 89/141 (63%), Gaps = 11/141 (8%)
 Frame = +3

Query  87   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRAT-LMVALILIFFFTINYPPLAES  263
            F  DT K+ KL+R N+YI +VNSS  +  +   LF    ++++ +LI  F +N+     +
Sbjct  5    FSIDTKKSIKLDR-NTYIHKVNSSTKLIVAFIKLFYCIAILISALLIGLFILNHILFIST  63

Query  264  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  443
                  R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC L
Sbjct  64   DSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCGL  114

Query  444  ALKKRGDGVLGLDNFNAXYDP  506
            ALKKRGDGV+G+DNFN+ YDP
Sbjct  115  ALKKRGDGVIGIDNFNSYYDP  135



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 99/153 (65%), Gaps = 19/153 (12%)
 Frame = +3

Query  105  KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  266
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  267  ------GGGRRRALHTTG---HSLL----AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  407
                          H+T     SLL    A+   GGAAWEK+V+ SA P R  G+SVLVT
Sbjct  74   LSAGAGDDSAGGGAHSTSASHRSLLMSSSASASYGGAAWEKEVRRSARPSRDGGISVLVT  133

Query  408  GAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GAAGFVG+HCSLALK RGDGVLGLDNFN+ YDP
Sbjct  134  GAAGFVGTHCSLALKARGDGVLGLDNFNSYYDP  166



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 96/151 (64%), Gaps = 11/151 (7%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  251
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGSALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  252  LAESSGGGRR------RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGA  413
            L   S           R+  +   S  AA   GG  W+K+++ SA PRR  G+SVLVTGA
Sbjct  61   LLSRSFSLASSSSVPPRSHRSLLASSSAAATYGGERWQKEIRRSAKPRRDGGLSVLVTGA  120

Query  414  AGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
             GFVG+HCSLALK RGDGV+GLDNFN+ YDP
Sbjct  121  GGFVGAHCSLALKARGDGVVGLDNFNSYYDP  151



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 78/142 (55%), Gaps = 33/142 (23%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLGLDNFN  YDP
Sbjct  88   LALKKRGDGVLGLDNFNPYYDP  109



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 78/142 (55%), Gaps = 33/142 (23%)
 Frame = +3

Query  81   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLGLDNFN  YDP
Sbjct  88   LALKKRGDGVLGLDNFNPYYDP  109



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 87/138 (63%), Gaps = 9/138 (7%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  6    PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  64

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
             R       G+  LA    GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  65   SRH-----FGNRALAW---GGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  116

Query  453  KRGDGVLGLDNFNAXYDP  506
            KRGDGV+GLDNFN+ YDP
Sbjct  117  KRGDGVVGLDNFNSYYDP  134



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 103/165 (62%), Gaps = 27/165 (16%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYP-  248
             P D + K  KLERY S     +RRV S KL++ASS LLFRAT++  + L+F FT++YP 
Sbjct  1    MPADAAAKGVKLERYASGGALLLRRVASGKLVSASSHLLFRATVLATIALVFLFTLHYPS  60

Query  249  ------------------PLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
                              PL  +S   R   + ++  +  AA+  G   W+K+++ SA P
Sbjct  61   LLSRSFSLSSSSSSSSPTPLQHASH--RSLLMSSSTPAASAASVYGSEKWQKEIKKSAKP  118

Query  375  RRQNG-MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            R+ +G MSVLVTGAAGFVG+HC+LAL+ RGDGVLGLDNFN+ YDP
Sbjct  119  RKADGGMSVLVTGAAGFVGTHCALALRARGDGVLGLDNFNSYYDP  163



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 85/138 (62%), Gaps = 9/138 (7%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  11   PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  69

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
             R        H    A   GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  70   SR--------HFGNRALTWGGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  121

Query  453  KRGDGVLGLDNFNAXYDP  506
            KRGDGV+GLDNFN+ YDP
Sbjct  122  KRGDGVVGLDNFNSYYDP  139



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 78/121 (64%), Gaps = 15/121 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  326
            FRAT++  L L+  F ++YP L   S              G        ++  SLL +  
Sbjct  44   FRATVLATLALVVLFAVHYPSLLSRSFTLSSASPSSSSSSGSSSSPRSRSSHRSLLGSGA  103

Query  327  S-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            S GGAAWE++V+ SATPRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNA YD
Sbjct  104  SYGGAAWEREVRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGRGDGVVGLDNFNAYYD  163

Query  504  P  506
            P
Sbjct  164  P  164



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 100/160 (63%), Gaps = 20/160 (13%)
 Frame = +3

Query  87   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  245
             P D + K  KLERY S       +RR +  K+++ASS LLFRAT++  L L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGGAMLLLLRRASGGKIVSASSHLLFRATVLATLGLVFLFTFHY  60

Query  246  PPLAESSGGGRRRAL-----HTTGHSLL--------AATFSGGAAWEKQVQSSATPRRQN  386
            P L   S             H +  SLL        A+   GGAAWEK+V+ SA PR+  
Sbjct  61   PSLLSRSFSLSGGGGDGGPAHASHRSLLMSSSSSYSASAAYGGAAWEKEVRKSAKPRKDG  120

Query  387  GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFN+ YDP
Sbjct  121  GIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNSYYDP  160



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GGA+WEKQV+ S+TPRR +G+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  YDP
Sbjct  31   GGASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDP  89



>ref|XP_008664162.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Zea mays]
 tpg|DAA48160.1| TPA: hypothetical protein ZEAMMB73_095571 [Zea mays]
Length=450

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAA-WEKQVQSS  365
            FRAT++  + L+  F  +YP L   S            + L AA +  GAA WE++V+ S
Sbjct  35   FRATVLATIALVVLFAAHYPSLLSRS------------YILSAAAYGRGAASWEREVRRS  82

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            A PRR   +SVLVTGAAGFVG HCSLAL  RGDGV+GLDNFNA YDP
Sbjct  83   AAPRRDGALSVLVTGAAGFVGLHCSLALSARGDGVVGLDNFNAYYDP  129



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 85/142 (60%), Gaps = 16/142 (11%)
 Frame = +3

Query  87   FPP--DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  260
             PP  D +   K+ER   Y  R  +S+  + S++L F A  ++AL+ IFF  +  P    
Sbjct  1    MPPSMDGALKGKMERNGGYFGRPANSRCCSPSARLFFWAATLIALLFIFFMGMTSP----  56

Query  261  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  440
                 RRR        +L +   GG  WEKQV+ S   +R+NG+ VLVTGAAGFVGSH S
Sbjct  57   --SEPRRR--------VLGSYSWGGPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVS  106

Query  441  LALKKRGDGVLGLDNFNAXYDP  506
            LALKKRGDGVLG+DNFN  YDP
Sbjct  107  LALKKRGDGVLGIDNFNNYYDP  128



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 11/102 (11%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +A+I +FF+    PP + +S   RR         L +AT+ GGAAWEK+V++SA  R 
Sbjct  40   LFIAVIFVFFY--RSPPSSSNSDLSRRY--------LTSATW-GGAAWEKRVRTSARIRS  88

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  89   RNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDP  130



>ref|XP_003572425.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=477

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 13/116 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGH-SLL----------AATFSGG  335
            FRAT++  + L+  F  +YP L   S   R  +  ++ H SLL          +A   G 
Sbjct  44   FRATVLATIALVCLFAAHYPSLLSHSF--RLSSPTSSPHRSLLGSSSSSSSSSSAPAFGT  101

Query  336  AAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            AAW++ V+ SATPRR NGMSVLVTGAAGFVG HC++AL  RGDGV+GLDNFNA YD
Sbjct  102  AAWDRAVRRSATPRRANGMSVLVTGAAGFVGFHCAMALAARGDGVVGLDNFNAYYD  157



>gb|AFW61553.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 14/118 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  332
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  333  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNA YDP
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNAYYDP  155



>ref|NP_001150944.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
 gb|ACG41039.1| NAD-dependent epimerase/dehydratase family protein [Zea mays]
Length=476

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 14/118 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESS------------GGGRRRALHTTGHSLLAATFSG  332
            FRAT++  L L+  F ++YP +   S                R +  +   S  A+ +S 
Sbjct  40   FRATVLATLALVVLFAVHYPSMLSRSFSLSAAPASGASSSRSRHSHRSLLGSRPASRWS-  98

Query  333  GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
             AAWE++V+ SA PRR   +SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNA YDP
Sbjct  99   -AAWEREVRRSAAPRRDGALSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNAYYDP  155



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 8/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+    P     S    RR+L T  ++       GG AWEK+V+SSA
Sbjct  39   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYAYTW------GGPAWEKRVRSSA  90

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  91   RVRTRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  136



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 72/107 (67%), Gaps = 12/107 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            A  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  90   ARVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  136



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 71/107 (66%), Gaps = 12/107 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            A  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  90   ARVRSHNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  136



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 67/102 (66%), Gaps = 9/102 (9%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +AL++ FFF     P + S+ G R         SL  A   GG AWEK V+SSA  RR
Sbjct  49   LAIALLVAFFFLSPTTPNSSSTSGRR---------SLRNAAPWGGPAWEKCVRSSARVRR  99

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  100  SGGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDP  141



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +  I++FFF   + P   S+ G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTNSAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN  YD
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYD  143



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  462  DGVLGLDNFNAXYDP  506
            DGV+GLDNFN  YDP
Sbjct  110  DGVVGLDNFNNYYDP  124



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRG
Sbjct  51   QSFMDTGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRG  109

Query  462  DGVLGLDNFNAXYDP  506
            DGV+GLDNFN  YDP
Sbjct  110  DGVVGLDNFNNYYDP  124



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  318  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAX  497
            +T  GG  WE+QV++SA  RRQNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+ 
Sbjct  66   STTWGGGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSY  125

Query  498  YDP  506
            YDP
Sbjct  126  YDP  128



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 68/106 (64%), Gaps = 11/106 (10%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+     P++ +     RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFFYR---SPVSSNPADPSRRSLRTYSW--------GGPAWEKRVRSSA  83

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  84   RLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  129



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+ YDP
Sbjct  71   GGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDP  129



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 7/101 (7%)
 Frame = +3

Query  201  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  380
            L +  I++FFF   + P    + G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTSPAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  381  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN  YD
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYD  143



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SATPRR  G+SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+ YDP
Sbjct  71   GGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDP  129



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+ YDP
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDP  129



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV+SSA  RRQ G SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN  YDP
Sbjct  72   GGIQWEKQVRSSAQIRRQGGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNDYYDP  130



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
             PR  NGM VLVTGAAGFVG+H S ALK+RG+GVLGLDNFN  YDP
Sbjct  89   KPRSSNGMCVLVTGAAGFVGTHVSAALKRRGNGVLGLDNFNDYYDP  134



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +3

Query  318  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAX  497
            +T  GG  WEKQV+SSA   RQNG SVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  
Sbjct  68   STAWGGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNY  127

Query  498  YDP  506
            YDP
Sbjct  128  YDP  130



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF+    P     S    RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYSW--------GGPAWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  86   RVRTRHGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  131



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 15/109 (14%)
 Frame = +3

Query  189  FRATLMVALILIFFF---TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQ  359
            F + + +A+ILIFFF   + N  P A+ S    RR+L T           GG A+EK+V+
Sbjct  42   FWSFIFLAVILIFFFRSPSSNPLPSADPS----RRSLRTYDW--------GGPAFEKRVR  89

Query  360  SSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  90   SSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  138



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV+ SA P R NG SV+VTGAAGFVGSH SLALKKRGDGV+GLDNFN+ YDP
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDP  129



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 12/106 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + L V +I   FF     P + SS   RR +L T  +        GG+AWEK+V+SSA
Sbjct  33   FWSILFVGIIFFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGSAWEKKVRSSA  80

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
                +NG++VLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YDP
Sbjct  81   RVTSKNGVTVLVTGAAGFVGTHTSIALKQRGDGVLGLDNFNDYYDP  126



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            TG   L A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            +DNFN  YDP
Sbjct  120  IDNFNNYYDP  129



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  318  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAX  497
            +T  GG  WEKQV+ SA   RQNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN  
Sbjct  68   STAWGGIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNY  127

Query  498  YDP  506
            YDP
Sbjct  128  YDP  130



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  120  LDNFNDYYDP  129



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++S 
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKAST  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
             PR  NG+ VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  89   KPRSSNGLCVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  134



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YDP
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDP  134



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA PRR  G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+ YDP
Sbjct  71   GGLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDP  129



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  120  LDNFNDYYDP  129



>gb|ACN26174.1| unknown [Zea mays]
Length=249

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 7/71 (10%)
 Frame = +3

Query  312  LAATFSGGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKRGDGVL  473
            LAA++ GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  19   LAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVV  77

Query  474  GLDNFNAXYDP  506
            G+DNFNA YDP
Sbjct  78   GVDNFNAYYDP  88



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YDP
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDP  134



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLTASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  120  LDNFNDYYDP  129



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 78/138 (57%), Gaps = 13/138 (9%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLILWSF---VFSAAILIFFF--RSPATSPLPAD  68

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L +  +        GG  WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPIWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALK  121

Query  453  KRGDGVLGLDNFNAXYDP  506
            +RGDGVLG+DNFN  YDP
Sbjct  122  RRGDGVLGIDNFNDYYDP  139



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GGAAWEK+V+SSA  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  77   GGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  135



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 66/104 (63%), Gaps = 7/104 (7%)
 Frame = +3

Query  195  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
            ++L VALI +FF+                R         LA+   GGAAWEK+V++SA  
Sbjct  38   SSLFVALIFLFFYRSPSSSSNNPPSSDPSR-------RYLASANWGGAAWEKRVRTSARI  90

Query  375  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN  YDP
Sbjct  91   RSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFNDYYDP  134



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SAT RR  GMSVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+ YDP
Sbjct  72   GGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDP  130



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGF+GSH SLALK+RGDGV+G
Sbjct  65   SGSRYLSASW-GGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRRGDGVVG  123

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  124  LDNFNDYYDP  133



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 2/76 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL +A   GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  119  GDGVLGLDNFNRYYDP  134



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRTHGGLTVLVTGASGFVGTHVSIALRRR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  120  GDGVLGLDNFNRYYDP  135



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 66/106 (62%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   LI IFF+    P     S    RR+L T           GG  WEK+V+SSA
Sbjct  39   FWSLVFTGLIFIFFY--RSPSSNPISSAPSRRSLRTYSW--------GGPDWEKRVRSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  89   RVRTRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  134



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 12/106 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + L   +I   FF     P + SS   RR +L T  +        GGAAWEK+V+SSA
Sbjct  27   FWSILFFGVIYFLFFRT---PSSFSSDTSRR-SLRTYNY--------GGAAWEKKVRSSA  74

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
                +NG+SVLVTGAAGFVGSH S+ALK+RGDGV+G+DNFN  YDP
Sbjct  75   KVTSKNGVSVLVTGAAGFVGSHVSIALKRRGDGVVGIDNFNDYYDP  120



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 12/106 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  82

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  83   RVRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  128



>gb|EYU30447.1| hypothetical protein MIMGU_mgv1a006641mg [Erythranthe guttata]
Length=437

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 8/90 (9%)
 Frame = +3

Query  234  TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGA  413
             I  PP A  S GG+RR+L TTGHS L A       WE + ++SA P  ++G++VLVTGA
Sbjct  54   VICSPPAA--SPGGKRRSLQTTGHSRLPAN------WEAKARNSARPVSKSGLTVLVTGA  105

Query  414  AGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            AGFVGSH +LALK RGDGV+GLDNFN  Y+
Sbjct  106  AGFVGSHAALALKNRGDGVVGLDNFNTYYE  135



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSAAKY-GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  118  GDGVLGLDNFNRYYDP  133



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 67/106 (63%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  39   FWSFIFLGLILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKRVRSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++GMSVLVTGAAGFVG+H S ALK+RGDGVLGLD FN  YDP
Sbjct  89   RVRSRHGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDP  134



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  62   RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRR  120

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  121  GDGVLGLDNFNRYYDP  136



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 77/138 (56%), Gaps = 13/138 (9%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLCLWSF---VFSAAILIFFF--RSPASSPLPAD  68

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L +  +        GG  WEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPVWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSAALK  121

Query  453  KRGDGVLGLDNFNAXYDP  506
            +RGDGVLG+DNFN  YDP
Sbjct  122  RRGDGVLGIDNFNDYYDP  139



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 68/106 (64%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F A + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWALVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDP  134



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  318  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAX  497
            +T  GG  WEKQV++SA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN  
Sbjct  68   STAWGGIHWEKQVRASAQIHRHNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNDY  127

Query  498  YDP  506
            YDP
Sbjct  128  YDP  130



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            R L+ +  S+  AT+ GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL +RG
Sbjct  62   RNLNKSSSSVSPATY-GGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRRG  120

Query  462  DGVLGLDNFNAXYDP  506
            DGVLGLDNFN  YDP
Sbjct  121  DGVLGLDNFNHYYDP  135



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T    LAA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYLAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  120  GDGVVGVDNFNAYYDP  135



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            TG     A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   TGSRYFTASW-GGILWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            +DNFN  YDP
Sbjct  120  IDNFNNYYDP  129



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGXAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN  YDP
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDP  137



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN  YDP
Sbjct  74   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNYYDP  132



>ref|XP_010047039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW78789.1| hypothetical protein EUGRSUZ_C00223 [Eucalyptus grandis]
Length=442

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 72/108 (67%), Gaps = 15/108 (14%)
 Frame = +3

Query  195  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  374
            AT M AL L+   T +Y  L         + L ++G+ LLAA++ GG  WEKQV+ SA P
Sbjct  43   ATFMWALFLLAL-TASYLSL---------QGLLSSGNRLLAASW-GGIQWEKQVRVSARP  91

Query  375  RRQNGM----SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            RR  G     SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN  YDP
Sbjct  92   RRPAGAGAGHSVLVTGAAGFVGAHVSLALRKRGDGVVGLDNFNPYYDP  139



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 68/106 (64%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN  YDP
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDP  137



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 66/106 (62%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  37   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  87

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  88   RIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  133



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 66/106 (62%), Gaps = 12/106 (11%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  79

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  80   RLRFRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDP  125



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 67/106 (63%), Gaps = 8/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI I FF       +  S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFICFFKSTSSSSSPVSSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R  NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  89   KIRSTNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDP  134



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWSLVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDP  134



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 78/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFFF    P  +     
Sbjct  8    PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFFF--RSPASSPVPAD  61

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  62   LSRRSLRTYNW--------GGPVWEKRVRASARVRSRNGFAVLVTGAAGFVGTHVSAALK  113

Query  453  KRGDGVLGLDNFNAXYDP  506
            +RGDGVLG+DNFN  YDP
Sbjct  114  RRGDGVLGIDNFNEYYDP  131



>ref|XP_008372097.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVL+TGAAGFVGSH SLALKKRGDGV+G+DNFN+ YDP
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLITGAAGFVGSHVSLALKKRGDGVVGIDNFNSYYDP  130



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L A++ GG  WEKQV+SS+   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  63   SGSRYLTASW-GGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  121

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  122  LDNFNNYYDP  131



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 6/65 (9%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGVLGLDNFN
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVLGLDNFN  130

Query  492  AXYDP  506
            + YDP
Sbjct  131  SYYDP  135



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV+SSA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+G DNFN  YDP
Sbjct  72   GGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKRGDGVVGFDNFNNYYDP  130



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRNLYDS--SVSAAKY-GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  118  GDGVLGLDNFNRYYDP  133



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA  RR  GMSVLVTG AGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  69   GGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  127



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 67/106 (63%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFF--RSPSSNSLPSDPXRRSLRTYNW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN  YDP
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDP  137



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 23/121 (19%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAES--------------SGGGRRRALHTTGHSLLAATF  326
            F A L +A+    F     PP AE+              +GG  RR+L T          
Sbjct  47   FWAFLAIAVFAALFLLSPXPPSAEADPPPSSSLGGAASGNGGQHRRSLRTASW-------  99

Query  327  SGGAAWEKQVQSSATPRRQ-NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
             GG AWEK+V+SSA  RRQ  G SVLVTGAAGFVG+H S ALKKRGDGVLGLD FN  YD
Sbjct  100  -GGPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKRGDGVLGLDCFNDYYD  158

Query  504  P  506
            P
Sbjct  159  P  159



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 10/105 (10%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YD
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYD  130



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 9/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAES-SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LI +FFF        ES +    RR+L T+ +        GG  WEK++++S
Sbjct  38   FWSFVFLGLIFVFFFRSPSSSSPESLTADPSRRSLRTSSY--------GGPDWEKRIKAS  89

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
            A  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YD
Sbjct  90   AKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYD  135



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRG  114

Query  462  DGVLGLDNFNAXYDP  506
            DGV+GLDNFN  YDP
Sbjct  115  DGVVGLDNFNNYYDP  129



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  120  GDGVVGIDNFNAYYDP  135



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRG  114

Query  462  DGVLGLDNFNAXYDP  506
            DGV+GLDNFN  YDP
Sbjct  115  DGVVGLDNFNNYYDP  129



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 10/105 (10%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  91

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YD
Sbjct  92   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYD  136



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 81/137 (59%), Gaps = 16/137 (12%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER N Y  R  S++  ++ +KL F   ++V LI+IFF       +  SS  
Sbjct  14   PSTPGKVKMERSNIYFGR-GSTRWQSSVAKLFFWTVVVVGLIVIFF-------MRSSSPV  65

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR        LL+    GG  WEK+V+ S   + + G+ VLVTGAAGFVGSH SLALK
Sbjct  66   ETRR--------LLSTPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALK  117

Query  453  KRGDGVLGLDNFNAXYD  503
            +RGDGVLGLDNFN  YD
Sbjct  118  RRGDGVLGLDNFNDYYD  134



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +3

Query  309  LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNF  488
            L +AT+ GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNF
Sbjct  66   LTSATW-GGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNF  124

Query  489  NAXYDP  506
            N  YDP
Sbjct  125  NDYYDP  130



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA  RR  G+SVLVTGAAGFVGSH SLAL+KRGDGV+GLDNFN  YDP
Sbjct  71   GGLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNTYYDP  129



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+ YDP
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDP  144



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  120  GDGVVGVDNFNAYYDP  135



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEK V+ SA  +R+NG+ VLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+ YDP
Sbjct  86   GGSVWEKHVRHSAHAKRENGLVVLVTGAAGFVGTHVSLALKKRGDGVIGLDNFNSYYDP  144



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN  YDP
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDP  129



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  129



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  312  LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            LA+   GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN
Sbjct  70   LASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFN  129

Query  492  AXYDP  506
              YDP
Sbjct  130  DYYDP  134



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN  YDP
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDP  129



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G+DNFN+ YDP
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGIDNFNSYYDP  130



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            TG   L A++ GG  WEKQV++SA  RR  G SVLVTG AGFVG+H SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  120  LDNFNNYYDP  129



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 78/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQIRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  453  KRGDGVLGLDNFNAXYDP  506
            +RGDGVLGLDNFN  YDP
Sbjct  120  RRGDGVLGLDNFNDYYDP  137



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKQVRTSAQIHRTGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  129



>gb|KJB27036.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=403

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKRGDGVVGLDNFNNYYDP  129



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK++++SA  R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YDP
Sbjct  76   GGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDP  134



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + LI + FF       + +S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFVCFFRSPSSSSSPASSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  89   KIRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDP  134



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G+DNFN+ YDP
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGIDNFNSYYDP  130



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G+DNFN+ YDP
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGIDNFNSYYDP  130



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 1/77 (1%)
 Frame = +3

Query  276  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  455
            R ++   +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKK
Sbjct  54   RFQSFVDSGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKK  112

Query  456  RGDGVLGLDNFNAXYDP  506
            RGDGV+GLDNFN  YDP
Sbjct  113  RGDGVVGLDNFNNYYDP  129



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 62/76 (82%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L+ +  SL +A + GG+ WEK+V+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAKY-GGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  118  GDGVLGLDNFNRYYDP  133



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR+L T  HS       GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  59   RRSLRT--HSW------GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+GLDNFN  YDP
Sbjct  111  GDGVIGLDNFNDYYDP  126



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  129



>gb|KJB27035.1| hypothetical protein B456_004G273500 [Gossypium raimondii]
Length=430

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SA   R  GMSVLVTGAAGF+GSH SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKQIRNSAKTNRPGGMSVLVTGAAGFIGSHVSLALKKRGDGVVGLDNFNNYYDP  129



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +3

Query  282  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  461
            ++   +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKRG
Sbjct  56   QSFMDSGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRG  114

Query  462  DGVLGLDNFNAXYDP  506
            DGV+G+DNFN  YDP
Sbjct  115  DGVVGIDNFNNYYDP  129



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTG+A FVGSH SLALK+RGDGV+G
Sbjct  64   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRRGDGVVG  122

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  123  LDNFNDYYDP  132



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  74   GGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDP  132



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALKKRGDGVLGLDNFN  YDP
Sbjct  76   GGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKRGDGVLGLDNFNDYYDP  134



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 60/76 (79%), Gaps = 2/76 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S ++A   GG+ WEKQV+ SA PR + G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFVGTHVSIALRRR  118

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  119  GDGVLGLDNFNRYYDP  134



>ref|XP_004251783.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum lycopersicum]
Length=432

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVGSH S+ALKKRGDGV+G
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGSHVSIALKKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            +DNFN  YDP
Sbjct  120  IDNFNNYYDP  129



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFN+ YDP
Sbjct  120  GDGVVGIDNFNSYYDP  135



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFN+ YDP
Sbjct  120  GDGVVGIDNFNSYYDP  135



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGV  470
            H  G +  AA++ GG AWEKQ++ S   RR N   VLVTGAAGF+G+H SLALKKRGDGV
Sbjct  66   HARGATTAAASW-GGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKRGDGV  124

Query  471  LGLDNFNAXYDP  506
            LGLDNFN  YDP
Sbjct  125  LGLDNFNDYYDP  136



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+E+    I      +L    +KL F   + V LIL+F    +      +S  
Sbjct  11   PSTPGKFKMEKSGYNIHHQYHHRLRWPVAKLTFWCCIFVGLILVFMLRSSSSSSYSASDY  70

Query  273  GRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  449
              + ++ +T HS    TFS GG +WEK+V++S   R  NG SVLVTGAAGFVG+H S AL
Sbjct  71   RDKDSI-STRHSRSLRTFSWGGPSWEKRVRNSGRVRAPNGFSVLVTGAAGFVGTHVSAAL  129

Query  450  KKRGDGVLGLDNFNAXYDP  506
            K+RGDGVLGLDNFN  YDP
Sbjct  130  KRRGDGVLGLDNFNDYYDP  148



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WE+Q+++SA  RR++G++VLVTGAAGFVG+H SLAL++RGDGV+GLDNFNA YDP
Sbjct  73   GGLHWERQIRASAAVRREDGIAVLVTGAAGFVGTHVSLALRRRGDGVVGLDNFNAYYDP  131



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEKQV+ SA PR   G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN  YDP
Sbjct  69   GGSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDP  127



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 10/105 (10%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +++  ILIFFF         S     RR+L T           GG +WEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPSWEKRVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN  YD
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYD  130



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN  YDP
Sbjct  76   GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDP  134



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRR  118

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  119  GDGVLGLDNFNRYYDP  134



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN  YDP
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDP  127



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  129



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  120  GDGVVGVDNFNAYYDP  135



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 13/105 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  23   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  69

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YD
Sbjct  70   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYD  114



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN  YDP
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDP  127



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  120  GDGVVGVDNFNAYYDP  135



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALQRR  118

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  119  GDGVLGLDNFNRYYDP  134



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            T    L+A++ GG  WEKQ++ SA  RR +G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRAHGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN+ YDP
Sbjct  120  LDNFNSYYDP  129



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   R  G+SVLVTGAAGFVGSH SLALKKRGDG +G
Sbjct  58   SGSKYLSASW-GGIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKRGDGAVG  116

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  117  LDNFNNYYDP  126



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 13/105 (12%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  84

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYD  503
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YD
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYD  129



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 7/76 (9%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  458
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGA+GFVG+HCSLAL+KR
Sbjct  62   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGASGFVGAHCSLALRKR  120

Query  459  GDGVLGLDNFNAXYDP  506
            GDGV+G+DNFNA YDP
Sbjct  121  GDGVVGIDNFNAYYDP  136



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN  YDP
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDP  129



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  86   GGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDP  144



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 10/106 (9%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  368
            F + + + +ILIFFF    P          RR+L T           GG AWEK V+SSA
Sbjct  36   FWSFVFLGMILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKXVRSSA  85

Query  369  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN  YDP
Sbjct  86   RVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDP  131



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            T    L+A++ GG  WEKQ++ SA  RR  G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRPQGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  477  LDNFNAXYDP  506
            LDNFN+ YDP
Sbjct  120  LDNFNSYYDP  129



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDP  132



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDP  132



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQ+++SAT RR  G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDN N+ YDP
Sbjct  71   GGMQWEKQIRASATVRRPGGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNLNSYYDP  129



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 56/65 (86%), Gaps = 6/65 (9%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQN------GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            GG  WE+Q+++SA+PRR++      G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+D+FN
Sbjct  49   GGLHWERQIRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDSFN  108

Query  492  AXYDP  506
            + YDP
Sbjct  109  SYYDP  113



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG +WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN  YDP
Sbjct  78   GGPSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDP  136



>ref|XP_010422190.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Camelina 
sativa]
 ref|XP_010422191.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Camelina 
sativa]
 ref|XP_010422192.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X3 [Camelina 
sativa]
 ref|XP_010422193.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X4 [Camelina 
sativa]
 ref|XP_010455665.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Camelina sativa]
Length=435

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 2/76 (3%)
 Frame = +3

Query  279  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  458
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  62   RRNLNDS--SSVSAAKYGGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRR  119

Query  459  GDGVLGLDNFNAXYDP  506
            GDGVLGLDNFN  YDP
Sbjct  120  GDGVLGLDNFNRYYDP  135



>ref|XP_008361335.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SL LKKRGDGV+G+DNFN+ YDP
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLGLKKRGDGVVGIDNFNSYYDP  130



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+ER +SY  RV S     AS++LL  +  ++A+ +   F I      +   G
Sbjct  11   PSTPGKVKVER-SSYFGRVASRWHSTASARLLVFSAFLLAVTIFICFRIAANGFVDVYIG  69

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
            G   A  +T    + + +     W+K+V+ S TP+R+NG+ VLVTGAAGFVGSH SLALK
Sbjct  70   GT--AYSSTNGGTIRSAYRSDHLWDKKVRQSCTPKRENGLVVLVTGAAGFVGSHVSLALK  127

Query  453  KRGDGVLGLDNFNAXYD  503
            KRGDG++G+DNFN  Y+
Sbjct  128  KRGDGLVGIDNFNDYYE  144



>gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  121  LDNFNNYYDP  130



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 78/138 (57%), Gaps = 14/138 (10%)
 Frame = +3

Query  93   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  272
            P T    K+++  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PPTPGKFKMDK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  273  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  452
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQVRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  453  KRGDGVLGLDNFNAXYDP  506
            +RGDGVLGLDNFN  YDP
Sbjct  120  RRGDGVLGLDNFNDYYDP  137



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WE+Q+++SA  RR +G++VLVTGAAGFVG+H SLAL++RGDGV+G+DNFNA YDP
Sbjct  73   GGLHWERQIRASAAVRRDDGIAVLVTGAAGFVGTHVSLALRRRGDGVVGIDNFNAYYDP  131



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEISRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  121  LDNFNNYYDP  130



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN  YDP
Sbjct  78   GGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGVDNFNDYYDP  136



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 6/65 (9%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  72   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  131

Query  492  AXYDP  506
              YDP
Sbjct  132  KYYDP  136



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 6/65 (9%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  74   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  133

Query  492  AXYDP  506
              YDP
Sbjct  134  KYYDP  138



>ref|XP_004296420.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Fragaria vesca subsp. 
vesca]
Length=434

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEKQV++SA   R  GMS+LVTGAAGFVG+H S+ALKKRGDGV+GLDNFN  YDP
Sbjct  74   GGIQWEKQVRNSAQIHRSGGMSILVTGAAGFVGTHVSVALKKRGDGVVGLDNFNNYYDP  132



>ref|XP_010047879.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW79891.1| hypothetical protein EUGRSUZ_C01241 [Eucalyptus grandis]
Length=432

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            GG  WEK+V+ SA   R +G+SVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN+ YDP
Sbjct  72   GGIQWEKRVRDSAQVHRPDGLSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNSYYDP  130



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 9/107 (8%)
 Frame = +3

Query  189  FRATLMVALILIFFFTINYPPLAESSGGG-RRRALHTTGHSLLAATFSGGAAWEKQVQSS  365
            F + + + LI +FFF       +  +     RR+L T+ +         G AWEK++++S
Sbjct  37   FWSFVFLGLIFVFFFRSPSSSSSSPAASDLSRRSLRTSSYD--------GPAWEKRIKAS  88

Query  366  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAXYDP  506
            A  R  +G+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN  YDP
Sbjct  89   AKVRSHSGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDP  135



>ref|XP_010438178.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=430

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 54/70 (77%), Gaps = 1/70 (1%)
 Frame = +3

Query  297  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  476
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  477  LDNFNAXYDP  506
            LDNFN  YDP
Sbjct  117  LDNFNNYYDP  126



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 6/65 (9%)
 Frame = +3

Query  330  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  491
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  130

Query  492  AXYDP  506
              YDP
Sbjct  131  NYYDP  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905