BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030M10

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009338145.1|  PREDICTED: proliferation-associated protein ...    103   8e-25   
ref|XP_004156612.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    105   4e-24   
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    105   4e-24   Cucumis sativus [cucumbers]
ref|XP_002530504.1|  proliferation-associated 2g4, putative             105   4e-24   Ricinus communis
ref|XP_008350687.1|  PREDICTED: proliferation-associated protein ...    101   1e-23   
ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    103   1e-23   Cucumis melo [Oriental melon]
ref|XP_007026647.1|  Metallopeptidase M24 family protein isoform 2      103   1e-23   
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             103   2e-23   
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    103   2e-23   Eucalyptus grandis [rose gum]
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    103   2e-23   Vitis vinifera
gb|KJB36946.1|  hypothetical protein B456_006G183700                    103   2e-23   Gossypium raimondii
gb|KJB36944.1|  hypothetical protein B456_006G183700                    103   2e-23   Gossypium raimondii
gb|KHG01253.1|  Proliferation-associated 2G4                            103   2e-23   Gossypium arboreum [tree cotton]
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    103   3e-23   Solanum lycopersicum
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    102   3e-23   
ref|XP_003623305.1|  Proliferation-associated protein 2G4               102   3e-23   Medicago truncatula
gb|ACJ85304.1|  unknown                                                 102   3e-23   Medicago truncatula
ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    102   3e-23   Nicotiana sylvestris
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    102   3e-23   
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    102   3e-23   Malus domestica [apple tree]
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      102   4e-23   
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   102   4e-23   Citrus sinensis [apfelsine]
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             102   5e-23   
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    102   5e-23   Cucumis melo [Oriental melon]
gb|ABF66654.1|  EBP1                                                    102   6e-23   Ammopiptanthus mongolicus
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    102   6e-23   Nicotiana tomentosiformis
gb|KJB17056.1|  hypothetical protein B456_002G262700                    101   6e-23   Gossypium raimondii
ref|XP_006381246.1|  hypothetical protein POPTR_0006s10320g             101   7e-23   
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    102   7e-23   Nicotiana tomentosiformis
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    101   8e-23   
ref|NP_001242070.1|  uncharacterized protein LOC100784176               101   8e-23   
gb|KEH38647.1|  proliferation-associated 2G4-like protein               101   8e-23   Medicago truncatula
gb|KDP22867.1|  hypothetical protein JCGZ_00454                         101   8e-23   Jatropha curcas
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    101   8e-23   Nicotiana tomentosiformis
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    101   9e-23   
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    101   9e-23   Vitis vinifera
ref|NP_001275188.1|  EBP1                                               101   1e-22   Solanum tuberosum [potatoes]
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    101   1e-22   Glycine max [soybeans]
gb|ABK95017.1|  unknown                                                 101   1e-22   Populus trichocarpa [western balsam poplar]
gb|ACU19222.1|  unknown                                               99.4    1e-22   Glycine max [soybeans]
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             101   1e-22   
gb|KJB17053.1|  hypothetical protein B456_002G262700                    100   1e-22   Gossypium raimondii
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    100   1e-22   Cicer arietinum [garbanzo]
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Malus domestica [apple tree]
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Nicotiana sylvestris
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Pyrus x bretschneideri [bai li]
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    100   2e-22   Cicer arietinum [garbanzo]
emb|CDP09213.1|  unnamed protein product                                100   3e-22   Coffea canephora [robusta coffee]
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g           99.8    4e-22   Phaseolus vulgaris [French bean]
gb|AHA84129.1|  DNA-binding protein GBP16                             99.8    4e-22   Phaseolus vulgaris [French bean]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...  99.8    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g           99.8    4e-22   Phaseolus vulgaris [French bean]
gb|KHG25370.1|  Proliferation-associated 2G4                          99.8    4e-22   Gossypium arboreum [tree cotton]
gb|KHN42848.1|  Proliferation-associated protein 2G4                  99.8    4e-22   Glycine soja [wild soybean]
gb|KHN39558.1|  Proliferation-associated protein 2G4                  99.8    5e-22   Glycine soja [wild soybean]
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...  99.8    5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4  99.8    5e-22   Glycine max [soybeans]
ref|NP_001241588.1|  uncharacterized protein LOC100781302             99.4    5e-22   Glycine max [soybeans]
ref|XP_006843644.1|  hypothetical protein AMTR_s00007p00167240        99.0    5e-22   
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...  99.4    5e-22   Solanum tuberosum [potatoes]
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein     99.4    6e-22   Phaseolus vulgaris [French bean]
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...  99.4    6e-22   Solanum tuberosum [potatoes]
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    100   6e-22   
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...  99.4    6e-22   Brassica rapa
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...  99.4    6e-22   Tarenaya hassleriana [spider flower]
gb|AEY75257.1|  putative DNA binding protein                          99.4    7e-22   Atriplex canescens [shadscale]
emb|CDY16291.1|  BnaC01g23260D                                        99.4    7e-22   Brassica napus [oilseed rape]
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...  99.4    7e-22   Solanum lycopersicum
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...  99.0    7e-22   Solanum lycopersicum
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg              99.0    8e-22   Erythranthe guttata [common monkey flower]
emb|CDX90633.1|  BnaA03g41480D                                        98.6    9e-22   
gb|AAF91445.1|AF281652_1  putative DNA binding protein                98.6    1e-21   Atriplex hortensis
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...  98.6    1e-21   Populus euphratica
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...  98.6    1e-21   Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...  98.6    1e-21   Brassica rapa
emb|CDY33263.1|  BnaA01g19300D                                        98.2    1e-21   Brassica napus [oilseed rape]
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...  98.2    2e-21   Populus euphratica
emb|CDX78041.1|  BnaA09g32360D                                        98.6    2e-21   
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4  97.8    2e-21   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX73690.1|  BnaC08g23130D                                        97.4    3e-21   
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...  97.1    4e-21   Elaeis guineensis
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...  97.1    4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...  96.7    5e-21   Brassica rapa
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...  96.7    5e-21   Phoenix dactylifera
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                  96.3    8e-21   Arabis alpina [alpine rockcress]
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4  95.5    1e-20   Fragaria vesca subsp. vesca
gb|EPS71863.1|  hypothetical protein M569_02886                       95.1    2e-20   Genlisea aurea
emb|CDY29047.1|  BnaC07g32530D                                        95.1    2e-20   Brassica napus [oilseed rape]
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...  94.7    2e-20   
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...  95.1    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...  95.1    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...  94.7    2e-20   Phoenix dactylifera
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg           94.7    3e-20   
ref|XP_008656355.1|  PREDICTED: proliferation-associated protein ...  92.4    3e-20   
dbj|BAH19507.1|  AT3G51800                                            94.4    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p         94.7    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...  94.4    3e-20   Camelina sativa [gold-of-pleasure]
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg              94.4    3e-20   Erythranthe guttata [common monkey flower]
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p            94.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...  94.4    4e-20   Elaeis guineensis
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g           94.0    4e-20   
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p            94.4    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530           93.6    6e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...  93.6    7e-20   Elaeis guineensis
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...  93.6    1e-19   
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p    93.2    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg           92.8    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610        92.4    2e-19   Sorghum bicolor [broomcorn]
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...  92.4    2e-19   Setaria italica
ref|NP_001149216.1|  proliferation-associated protein 2G4             91.7    4e-19   Zea mays [maize]
ref|XP_004148633.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  90.9    4e-19   
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4  91.3    5e-19   Brachypodium distachyon [annual false brome]
gb|ADK78215.1|  methionine aminopeptiase                              91.3    6e-19   Hordeum vulgare [barley]
gb|ABR26103.1|  proliferation-associated protein 2g4                  89.0    1e-18   Oryza sativa Indica Group [Indian rice]
gb|EMT31637.1|  Proliferation-associated protein 2G4                  91.3    1e-18   
gb|EMS60472.1|  Proliferation-associated protein 2G4                  91.3    1e-18   Triticum urartu
ref|XP_010092793.1|  Proliferation-associated protein 2G4             90.5    1e-18   
gb|AFG29445.1|  Erb3 binding protein                                  89.7    2e-18   Nervilia fordii
ref|XP_006602676.1|  PREDICTED: proliferation-associated protein ...  85.1    3e-18   
gb|AAB80919.1|  DNA-binding protein GBP16                             89.0    4e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97646.1|  hypothetical protein OsI_19569                        88.6    5e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001055274.1|  Os05g0350500                                     88.6    5e-18   
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...  88.6    5e-18   Phoenix dactylifera
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...  87.4    1e-17   Oryza brachyantha
gb|ABK24337.1|  unknown                                               85.5    6e-17   Picea sitchensis
ref|XP_001779761.1|  predicted protein                                84.7    1e-16   
ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...  82.8    6e-16   Sesamum indicum [beniseed]
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...  81.6    2e-15   Sesamum indicum [beniseed]
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...  81.6    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_001769950.1|  predicted protein                                80.9    3e-15   
gb|EEE63363.1|  hypothetical protein OsJ_18175                        77.4    4e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648           76.3    1e-13   
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780            76.3    1e-13   
ref|XP_002772853.1|  Curved DNA-binding protein, putative             66.2    1e-10   Perkinsus marinus ATCC 50983
ref|XP_002775231.1|  proliferation-associated protein 2G4 metallo...  67.8    1e-10   Perkinsus marinus ATCC 50983
ref|XP_002772849.1|  proliferation-associated protein 2G4 metallo...  65.5    8e-10   Perkinsus marinus ATCC 50983
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596            64.7    2e-09   Volvox carteri f. nagariensis
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416           61.2    2e-08   Chlamydomonas reinhardtii
ref|XP_003880798.1|  methionine aminopeptidase,related                60.5    5e-08   Neospora caninum Liverpool
gb|KHN20321.1|  Proliferation-associated protein 2G4                  56.6    1e-07   Glycine soja [wild soybean]
gb|KIZ00762.1|  hypothetical protein MNEG_7198                        58.5    2e-07   Monoraphidium neglectum
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative   58.2    3e-07   
ref|XP_003062941.1|  predicted protein                                57.8    4e-07   Micromonas pusilla CCMP1545
ref|XP_011400941.1|  Proliferation-associated protein A               57.4    5e-07   Auxenochlorella protothecoides
ref|XP_007780740.1|  methionyl aminopeptidase                         57.4    5e-07   Coniosporium apollinis CBS 100218
gb|KEQ99626.1|  hypothetical protein AUEXF2481DRAFT_35538             57.4    5e-07   Aureobasidium subglaciale EXF-2481
ref|XP_009225656.1|  curved DNA-binding protein                       57.4    6e-07   Gaeumannomyces tritici R3-111a-1
ref|XP_002508417.1|  predicted protein                                57.0    6e-07   Micromonas commoda
ref|XP_008597452.1|  DNA-binding protein                              57.0    6e-07   Beauveria bassiana ARSEF 2860
gb|ADX97052.1|  proliferation-associated protein 2g4                  57.0    7e-07   Perca flavescens
gb|ERT00738.1|  DNA-binding protein, 42 kDa                           57.0    7e-07   Sporothrix schenckii ATCC 58251
gb|EPR57248.1|  putative proliferation-associated protein 2G4         57.0    9e-07   Toxoplasma gondii GT1
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative   57.0    9e-07   Toxoplasma gondii ME49
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...  56.6    1e-06   Astyanax mexicanus [blind cave fish]
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...  56.2    1e-06   Maylandia zebra
ref|XP_005650680.1|  proliferation-associated protein 1               55.8    2e-06   Coccomyxa subellipsoidea C-169
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4  55.8    2e-06   Larimichthys crocea [croceine croaker]
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4  55.8    2e-06   Stegastes partitus
ref|XP_001765994.1|  predicted protein                                55.8    2e-06   
ref|XP_008084685.1|  Creatinase/aminopeptidase                        55.8    2e-06   Glarea lozoyensis ATCC 20868
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative   55.5    2e-06   Pediculus humanus corporis [human body lice]
gb|KEQ89790.1|  Creatinase/aminopeptidase                             55.1    3e-06   Aureobasidium pullulans EXF-150
ref|XP_007238523.1|  PREDICTED: proliferation-associated protein ...  54.3    3e-06   
gb|KGQ12825.1|  Curved DNA-binding protein                            55.1    3e-06   Beauveria bassiana D1-5
gb|EFA84439.1|  proliferation associated protein                      55.1    3e-06   Heterostelium album PN500
ref|XP_007723115.1|  methionyl aminopeptidase                         55.1    4e-06   Capronia coronata CBS 617.96
ref|XP_009160571.1|  methionyl aminopeptidase                         54.7    4e-06   Exophiala dermatitidis NIH/UT8656
gb|KIW05574.1|  DNA-binding protein, 42 kDa                           54.7    4e-06   Verruconis gallopava
ref|NP_001002070.1|  proliferation-associated 2G4, a                  54.7    5e-06   Danio rerio [leopard danio]
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...  54.3    5e-06   Oreochromis niloticus
ref|XP_756019.1|  curved DNA-binding protein (42 kDa protein)         54.7    5e-06   Aspergillus fumigatus Af293
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...  54.3    5e-06   Pundamilia nyererei
ref|XP_002182273.1|  predicted protein                                54.3    5e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...  54.3    5e-06   Neolamprologus brichardi [lyretail cichlid]
gb|EFX00371.1|  curved DNA-binding protein                            54.3    6e-06   Grosmannia clavigera kw1407
ref|XP_006961234.1|  predicted protein                                53.9    7e-06   Trichoderma reesei QM6a
ref|XP_001538918.1|  curved DNA-binding protein 42 kDa protein        53.9    7e-06   Histoplasma capsulatum NAm1
gb|EGE81269.1|  curved DNA-binding protein                            53.9    8e-06   Blastomyces dermatitidis ATCC 18188
emb|CAG06775.1|  unnamed protein product                              53.9    8e-06   Tetraodon nigroviridis
ref|XP_002626628.1|  curved DNA-binding protein                       53.9    8e-06   Blastomyces gilchristii SLH14081
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4  53.9    8e-06   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591            53.9    9e-06   Aureococcus anophagefferens
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...  53.5    9e-06   Oryzias latipes [Japanese rice fish]
gb|KEZ41545.1|  hypothetical protein SAPIO_CDS7708                    53.5    9e-06   Scedosporium apiospermum
dbj|GAM85687.1|  hypothetical protein ANO11243_036950                 53.5    9e-06   fungal sp. No.11243
gb|EGC43811.1|  curved DNA-binding protein                            53.5    1e-05   Histoplasma capsulatum H88
gb|EEH04219.1|  curved DNA-binding protein                            53.5    1e-05   Histoplasma capsulatum G186AR
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...  53.5    1e-05   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ESZ92139.1|  curved DNA-binding protein (42 kDa protein)           53.5    1e-05   Sclerotinia borealis F-4128
emb|CBK24689.2|  unnamed protein product                              53.5    1e-05   Blastocystis hominis
gb|EHK24663.1|  hypothetical protein TRIVIDRAFT_71961                 53.5    1e-05   Trichoderma virens Gv29-8
ref|XP_002141587.1|  proliferation-associated protein 2G4             53.1    1e-05   Cryptosporidium muris RN66
gb|KIH92167.1|  methionyl aminopeptidase                              53.1    1e-05   Sporothrix brasiliensis 5110
ref|XP_004029906.1|  hypothetical protein IMG5_170920                 52.8    2e-05   Ichthyophthirius multifiliis
ref|XP_007729945.1|  methionyl aminopeptidase                         53.1    2e-05   Capronia epimyces CBS 606.96
ref|XP_007822009.1|  Peptidase M24, structural domain protein         52.8    2e-05   Metarhizium robertsii ARSEF 23
ref|XP_680568.1|  hypothetical protein AN7299.2                       52.8    2e-05   Aspergillus nidulans FGSC A4
gb|KFG83101.1|  hypothetical protein MANI_006615                      52.8    2e-05   Metarhizium anisopliae
gb|KID91064.1|  Peptidase M24, structural domain protein              52.8    2e-05   Metarhizium guizhouense ARSEF 977
gb|EHK47914.1|  hypothetical protein TRIATDRAFT_298169                52.8    2e-05   Trichoderma atroviride IMI 206040
gb|KID80031.1|  Peptidase M24, structural domain protein              52.8    2e-05   Metarhizium brunneum ARSEF 3297
ref|XP_007275522.1|  curved dna-binding protein (42 kda protein)      52.8    2e-05   
emb|CBJ31951.1|  conserved unknown protein                            52.8    2e-05   Ectocarpus siliculosus
gb|KFX45625.1|  Curved DNA-binding protein                            52.8    2e-05   Talaromyces marneffei PM1
gb|KEQ71987.1|  curved DNA-binding protein-like protein               52.8    2e-05   Aureobasidium namibiae CBS 147.97
dbj|GAD91806.1|  curved DNA-binding protein                           52.4    3e-05   Byssochlamys spectabilis No. 5
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein ...  52.4    3e-05   
emb|CCE30910.1|  related to 442K curved dna-binding protein           52.4    3e-05   Claviceps purpurea 20.1
ref|XP_001261149.1|  curved DNA-binding protein (42 kDa protein)      52.0    3e-05   Aspergillus fischeri NRRL 181
gb|KEQ67804.1|  curved DNA-binding protein                            52.0    3e-05   Aureobasidium melanogenum CBS 110374
ref|XP_002791404.1|  curved DNA-binding protein 42 kDa protein        52.0    3e-05   Paracoccidioides lutzii Pb01
gb|KIE03023.1|  Peptidase M24, structural domain protein              52.0    3e-05   Metarhizium majus ARSEF 297
ref|XP_003717269.1|  curved DNA-binding protein                       52.0    3e-05   Magnaporthe oryzae 70-15
ref|XP_001275960.1|  curved DNA-binding protein (42 kDa protein)      52.0    3e-05   Aspergillus clavatus NRRL 1
gb|KIL90871.1|  methionyl aminopeptidase                              51.6    4e-05   Fusarium avenaceum
ref|XP_003655248.1|  hypothetical protein THITE_2118722               51.6    4e-05   Thielavia terrestris NRRL 8126
ref|XP_003023402.1|  hypothetical protein TRV_02504                   51.6    4e-05   Trichophyton verrucosum HKI 0517
ref|XP_007809491.1|  hypothetical protein MAC_03151                   51.6    4e-05   Metarhizium acridum CQMa 102
ref|XP_001134549.1|  proliferation associated protein                 51.6    4e-05   Dictyostelium discoideum AX4
ref|XP_003010574.1|  hypothetical protein ARB_03275                   51.6    4e-05   Trichophyton benhamiae CBS 112371
gb|EZF36166.1|  DNA-binding protein, 42 kDa                           51.6    4e-05   Trichophyton interdigitale H6
gb|EZF23298.1|  DNA-binding protein, 42 kDa                           51.6    4e-05   Trichophyton rubrum MR850
gb|EZG06696.1|  DNA-binding protein, 42 kDa                           51.6    4e-05   Trichophyton rubrum CBS 735.88
gb|ENH80985.1|  curved DNA-binding protein                            51.6    4e-05   
ref|XP_007910879.1|  putative curved dna-binding protein              51.6    5e-05   Phaeoacremonium minimum UCRPA7
gb|EZF74346.1|  DNA-binding protein, 42 kDa                           51.6    5e-05   Trichophyton soudanense CBS 452.61
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4     51.2    5e-05   Tribolium castaneum [rust-red flour beetle]
ref|XP_003851977.1|  peptidase M24                                    51.6    5e-05   Zymoseptoria tritici IPO323
ref|XP_001744838.1|  hypothetical protein                             51.2    5e-05   Monosiga brevicollis MX1
gb|KHN95092.1|  Peptidase M24, structural domain protein              51.2    6e-05   Metarhizium album ARSEF 1941
ref|XP_003170517.1|  curved DNA-binding protein                       51.2    6e-05   Nannizzia gypsea CBS 118893
gb|EME42273.1|  hypothetical protein DOTSEDRAFT_73192                 51.2    6e-05   Dothistroma septosporum NZE10
ref|XP_002848380.1|  curved DNA-binding protein                       51.2    6e-05   Microsporum canis CBS 113480
ref|XP_001402244.1|  curved DNA-binding protein                       51.2    6e-05   Aspergillus niger CBS 513.88
ref|XP_002584182.1|  conserved hypothetical protein                   51.2    7e-05   Uncinocarpus reesii 1704
ref|XP_008718377.1|  DNA-binding protein, 42 kDa                      50.8    7e-05   Cyphellophora europaea CBS 101466
gb|ELT89178.1|  hypothetical protein CAPTEDRAFT_136142                48.9    7e-05   Capitella teleta
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...  50.8    7e-05   Galendromus occidentalis
gb|EAS28237.3|  DNA-binding protein, 42 kDa                           50.8    7e-05   Coccidioides immitis RS
ref|XP_001239820.1|  hypothetical protein CIMG_09441                  50.8    7e-05   
ref|XP_003067352.1|  curved DNA-binding protein, putative             50.8    7e-05   Coccidioides posadasii C735 delta SOWgp
emb|CDQ74715.1|  unnamed protein product                              50.8    8e-05   Oncorhynchus mykiss
ref|NP_997806.1|  proliferation-associated 2G4-like                   50.8    8e-05   Danio rerio [leopard danio]
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...  50.8    8e-05   
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512            50.8    9e-05   Aureococcus anophagefferens
ref|XP_001585439.1|  hypothetical protein SS1G_13678                  50.8    9e-05   Sclerotinia sclerotiorum 1980 UF-70
emb|CDQ89185.1|  unnamed protein product                              50.4    1e-04   Oncorhynchus mykiss
emb|CCD54680.1|  similar to curved DNA-binding protein                50.4    1e-04   Botrytis cinerea T4
gb|KFX88177.1|  hypothetical protein O988_09133                       50.4    1e-04   Pseudogymnoascus sp. VKM F-3808
ref|XP_001546060.1|  hypothetical protein BC1G_15535                  50.4    1e-04   
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...  50.4    1e-04   Maylandia zebra
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...  50.4    1e-04   Oreochromis niloticus
dbj|GAA90988.1|  curved DNA-binding protein (42 kDa protein)          50.4    1e-04   Aspergillus kawachii IFO 4308
gb|KFY73724.1|  hypothetical protein V499_06201                       50.4    1e-04   Pseudogymnoascus sp. VKM F-103
gb|ELR08951.1|  hypothetical protein GMDG_00569                       50.4    1e-04   Pseudogymnoascus destructans 20631-21
ref|XP_002486971.1|  curved DNA-binding protein (42 kDa protein)      50.4    1e-04   Talaromyces stipitatus ATCC 10500
gb|KFH48005.1|  Curved DNA-binding protein-like protein               50.1    1e-04   Acremonium chrysogenum ATCC 11550
ref|XP_011113791.1|  hypothetical protein H072_8066                   50.1    1e-04   
gb|EPE07312.1|  curved dna-binding protein                            50.1    1e-04   Ophiostoma piceae UAMH 11346
gb|ACI67880.1|  Proliferation-associated protein 2G4                  47.8    1e-04   Salmo salar
gb|EXM36515.1|  methionyl aminopeptidase                              50.1    1e-04   Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_007291250.1|  curved DNA-binding protein                       50.1    1e-04   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KDB25277.1|  DNA-binding protein, 42 kDa                           50.1    1e-04   Trichophyton interdigitale MR816
gb|EGU78845.1|  hypothetical protein FOXB_10634                       50.1    1e-04   Fusarium oxysporum Fo5176
ref|XP_001908204.1|  hypothetical protein                             50.1    1e-04   Podospora anserina S mat+
dbj|GAM23516.1|  hypothetical protein SAMD00019534_066910             50.1    1e-04   Acytostelium subglobosum LB1
ref|XP_007596603.1|  DNA-binding protein                              50.1    2e-04   
gb|ACI33074.1|  Proliferation-associated protein 2G4                  49.7    2e-04   Salmo salar
gb|EYB23739.1|  hypothetical protein FG05_06955                       49.7    2e-04   Fusarium graminearum
ref|XP_011326629.1|  hypothetical protein FGSG_06955                  49.7    2e-04   Fusarium graminearum PH-1
gb|KFB44440.1|  AGAP005108-PA-like protein                            49.7    2e-04   Anopheles sinensis
gb|EWG48488.1|  methionyl aminopeptidase                              49.7    2e-04   Fusarium verticillioides 7600
ref|XP_009256162.1|  hypothetical protein FPSE_04769                  49.7    2e-04   Fusarium pseudograminearum CS3096
emb|CCT65921.1|  related to 442K curved dna-binding protein           49.7    2e-04   Fusarium fujikuroi IMI 58289
ref|XP_002145556.1|  curved DNA-binding protein (42 kDa protein)      49.7    2e-04   Talaromyces marneffei ATCC 18224
gb|EXV04163.1|  peptidase M24 family protein                          49.7    2e-04   Metarhizium robertsii
gb|EPZ31276.1|  Peptidase M24, structural domain-containing protein   49.3    2e-04   Rozella allomycis CSF55
gb|KFX45626.1|  Curved DNA-binding protein                            49.7    2e-04   
gb|KFY28169.1|  hypothetical protein V493_03065                       49.3    2e-04   
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...  49.3    2e-04   
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...  49.3    2e-04   
gb|ELQ37988.1|  curved DNA-binding protein                            49.3    2e-04   
gb|KFA63568.1|  hypothetical protein S40285_00298                     49.3    2e-04   
gb|KEY74153.1|  hypothetical protein S7711_00313                      49.3    2e-04   
ref|XP_007803962.1|  hypothetical protein EPUS_05214                  49.3    3e-04   
gb|KGO65570.1|  Winged helix-turn-helix transcription repressor D...  49.3    3e-04   
ref|XP_005537086.1|  probable DNA binding protein                     49.3    3e-04   
gb|EKV16065.1|  hypothetical protein PDIP_37990                       49.3    3e-04   
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...  49.3    3e-04   
gb|KGO45349.1|  Winged helix-turn-helix transcription repressor D...  48.9    3e-04   
gb|EYE96511.1|  curved DNA-binding protein                            48.9    3e-04   
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4  48.9    3e-04   
gb|KJB36945.1|  hypothetical protein B456_006G183700                  48.9    3e-04   
ref|XP_003003217.1|  curved DNA-binding protein                       48.9    3e-04   
ref|XP_005705833.1|  DNA binding protein                              48.9    3e-04   
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4  48.9    3e-04   
ref|XP_011119218.1|  hypothetical protein AOL_s00043g430              48.9    3e-04   
ref|XP_009653537.1|  curved DNA-binding protein                       48.9    3e-04   
ref|XP_003051775.1|  predicted protein                                48.9    4e-04   
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...  48.9    4e-04   
ref|XP_002047403.1|  GJ11948                                          48.9    4e-04   
ref|XP_001822375.1|  curved DNA-binding protein                       48.9    4e-04   
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...  48.9    4e-04   
gb|KIN07149.1|  hypothetical protein OIDMADRAFT_22049                 48.9    4e-04   
gb|ACI33868.1|  Proliferation-associated protein 2G4                  48.9    4e-04   
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                48.5    4e-04   
emb|CDQ85755.1|  unnamed protein product                              48.5    4e-04   
gb|KDB17471.1|  curved DNA-binding protein                            48.5    4e-04   
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...  48.5    4e-04   
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4  48.5    4e-04   
ref|XP_006667847.1|  Peptidase M24, structural domain                 48.5    5e-04   
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...  48.5    5e-04   
gb|AAB03665.1|  PrlA                                                  48.5    5e-04   
ref|XP_004031065.1|  hypothetical protein IMG5_148130                 48.5    5e-04   
ref|XP_002568912.1|  Pc21g19210                                       48.5    5e-04   
gb|ACI68772.1|  Proliferation-associated protein 2G4                  48.1    5e-04   
gb|EJK49958.1|  hypothetical protein THAOC_31113                      48.5    5e-04   
ref|XP_004992055.1|  proliferation-associated protein 2G4             48.1    5e-04   
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                48.1    5e-04   
emb|CDQ78322.1|  unnamed protein product                              48.1    6e-04   
ref|XP_001010313.1|  metallopeptidase family M24 containing protein   48.1    6e-04   
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  48.1    6e-04   
gb|EFQ24998.1|  DNA-binding protein                                   48.1    7e-04   
gb|EGD97523.1|  curved DNA-binding protein                            48.1    7e-04   
ref|XP_007928327.1|  hypothetical protein MYCFIDRAFT_204150           48.1    7e-04   
ref|XP_001984453.1|  GH15010                                          47.8    7e-04   
emb|CEJ89289.1|  Putative Curved dna-binding protein                  47.8    7e-04   
gb|KFA55537.1|  hypothetical protein S40293_02069                     48.1    8e-04   
gb|AAH44287.1|  Pa2g4 protein                                         47.8    8e-04   
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...  47.8    8e-04   
ref|XP_313985.4|  AGAP005108-PA                                       47.8    8e-04   
gb|KFA76710.1|  hypothetical protein S40288_08103                     48.1    8e-04   
pdb|4IPA|A  Chain A, Structure Of A Thermophilic Arx1                 47.8    9e-04   
ref|XP_007583994.1|  putative curved dna-binding protein              47.8    9e-04   
ref|XP_006692802.1|  putative curved DNA-binding protein              47.8    9e-04   
gb|EKG17820.1|  hypothetical protein MPH_04952                        47.8    9e-04   
gb|EMF12903.1|  Creatinase/aminopeptidase                             47.8    0.001   
gb|KDO24965.1|  hypothetical protein SPRG_20806                       47.4    0.001   
gb|KDO19442.1|  DNA-binding protein                                   47.4    0.001   
ref|XP_008619458.1|  hypothetical protein SDRG_15074                  47.4    0.001   
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...  47.4    0.001   
gb|EPS32854.1|  hypothetical protein PDE_07815                        47.4    0.001   
ref|XP_001229775.1|  hypothetical protein CHGG_03259                  47.4    0.001   
ref|XP_004355743.1|  proliferation associated protein                 47.4    0.001   
gb|KFY86260.1|  hypothetical protein V498_07565                       47.4    0.001   



>ref|XP_009338145.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Pyrus x bretschneideri]
Length=160

 Score =   103 bits (257),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDEEREEKELDLTSPEVVTKYKSAAEIINKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_004156612.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=395

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIR  59



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIR  59



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDAFIR  58



>ref|XP_008350687.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=199

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP  ++VDICEKGD+FIR
Sbjct  2    MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKTKIVDICEKGDSFIR  59



>ref|XP_007026647.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
 gb|EOY07149.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
Length=286

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIR  58



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSSPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLSSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP A+VVD+CEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPKAKVVDVCEKGDSFIR  58



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVLSECKPKAKIVDICEKGDSFIR  58



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIR  58



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIR  58



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIR  58



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIK  58



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIR  58



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIR  58



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYK+AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKNAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIK  58



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIR  58



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIR  58



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIR  58



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE ELDLSSP+VVTKYKSAAEI+NKAL+LV+SQCKP A++VDICEKGD+FIR
Sbjct  60   SDDEREEMELDLSSPDVVTKYKSAAEIINKALQLVISQCKPKAKIVDICEKGDSFIR  116



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSSPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLSSPEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIK  58



>gb|KJB17056.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17057.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=286

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIR  58



>ref|XP_006381246.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|ERP59043.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=284

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIR  59



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+
Sbjct  41   MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIK  98



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIR  58



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIR  58



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+ER+EKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP+ ++VDICEKGD+FIR
Sbjct  1    MSDDERDEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPDVKIVDICEKGDSFIR  58



>gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S CKP A++VD+CEKGD +IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISGCKPKAKIVDLCEKGDTYIR  58



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CKP +++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKPKSKIVDLCEKGDAFIK  58



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIR
Sbjct  1    MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIR  58



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIR
Sbjct  1    MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIR  58



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKVKIVDLCEKGDAFIK  58



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIR  58



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIR  59



>gb|ACU19222.1| unknown [Glycine max]
Length=219

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIR  58



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  3    SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIR  59



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIR  58



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  1    MSDDEREEKELDLSSSEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSFIR  58



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIR  58



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+E DL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEREFDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIK  58



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIR  58



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IR
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIR  58



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVVS+CKP A++VDICEKGDAFIR
Sbjct  3    SDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIR  59



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIR  58



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+
Sbjct  1    MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPATKIVDLCEKGDAFIK  58



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIR  58



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIR  58



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 57/59 (97%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LVVS+CKP A++VD+CEKGDAFIR
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIR  59



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IR
Sbjct  1    MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIR  58



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIR
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVKECKPKVKIVDICEKGDAFIR  58



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+ERE+KELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IR
Sbjct  1    MSDDEREKKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIR  58



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIR  58



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 57/59 (97%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEE +EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIR
Sbjct  1    MSDEETKEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIR  59



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIR  58



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIR  58



>ref|XP_006843644.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
 gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 57/59 (97%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EE+ELDL+SP+VVTKYK+AAEILNKAL+LVVS+CKP A+VVDICEKGDAFIR
Sbjct  1    MSDDEAKEERELDLTSPDVVTKYKTAAEILNKALQLVVSECKPKAKVVDICEKGDAFIR  59



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIK  58



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIR  58



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIK  58



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIR
Sbjct  1    MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIR  58



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIK  59



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREEKELDL+S +VVTKYKSAAEI+NKAL LVVS+CKP A++VDICEKGDAFIR
Sbjct  3    SDDEREEKELDLTSSDVVTKYKSAAEIINKALHLVVSECKPKAKIVDICEKGDAFIR  59



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV++CKP A++VD+CEKGD FIR
Sbjct  1    MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDLCEKGDNFIR  58



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIK  59



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIK  58



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIK  58



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDE+ EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD +IR
Sbjct  1    MSDEDMEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDVYIR  58



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIK  59



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV +CKP A++VD+CEKGD FIR
Sbjct  1    MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVGECKPKAKIVDLCEKGDNFIR  58



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP A++VDICEKGD++IR
Sbjct  3    SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKAKIVDICEKGDSYIR  59



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLTECKPKAKIVDICEKGDAFIK  59



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+S EVVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIR
Sbjct  3    SDDEREERELDLTSSEVVTKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIR  59



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  48   SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  104



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREE+ELDL+ PEVVTKYKSAA+I+N+AL+LVV++CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEQELDLTYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDICEKGDSYIR  58



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI
Sbjct  3    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFI  58



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 55/59 (93%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E REEKELDL+SP+VVTKYK AAEILNKAL+LVVS+CKP A +VDICEKGDAFI+
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKCAAEILNKALQLVVSECKPKANIVDICEKGDAFIK  59



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 56/59 (95%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LV S+CKP A++VD+CE+GDAFIR
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVTSKCKPKAKIVDLCEQGDAFIR  59



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+SPEVVTK+KSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSPEVVTKHKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIK  59



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 56/59 (95%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E REEKELDL+SP+VVTKYK AAEI+NKAL+LVVS+CKP A++VDICEKGDAFI+
Sbjct  1    MSDDEAREEKELDLTSPDVVTKYKCAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIK  59



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EK+LDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGDAFI+
Sbjct  3    SDDERDEKQLDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDAFIK  59



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+ V+++CKP A++VD+CE GD+FIR
Sbjct  3    SDDEREEKELDLTSPEVVTKYKSAAEIVNKALQRVIAECKPKAKIVDVCEIGDSFIR  59



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSDEEREEKELDL+S EVV KYKSAAEI+N+AL+ V+S+CKP A++VD+CEKGD+FIR
Sbjct  1    MSDEEREEKELDLTSSEVVMKYKSAAEIVNRALQSVLSECKPKAKIVDLCEKGDSFIR  58



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SD+ER++KELDL+SPEVVTKYKSAAEI+NKAL++V++ CKP A++VDICEKGDAFI
Sbjct  3    SDDERDDKELDLTSPEVVTKYKSAAEIVNKALQVVLAICKPGAKIVDICEKGDAFI  58



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIR  58



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +E+ELDL+S +VVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEAKEEELDLTSSDVVTKYKSAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIR  58



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>ref|XP_008656355.1| PREDICTED: proliferation-associated protein A-like [Zea mays]
Length=188

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIR
Sbjct  5    DEVREEKELDLSSNDVVTKYKTAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIR  60



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIK  59



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIK  59



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL LSSPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGD+FI+
Sbjct  3    SDDERDEKELSLSSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIK  59



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEEREE-KELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M+DE REE +ELDLSSPEVVTKYKSAAEI+NKAL+LV+SQCKP  ++VD+CE GDAFIR
Sbjct  1    MADEIREENEELDLSSPEVVTKYKSAAEIVNKALQLVLSQCKPKVKIVDLCEAGDAFIR  59



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIK  59



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIR  58



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP  ++VDICEK D++IR
Sbjct  3    SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKVKIVDICEKADSYIR  59



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIK  59



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+E+EL L+SPEVVTKYK+AAEI+NKAL++V+++CKP A++VDICEKGDAFI+
Sbjct  3    SDDERDEQELSLTSPEVVTKYKTAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIK  59



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+
Sbjct  1    MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIK  59



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+
Sbjct  1    MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIK  59



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGD+FI+
Sbjct  3    SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDSFIK  59



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            SD+ER+EKELDL+S EVVTKYKSAAEI+NKAL++V+++CKP  ++VDICEKGDAFI+
Sbjct  3    SDDERDEKELDLTSSEVVTKYKSAAEIVNKALQVVLAECKPKTKIVDICEKGDAFIK  59



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIR
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIR  60



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIR
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIR  60



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK+AAEILN AL++VVSQCKP  ++VD+CEKGD+FIR
Sbjct  5    DEVREEKELDLSSNDVVTKYKAAAEILNNALKIVVSQCKPKVKIVDLCEKGDSFIR  60



>ref|XP_004148633.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=296

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            SD+E EE ELDLSSP VVTKYK+AAEI+NKAL+LV+SQCKP A++VDICE GD+F
Sbjct  3    SDDESEEMELDLSSPGVVTKYKNAAEIINKALQLVISQCKPKAKIVDICEIGDSF  57



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            DE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI
Sbjct  5    DEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFI  59



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI
Sbjct  3    SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFI  59



>gb|ABR26103.1| proliferation-associated protein 2g4 [Oryza sativa Indica Group]
Length=231

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IR
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIR  60



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI
Sbjct  71   SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFI  127



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = +3

Query  246  SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI
Sbjct  42   SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFI  98



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 14/72 (19%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILN--------------KALELVVSQCKPNARV  380
            MSD+EREEKELDL+SPEVVTKYKSAAEI+N              +AL+LV+S+CKP A++
Sbjct  1    MSDDEREEKELDLTSPEVVTKYKSAAEIVNSIFVVYNLGIGKNEEALQLVLSECKPKAKI  60

Query  381  VDICEKGDAFIR  416
            VD+CEKGD++IR
Sbjct  61   VDLCEKGDSYIR  72



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EE ELDL+S +VVTKYK+A+EI+NKAL+LVVS CKP A++VDICEKGDAFIR
Sbjct  1    MSDDEAKEEIELDLTSSDVVTKYKAASEIVNKALQLVVSGCKPKAKIVDICEKGDAFIR  59



>ref|XP_006602676.1| PREDICTED: proliferation-associated protein A-like isoform X1 
[Glycine max]
Length=98

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 5/58 (9%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+EREEKELDLSS EVVTKYK+ AEI+N     ++S+CKP A++VDICEKGD++IR
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTTAEIVN-----IISECKPKAKIVDICEKGDSYIR  53



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IR
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIR  60



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IR
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIR  60



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IR
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIR  60



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDL+ P+VVTKYK  AEI+NKAL+LV+S+CKP A++ DICEKGDAFI+
Sbjct  1    MSDDEAKEEKELDLTFPDVVTKYKCNAEIVNKALQLVISECKPKAKIADICEKGDAFIK  59



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICE+GD++IR
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICERGDSYIR  60



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 54/59 (92%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDL+S +VVTKYK +AEI NKAL++V+S+CKP A+VVD+CEKGD++IR
Sbjct  1    MSDDEAKEEKELDLTSHDVVTKYKLSAEIANKALQIVLSECKPKAKVVDLCEKGDSYIR  59



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ CKP A++VD+CEKGD+ IR
Sbjct  1    MSDDEVKEEKELDLTSPDVVTKYKCAAEVANKALQAVLADCKPGAKIVDLCEKGDSSIR  59



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            +SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIR
Sbjct  14   TSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDVCEKGDAFIR  58



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            +SPEVVTKYKSAA+I+NKAL+LVVS+CKP A++VD+CEKGDAFIR
Sbjct  14   TSPEVVTKYKSAADIVNKALQLVVSECKPKAKIVDLCEKGDAFIR  58



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +3

Query  282  SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            +SPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGDAFIR
Sbjct  15   TSPEVVTKYKNAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIR  59



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ C P  ++VD+CEKGD+ IR
Sbjct  1    MSDDEMKEEKELDLTSPDVVTKYKCAAEVANKALQAVLAACAPGFKIVDLCEKGDSVIR  59



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEK  398
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEK
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEK  54



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+
Sbjct  1    MSDDESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIK  59



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            DE +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+
Sbjct  4    DESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIK  59



>ref|XP_002772853.1| Curved DNA-binding protein, putative [Perkinsus marinus ATCC 
50983]
 gb|EER04669.1| Curved DNA-binding protein, putative [Perkinsus marinus ATCC 
50983]
Length=221

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V ++C  GD FI
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYITAAGITNKALELVMNAVKPGADVYELCRLGDDFI  57



>ref|XP_002775231.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER07047.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
Length=379

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V D+C  GD FI
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYIAAAGITNKALELVLAAVKPGADVYDLCRLGDDFI  57



>ref|XP_002772849.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER04665.1| proliferation-associated protein 2G4 metalloprotease, putative 
[Perkinsus marinus ATCC 50983]
Length=382

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD E E++  DLS+P+V TKY +AA I NKALELV++  KP A V ++C  GD FI
Sbjct  1    MSDSEYEDEVTDLSNPDVTTKYITAAGITNKALELVMNAVKPGADVYELCRLGDDFI  57



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MSDEE--REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+   + E+E +LS PEVVTKYK+AA+I N+AL+ V+  CK  +++VD+C  GD FI
Sbjct  1    MSDDGSIQGEQEPNLSVPEVVTKYKAAADICNRALQAVIDGCKDGSKIVDLCRTGDNFI  59



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +3

Query  243  MSDEER-EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+   E +E +LS PEVVTKYK+AA+I N+AL  VV   K  A+VVD+C  GD FI 
Sbjct  1    MSDDGSIEHQEPNLSVPEVVTKYKAAADICNRALLAVVEAAKDGAKVVDLCRMGDQFIN  59



>ref|XP_003880798.1| methionine aminopeptidase,related [Neospora caninum Liverpool]
 emb|CBZ50765.1| methionine aminopeptidase,related [Neospora caninum Liverpool]
Length=404

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = +3

Query  243  MSDEEREEKEL----DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            M+D    E E     DLS+P+VVTKY++AA+I+N AL+ V+S C P A V  +C+ GDA+
Sbjct  1    MADATGSEVEAEVVQDLSNPDVVTKYRTAADIVNGALKKVISGCIPGADVYALCKTGDAY  60

Query  411  I  413
            I
Sbjct  61   I  61



>gb|KHN20321.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=165

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            MSD+EREEKELDLSS EVVTKYK+ AEI+NK+ +L++   +    V++I + G+ +
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTTAEIVNKS-KLIIFINEGALPVLNIYQTGNVY  55



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EE+ELDLS+ +VVTKYK+AAEI NKA+   V   K  A+VVD+C  GD  I
Sbjct  3    EEQELDLSNSDVVTKYKAAAEICNKAISAAVEASKDGAKVVDVCRIGDDVI  53



>ref|XP_008887722.1| proliferation-associated protein 2G4, putative [Hammondia hammondi]
 gb|KEP61733.1| proliferation-associated protein 2G4, putative [Hammondia hammondi]
Length=473

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +3

Query  207  IFPLCSL*IRTKMSDEEREEKEL----DLSSPEVVTKYKSAAEILNKALELVVSQCKPNA  374
            + P  +  I   M+D    E E     DLS+P+VVTKY++AA+I+N AL+ V+  C P A
Sbjct  57   LHPTTTSEIGPTMADATGSEVETEVVQDLSNPDVVTKYRTAADIVNGALKKVICGCVPGA  116

Query  375  RVVDICEKGDAFI  413
             V  +C+ GD +I
Sbjct  117  DVYALCKTGDMYI  129



>ref|XP_003062941.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  246  SDEEREEKELD-LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SD +REE+E + L +P VV KYK AAEI NK+L  V++ C P A+VVD C  GD  I
Sbjct  4    SDSDREEREDETLGNPAVVDKYKVAAEIANKSLAAVIAACVPGAKVVDACALGDKSI  60



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            SD E  E E  +S+P+VVTKYK+AA+I+N  L  V+   KP A++VD+C  GD  I
Sbjct  6    SDSESRENE-SISNPDVVTKYKAAAKIVNDTLAAVIDAAKPGAKIVDLCTLGDKLI  60



>ref|XP_007780740.1| methionyl aminopeptidase [Coniosporium apollinis CBS 100218]
 gb|EON65423.1| methionyl aminopeptidase [Coniosporium apollinis CBS 100218]
Length=414

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  + +  L++P+ +TKYK AA+I +KALE V   C   A++VD+CE+GD F+
Sbjct  3    EEAQTDYSLNNPDTLTKYKQAAQISHKALEFVTGLCIEGAKIVDVCERGDKFL  55



>gb|KEQ99626.1| hypothetical protein AUEXF2481DRAFT_35538 [Aureobasidium subglaciale 
EXF-2481]
Length=407

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+  E  E +  L++P+ +TKYK+AA+I  K LE V   C   A++VD+CEKGD  +
Sbjct  1    MASTEAAEIDYSLNNPDTLTKYKTAAQISQKVLEAVTGWCTEGAKIVDVCEKGDQLL  57



>ref|XP_009225656.1| curved DNA-binding protein [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT72682.1| curved DNA-binding protein [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=411

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EEK  D  L++P+ +TKYK+AA+I  K L+ VV+ C P A++VDICEKGD  I
Sbjct  4    EEKVTDYTLNNPDTLTKYKTAAQISEKVLKDVVALCVPGAKIVDICEKGDQLI  56



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSD---EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGD  404
            MSD   +  +E E   ++P VV KYK AAEI NKAL + ++ CKP A++VDIC  GD
Sbjct  1    MSDYGSDAEDETETTCANPAVVDKYKVAAEIANKALAVALAACKPGAKIVDICNLGD  57



>ref|XP_008597452.1| DNA-binding protein [Beauveria bassiana ARSEF 2860]
 gb|EJP66840.1| DNA-binding protein [Beauveria bassiana ARSEF 2860]
Length=408

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EEKE+D  L++P+ +TKYK+A +I  K L LV   C P A++V+IC+KGD  I
Sbjct  3    EEKEIDYTLNNPDTLTKYKTAGQISEKVLALVAELCVPGAKIVEICQKGDKLI  55



>gb|ADX97052.1| proliferation-associated protein 2g4, partial [Perca flavescens]
Length=391

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDEE+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I
Sbjct  1    MSDEEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYI  54



>gb|ERT00738.1| DNA-binding protein, 42 kDa [Sporothrix schenckii ATCC 58251]
Length=424

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E+KE+D  L++P+ +TKYKSAA+I  KAL  V + C   A++VDICEKGD  I
Sbjct  4    EDKEIDYTLNNPDTLTKYKSAAQISEKALAAVSALCVAGAKIVDICEKGDKLI  56



>gb|EPR57248.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
GT1]
 gb|ESS33456.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
VEG]
 gb|KFG29526.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
p89]
 gb|KFG38993.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
 gb|KFG42559.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
FOU]
 gb|KFG58991.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
RUB]
 gb|KFH01579.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
VAND]
 gb|KFH13585.1| putative proliferation-associated protein 2G4 [Toxoplasma gondii 
MAS]
Length=462

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 6/72 (8%)
 Frame = +3

Query  210  FPLCSL*IRTKMSDEEREEKEL----DLSSPEVVTKYKSAAEILNKALELVVSQCKPNAR  377
            FP+ S  I T M+D    E E     DLS+P+VVTKY++AA+I+N AL+ V+  C P A 
Sbjct  49   FPISSD-IAT-MADATGSEVETEVVQDLSNPDVVTKYRTAADIVNGALKKVICGCVPGAD  106

Query  378  VVDICEKGDAFI  413
            V  +C+ GD +I
Sbjct  107  VYALCKTGDTYI  118



>ref|XP_002371979.1| proliferation-associated protein 2G4, putative [Toxoplasma gondii 
ME49]
 gb|EPT27524.1| proliferation-associated protein 2G4, putative [Toxoplasma gondii 
ME49]
Length=462

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +3

Query  243  MSDEEREEKEL----DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            M+D    E E     DLS+P+VVTKY++AA+I+N AL+ V+  C P A V  +C+ GD +
Sbjct  58   MADATGSEVETEVVQDLSNPDVVTKYRTAADIVNGALKKVICGCVPGADVYALCKTGDTY  117

Query  411  I  413
            I
Sbjct  118  I  118



>ref|XP_007253393.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=392

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E++E+ +  DL    VVTKYK + +I N+AL+LV+   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQQEQTIAEDL----VVTKYKMSGDIANQALKLVIEAAKPGVSVLSLCEKGDAYI  55



>ref|XP_004544946.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
Length=424

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +3

Query  240  KMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            KMSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I
Sbjct  33   KMSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYI  87



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 3/60 (5%)
 Frame = +3

Query  243  MSDEER---EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD +    E +ELDLS+ +VVTKYK+AA+I N AL  V+   K  A++VD+C  GD  I
Sbjct  1    MSDYDSDVEEGQELDLSNSDVVTKYKAAADITNNALAAVIKAAKAGAKLVDLCSLGDKSI  60



>ref|XP_010747198.1| PREDICTED: proliferation-associated protein 2G4 [Larimichthys 
crocea]
Length=391

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYI  54



>ref|XP_008294311.1| PREDICTED: proliferation-associated protein 2G4 [Stegastes partitus]
Length=391

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYI  54



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 14/59 (24%)
 Frame = +3

Query  243  MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            MSD+E +EEKE DL SP+VVTKYK AAE+              N ++VD+CEKGD+ IR
Sbjct  1    MSDDEMKEEKEPDLRSPDVVTKYKCAAEV-------------ANTKIVDLCEKGDSLIR  46



>ref|XP_008084685.1| Creatinase/aminopeptidase [Glarea lozoyensis ATCC 20868]
 gb|EHK97136.1| putative Curved DNA-binding protein [Glarea lozoyensis 74030]
 gb|EPE28777.1| Creatinase/aminopeptidase [Glarea lozoyensis ATCC 20868]
Length=409

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +3

Query  243  MSDE-EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+D+ E EE +  L++P+ +TKYKSAA+I  K LE V + C   A+VV+ICEKGD  +
Sbjct  1    MADKKETEEVDYTLNNPDTLTKYKSAAQISQKVLEAVSALCLAGAKVVEICEKGDKLL  58



>ref|XP_002423336.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
 gb|EEB10598.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
Length=389

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+D++ EEK +  DL    VVTKYK A EI+N+ L+ V+ +C+PNA V  ICE GD+ I
Sbjct  1    MADKDVEEKTIAEDL----VVTKYKLAGEIVNRVLKQVIDKCQPNASVRQICESGDSLI  55



>gb|KEQ89790.1| Creatinase/aminopeptidase [Aureobasidium pullulans EXF-150]
Length=402

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I  K LE V   C   A++VD+CEKGD  +
Sbjct  4    ESAEIDYSLNNPDTLTKYKTAAQISQKVLEAVTGWCTEGAKIVDVCEKGDQLL  56



>ref|XP_007238523.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=248

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MS++E++E+ +  DL    VVTKYK  A+I N+AL+ V    KP   V+ +CEKGDAFI
Sbjct  1    MSEDEQQEQTIAEDL----VVTKYKMGADIANRALKAVTEAAKPGVSVLSLCEKGDAFI  55



>gb|KGQ12825.1| Curved DNA-binding protein [Beauveria bassiana D1-5]
Length=414

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 8/59 (14%)
 Frame = +3

Query  261  EEKELD--------LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EEKE+D        L++P+ +TKYK+A +I  K L LV   C P A++V+IC+KGD  I
Sbjct  3    EEKEIDADIDADYTLNNPDTLTKYKTAGQISEKVLALVAELCVPGAKIVEICQKGDKLI  61



>gb|EFA84439.1| proliferation associated protein [Polysphondylium pallidum PN500]
Length=384

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  246  SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            S++E E    DL+SP VVT Y+SAA I NKAL+ V+++C   A +VD+C  GD FI
Sbjct  10   SEDEDENIVEDLTSPWVVTCYQSAALIANKALKEVIAKCVEGAVIVDVCAAGDDFI  65



>ref|XP_007723115.1| methionyl aminopeptidase [Capronia coronata CBS 617.96]
 gb|EXJ90921.1| methionyl aminopeptidase [Capronia coronata CBS 617.96]
Length=419

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            ++S+P+V+TKYK+AA I  K LE V   C P+A++V++C+KGDA +
Sbjct  10   NISNPDVLTKYKTAAGIAQKVLEEVSGWCVPDAKIVELCQKGDALL  55



>ref|XP_009160571.1| methionyl aminopeptidase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY60110.1| methionyl aminopeptidase [Exophiala dermatitidis NIH/UT8656]
Length=423

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            ++S+P+V+TKYK+AA I  K LE V   C P A++V++C+KGDA +
Sbjct  10   NISNPDVLTKYKTAAGIAQKVLEEVSGWCLPGAKIVELCQKGDALL  55



>gb|KIW05574.1| DNA-binding protein, 42 kDa [Verruconis gallopava]
Length=385

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+  E  + +  L++P+ +TKYK AA+I  K LE V   C   A++V+ICEKGDA +
Sbjct  1    MATTEEAQVDYSLNNPDTLTKYKEAAKISQKVLEAVSGWCTEGAKIVEICEKGDALM  57



>ref|NP_001002070.1| proliferation-associated 2G4, a [Danio rerio]
 emb|CAD58759.1| novel protein similar to human proliferation-associated 2G4 protein 
(PA2G4) [Danio rerio]
 gb|AAH71407.1| Proliferation-associated 2G4, a [Danio rerio]
Length=392

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKEL--DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E++E+ +  DL    VVTKYK   +I N+AL  V+   KP   V+ +C+KGDAFI
Sbjct  1    MSDDEQQEQTIAEDL----VVTKYKMGGDIANQALRAVIEAAKPGVSVLSLCQKGDAFI  55



>ref|XP_003441515.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=391

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYI  54



>ref|XP_756019.1| curved DNA-binding protein (42 kDa protein) [Aspergillus fumigatus 
Af293]
 gb|EAL93981.1| curved DNA-binding protein (42 kDa protein) [Aspergillus fumigatus 
Af293]
 gb|EDP55186.1| curved DNA-binding protein (42 kDa protein) [Aspergillus fumigatus 
A1163]
 gb|KEY76599.1| curved DNA binding protein 42 kDa protein [Aspergillus fumigatus 
var. RP-2014]
Length=426

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +3

Query  231  IRTKMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAF  410
            I   M++ +  E +  L++P+ +TKYK+AA+I +K LE V + C   A++V+IC+KGD  
Sbjct  18   IYFTMAENQAPEVDYTLNNPDTLTKYKTAAQISHKVLEAVTALCSEGAKIVEICQKGDEL  77

Query  411  I  413
            +
Sbjct  78   L  78



>ref|XP_005741395.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005944019.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
Length=391

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYI  54



>ref|XP_002182273.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46174.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=406

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            DLSS +V TKY+ AA+I+N AL+ +VSQC P   ++DICE G   I
Sbjct  26   DLSSSDVCTKYQEAAKIVNLALQGLVSQCVPGGTILDICEFGQTII  71



>ref|XP_006807648.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=391

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYI  54



>gb|EFX00371.1| curved DNA-binding protein [Grosmannia clavigera kw1407]
Length=382

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+  E +E +  L++P+ +TKYKSAA+I    L  V   C   A++VDICEKGD  I
Sbjct  1    MAPTEEKEADYSLNNPDTLTKYKSAAQISETVLAAVSELCVAGAKIVDICEKGDVLI  57



>ref|XP_006961234.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR52281.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS06499.1| Creatinase/aminopeptidase [Trichoderma reesei RUT C-30]
Length=411

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E KE+D  L++P+ +TKYK+AA+I  K L  V   C P A++VDIC++GD  I
Sbjct  3    ETKEIDYSLNNPDTLTKYKTAAQISEKVLAAVSDLCVPGAKIVDICQQGDKLI  55



>ref|XP_001538918.1| curved DNA-binding protein 42 kDa protein [Histoplasma capsulatum 
NAm1]
 gb|EDN09356.1| curved DNA-binding protein 42 kDa protein [Histoplasma capsulatum 
NAm1]
Length=462

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  237  TKMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            T  S  E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+V++ICEKGD  +
Sbjct  45   TCFSMAESTEIDYTLNNPDTLTKYKTAAQISHKVLETVTGWCVEGAKVIEICEKGDKLL  103



>gb|EGE81269.1| curved DNA-binding protein [Blastomyces dermatitidis ATCC 18188]
Length=410

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+VV+ICEKGD  +
Sbjct  3    ESTEIDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKVVEICEKGDKLL  55



>emb|CAG06775.1| unnamed protein product [Tetraodon nigroviridis]
Length=391

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E E+    ++   VVTKYK   +I N+AL LVV    P A V+ +CEKGDA+I
Sbjct  1    MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESACPGASVLSLCEKGDAYI  54



>ref|XP_002626628.1| curved DNA-binding protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ76281.1| curved DNA-binding protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ84410.1| curved DNA-binding protein [Blastomyces dermatitidis ER-3]
 gb|EQL36927.1| methionyl aminopeptidase [Blastomyces dermatitidis ATCC 26199]
Length=410

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+VV+ICEKGD  +
Sbjct  3    ESTEIDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKVVEICEKGDKLL  55



>ref|XP_010764812.1| PREDICTED: proliferation-associated protein 2G4 [Notothenia coriiceps]
Length=391

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV    P   V+ +CEKGDA+I
Sbjct  1    MSDDEKEQT---IAEDLVVTKYKMGGDIANQALRLVVETAMPGVSVLSLCEKGDAYI  54



>ref|XP_009041985.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
 gb|EGB03305.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
Length=393

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EE ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+D+C+ GD  I
Sbjct  18   EEVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLDLCKFGDMVI  68



>ref|XP_004085494.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=391

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+ L LV+   KP   V+ +CEKGDA+I
Sbjct  1    MSDDEQEQT---IAEDLVVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYI  54



>gb|KEZ41545.1| hypothetical protein SAPIO_CDS7708 [Scedosporium apiospermum]
Length=410

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            + KE+D  L++P+ +TKYK+AA+I    L  V   C P A++VDICEKGD  I
Sbjct  3    DTKEIDYTLNNPDTLTKYKTAAQISEHVLAAVKELCTPGAKIVDICEKGDKLI  55



>dbj|GAM85687.1| hypothetical protein ANO11243_036950 [fungal sp. No.11243]
Length=416

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+DE  E  +  L++P+ +TKYK+A +I  KALE +   C   A+++DIC++GD  +
Sbjct  1    MADESTE-VDYSLANPDTLTKYKTAGQISQKALETISGWCTEGAKILDICQRGDKLL  56



>gb|EGC43811.1| curved DNA-binding protein [Histoplasma capsulatum H88]
Length=414

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+V++ICEKGD  +
Sbjct  3    ESTEIDYTLNNPDTLTKYKTAAQISHKVLETVTGWCVEGAKVIEICEKGDKLL  55



>gb|EEH04219.1| curved DNA-binding protein [Histoplasma capsulatum G186AR]
Length=414

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+V++ICEKGD  +
Sbjct  3    ESTEIDYTLNNPDTLTKYKTAAQISHKVLETVTGWCVEGAKVIEICEKGDKLL  55



>ref|XP_008318205.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=391

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CE GDA+I
Sbjct  1    MSDDEQEQT---VAEDLVVTKYKMGGDIANQALRLVVGAAKPGLSVLSLCEMGDAYI  54



>gb|ESZ92139.1| curved DNA-binding protein (42 kDa protein) [Sclerotinia borealis 
F-4157]
Length=401

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+D++ E +E+D  L++P+ +TKYK+AA+I  K LE V + C    ++V ICE+GD  +
Sbjct  1    MADKKEENQEIDYSLNNPDTLTKYKNAAQISQKVLEAVTALCVAGEKIVTICEQGDKLL  59



>emb|CBK24689.2| unnamed protein product [Blastocystis hominis]
Length=399

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            DLS+P VV KYK AA+I+NKAL+ V+SQC     V DIC  GD  I
Sbjct  17   DLSNPNVVEKYKVAADIVNKALKGVLSQCVAGKLVSDICSFGDLLI  62



>gb|EHK24663.1| hypothetical protein TRIVIDRAFT_71961 [Trichoderma virens Gv29-8]
Length=411

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E KE+D  L++P+ +TKYK+AA+I  K L  V   C P A++VD+C++GD  I
Sbjct  3    ETKEIDYTLNNPDTLTKYKTAAQISEKVLAAVSELCVPGAKIVDVCQQGDKLI  55



>ref|XP_002141587.1| proliferation-associated protein 2G4 [Cryptosporidium muris RN66]
 gb|EEA07238.1| proliferation-associated protein 2G4, putative [Cryptosporidium 
muris RN66]
Length=383

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EE    LS P+V+TKY + AEILN  L+ ++ +CKP A +  +C+ GD  I
Sbjct  14   EEISGGLSCPDVITKYHTGAEILNSTLQHIIQECKPEADISLLCKTGDMLI  64



>gb|KIH92167.1| methionyl aminopeptidase [Sporothrix brasiliensis 5110]
Length=427

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  279  LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            L++P+ +TKYKSAA+I  KAL  V + C   A++VDICEKGD  I
Sbjct  15   LNNPDTLTKYKSAAQISEKALAAVSALCVAGAKIVDICEKGDKLI  59



>ref|XP_004029906.1| hypothetical protein IMG5_170920 [Ichthyophthirius multifiliis]
 gb|EGR28670.1| hypothetical protein IMG5_170920 [Ichthyophthirius multifiliis]
Length=374

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
            M+    E+KE  L++P V+ KY++A +I N  LE V+ + KP A++++IC+ GD  I+
Sbjct  1    MNSHPEEQKEETLATPGVLDKYQAAGKITNFVLEQVLQKIKPGAKIIEICDFGDKLIQ  58



>ref|XP_007729945.1| methionyl aminopeptidase [Capronia epimyces CBS 606.96]
 gb|EXJ93055.1| methionyl aminopeptidase [Capronia epimyces CBS 606.96]
Length=422

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  276  DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            ++S+P+V+TKYK+A+ I  K LE V   C P A++V++C+KGDA +
Sbjct  10   NISNPDVLTKYKTASGISQKVLEEVSGWCVPGAKIVELCQKGDALL  55



>ref|XP_007822009.1| Peptidase M24, structural domain protein [Metarhizium robertsii 
ARSEF 23]
 gb|EFY98681.1| Peptidase M24, structural domain protein [Metarhizium robertsii 
ARSEF 23]
 gb|KID68497.1| Peptidase M24, structural domain protein, partial [Metarhizium 
anisopliae ARSEF 549]
Length=417

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDE-KDAVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKLL  56



>ref|XP_680568.1| hypothetical protein AN7299.2 [Aspergillus nidulans FGSC A4]
 gb|EAA61350.1| hypothetical protein AN7299.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF78669.1| TPA: curved DNA-binding protein (42 kDa protein) (AFU_orthologue; 
AFUA_2G16820) [Aspergillus nidulans FGSC A4]
Length=403

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M++ + +  E+D  L++P+ +TKYK+AA+I +K LE V +QC   A+++++C++GD  +
Sbjct  1    MAENQTQTPEVDYTLNNPDTLTKYKTAAQISHKVLEAVSAQCVEGAKIIELCQQGDKLL  59



>gb|KFG83101.1| hypothetical protein MANI_006615 [Metarhizium anisopliae]
Length=385

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDE-KDAVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKLL  56



>gb|KID91064.1| Peptidase M24, structural domain protein [Metarhizium guizhouense 
ARSEF 977]
Length=416

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDE-KDAVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKLL  56



>gb|EHK47914.1| hypothetical protein TRIATDRAFT_298169 [Trichoderma atroviride 
IMI 206040]
Length=407

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E KE+D  L++P+ +TKYK+AA+I  K L  V   C P A++VDIC++GD  +
Sbjct  3    ETKEVDYSLNNPDTLTKYKTAAQISEKVLAAVSELCVPGAKIVDICQQGDKLL  55



>gb|KID80031.1| Peptidase M24, structural domain protein, partial [Metarhizium 
brunneum ARSEF 3297]
Length=417

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDE-KDAVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKLL  56



>ref|XP_007275522.1| curved dna-binding protein (42 kda protein) [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA35376.1| curved dna-binding protein (42 kda protein) [Colletotrichum gloeosporioides 
Nara gc5]
 gb|EQB46946.1| hypothetical protein CGLO_13973 [Colletotrichum gloeosporioides 
Cg-14]
Length=414

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE    KE+D  L++P+ +TKYK+AA+I  K L  V   C P  ++V ICEKGD  I
Sbjct  1    MSDE----KEIDYTLNNPDTLTKYKTAAQISEKVLAAVAELCVPGEKIVTICEKGDKLI  55



>emb|CBJ31951.1| conserved unknown protein [Ectocarpus siliculosus]
Length=401

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  249  DEEREEKEL-DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            +E +E  E+ DLS+ +V TKY+ A++I N AL+ VV QC  NARV D+C+ GD  I
Sbjct  16   EETKEAAEVTDLSNSDVTTKYQEASKIANLALQGVVQQCVANARVNDLCKFGDTVI  71



>gb|KFX45625.1| Curved DNA-binding protein, partial [Talaromyces marneffei PM1]
Length=433

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +3

Query  204  CIF-PLCSL*IRTKMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARV  380
            CIF P  SL  RT   +  R  ++  L++P+ +TKYK+AA+I +K LE V   C   ++V
Sbjct  6    CIFLPAYSLRERTSRRNG-RVHRDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVDGSKV  64

Query  381  VDICEKGDAFI  413
            +++C+KGD  +
Sbjct  65   LELCQKGDQLL  75



>gb|KEQ71987.1| curved DNA-binding protein-like protein [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=408

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  EKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E +  L++P+ +TKYK+AA+I  K LE V   C   A++V+ICEKGD  +
Sbjct  9    EIDYSLNNPDTLTKYKTAAQISQKVLEAVTGWCTEGAKIVEICEKGDKLL  58



>dbj|GAD91806.1| curved DNA-binding protein [Byssochlamys spectabilis No. 5]
Length=415

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M++ +  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++C+KGD  +
Sbjct  1    MAETQAPEVDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCLEGAKIVELCQKGDQLL  57



>ref|XP_003973252.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=391

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+E E+    ++   VVTKYK   +I N+AL LVV      A V+ +CEKGDA+I
Sbjct  1    MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESASSGASVLGLCEKGDAYI  54



>emb|CCE30910.1| related to 442K curved dna-binding protein [Claviceps purpurea 
20.1]
Length=417

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE +E  +  L++P+ +TKYK+A +I  K L  V   C P A++V+IC+KGD  +
Sbjct  7    MSDE-KETVDYSLNNPDTLTKYKTAGQISEKVLAEVAKLCVPGAKIVEICQKGDKIM  62



>ref|XP_001261149.1| curved DNA-binding protein (42 kDa protein) [Neosartorya fischeri 
NRRL 181]
 gb|EAW19252.1| curved DNA-binding protein (42 kDa protein) [Neosartorya fischeri 
NRRL 181]
Length=405

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M++ +  E +  L++P+ +TKYK+AA+I +K LE V + C   +++V+IC+KGD  +
Sbjct  1    MAENQAPEVDYTLNNPDTLTKYKTAAQISHKVLEAVTALCLEGSKIVEICQKGDELL  57



>gb|KEQ67804.1| curved DNA-binding protein [Aureobasidium melanogenum CBS 110374]
Length=407

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  EKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E +  L++P+ +TKYK+AA+I  K LE V   C   A++V++CEKGD  +
Sbjct  9    EIDYSLNNPDTLTKYKTAAQISQKVLEAVTGWCTEGAKIVEVCEKGDQLL  58



>ref|XP_002791404.1| curved DNA-binding protein 42 kDa protein [Paracoccidioides sp. 
'lutzii' Pb01]
 gb|EEH35527.1| curved DNA-binding protein 42 kDa protein [Paracoccidioides sp. 
'lutzii' Pb01]
Length=419

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  264  EKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E +  L++P+ +TKYK+AA+I +K LE V   C   A++V+ICEKGD  +
Sbjct  7    EIDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKIVEICEKGDKLL  56



>gb|KIE03023.1| Peptidase M24, structural domain protein, partial [Metarhizium 
majus ARSEF 297]
Length=417

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDE-KDVVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKLL  56



>ref|XP_003717269.1| curved DNA-binding protein [Magnaporthe oryzae 70-15]
 gb|EHA50950.1| curved DNA-binding protein [Magnaporthe oryzae 70-15]
Length=413

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E+KE+D  L++P+ +TKYK+AA+I  K L+ V + C   A++V+ICEKGD  I
Sbjct  4    EDKEIDYTLNNPDTLTKYKTAAQISEKVLKDVSALCVAGAKIVEICEKGDQLI  56



>ref|XP_001275960.1| curved DNA-binding protein (42 kDa protein) [Aspergillus clavatus 
NRRL 1]
 gb|EAW14534.1| curved DNA-binding protein (42 kDa protein) [Aspergillus clavatus 
NRRL 1]
Length=408

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M++ +  E +  L++P+ +TKYK+AA+I +K LE V   C   +++V++C+KGD  +
Sbjct  1    MTETQAPEVDYTLNNPDTLTKYKTAAQISHKVLEAVAGWCVEGSKIVELCQKGDQLL  57



>gb|KIL90871.1| methionyl aminopeptidase [Fusarium avenaceum]
Length=406

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MS E +E  +  L++P+ +TKYK+AA+I  K L  V     P A++VDIC++GD  +
Sbjct  1    MSSENKEVIDYSLANPDTLTKYKTAAQISEKVLAEVSKLVVPGAKIVDICQQGDKLL  57



>ref|XP_003655248.1| hypothetical protein THITE_2118722 [Thielavia terrestris NRRL 
8126]
 gb|AEO68912.1| hypothetical protein THITE_2118722 [Thielavia terrestris NRRL 
8126]
Length=421

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  279  LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            L++P+ +TKYK+AA+I  K L  V   C P +++VDICEKGD  I
Sbjct  12   LNNPDTLTKYKTAAQISEKVLAEVSKLCVPGSKIVDICEKGDKLI  56



>ref|XP_003023402.1| hypothetical protein TRV_02504 [Trichophyton verrucosum HKI 0517]
 gb|EFE42784.1| hypothetical protein TRV_02504 [Trichophyton verrucosum HKI 0517]
Length=412

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>ref|XP_007809491.1| hypothetical protein MAC_03151 [Metarhizium acridum CQMa 102]
 gb|EFY90788.1| hypothetical protein MAC_03151 [Metarhizium acridum CQMa 102]
Length=426

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSDE ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC++GD  +
Sbjct  1    MSDE-KDAIDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQRGDKLL  56



>ref|XP_001134549.1| proliferation associated protein [Dictyostelium discoideum AX4]
 sp|Q1ZXG4.1|PRLA_DICDI RecName: Full=Proliferation-associated protein A [Dictyostelium 
discoideum]
 gb|EAS66866.1| proliferation associated protein [Dictyostelium discoideum AX4]
Length=385

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 6/63 (10%)
 Frame = +3

Query  243  MSDEEREEKEL------DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGD  404
            MS++++E KE       DLS+P VV  Y +A  I N A++ V+S+C   A VVDIC+ GD
Sbjct  1    MSNKDQEIKEEAPVAIEDLSNPVVVDSYNAAGIIANNAIKHVISKCVVGALVVDICQYGD  60

Query  405  AFI  413
             FI
Sbjct  61   DFI  63



>ref|XP_003010574.1| hypothetical protein ARB_03275 [Arthroderma benhamiae CBS 112371]
 gb|EFE29934.1| hypothetical protein ARB_03275 [Arthroderma benhamiae CBS 112371]
Length=433

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>gb|EZF36166.1| DNA-binding protein, 42 kDa [Trichophyton interdigitale H6]
Length=412

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>gb|EZF23298.1| DNA-binding protein, 42 kDa [Trichophyton rubrum MR850]
 gb|EZF42269.1| DNA-binding protein, 42 kDa [Trichophyton rubrum CBS 100081]
 gb|EZF52933.1| DNA-binding protein, 42 kDa [Trichophyton rubrum CBS 288.86]
 gb|EZF63573.1| DNA-binding protein, 42 kDa [Trichophyton rubrum CBS 289.86]
 gb|EZF84840.1| DNA-binding protein, 42 kDa [Trichophyton rubrum MR1448]
 gb|EZF95601.1| DNA-binding protein, 42 kDa [Trichophyton rubrum MR1459]
 gb|EZG17145.1| DNA-binding protein, 42 kDa [Trichophyton rubrum CBS 202.88]
 gb|KDB34077.1| DNA-binding protein, 42 kDa [Trichophyton rubrum D6]
Length=411

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>gb|EZG06696.1| DNA-binding protein, 42 kDa [Trichophyton rubrum CBS 735.88]
Length=412

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>gb|ENH80985.1| curved DNA-binding protein [Colletotrichum orbiculare MAFF 240422]
Length=412

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+    KE+D  L++P+ +TKYK+AA+I  K L  V   C P  ++V ICEKGD  I
Sbjct  1    MSDD----KEIDYTLNNPDTLTKYKTAAQISEKVLAAVAELCVPGEKIVTICEKGDKLI  55



>ref|XP_007910879.1| putative curved dna-binding protein [Togninia minima UCRPA7]
 gb|EOO04397.1| putative curved dna-binding protein [Togninia minima UCRPA7]
Length=415

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  261  EEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            EEKE+D  L++P+ +TKYK+AA+I  K L  V   C   A++V ICEKGD  I
Sbjct  4    EEKEIDYSLANPDTLTKYKTAAQISEKVLAAVKELCVAGAKIVTICEKGDKLI  56



>gb|EZF74346.1| DNA-binding protein, 42 kDa [Trichophyton soudanense CBS 452.61]
Length=412

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  55



>ref|XP_969584.1| PREDICTED: proliferation-associated protein 2G4 [Tribolium castaneum]
 gb|EFA11745.1| hypothetical protein TcasGA2_TC004235 [Tribolium castaneum]
Length=386

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+DE+  EK   +S   VVTKYK A EI+N+ L+ V+ +CKP + V +ICE GD  I
Sbjct  1    MADEKNVEK--TISEDLVVTKYKMAGEIVNRILKQVLEKCKPGSSVREICEFGDQLI  55



>ref|XP_003851977.1| peptidase M24 [Zymoseptoria tritici IPO323]
 gb|EGP86953.1| peptidase M24 [Zymoseptoria tritici IPO323]
Length=423

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+  +    +  L++P+ +TKYK+AA I  K LE V   C   A++VDIC++GD  +
Sbjct  1    MAATQEAPVDYSLANPDTLTKYKTAATISQKVLETVSGWCTDGAKIVDICQRGDKLL  57



>ref|XP_001744838.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90071.1| predicted protein [Monosiga brevicollis MX1]
Length=397

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDA  407
            M+    EE+   L   +VVTKYK  AE+LN+AL+ V S C   A V+++CE GDA
Sbjct  1    MAAAYEEERAPGLEEADVVTKYKMGAEMLNRALQHVASLCVEGASVLELCEAGDA  55



>gb|KHN95092.1| Peptidase M24, structural domain protein [Metarhizium album ARSEF 
1941]
Length=416

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD+ ++  +  L++P+ +TKYK+A +I  K L  V   C P A++VDIC+KGD  +
Sbjct  1    MSDD-KDAVDYSLNNPDTLTKYKTAGQISEKVLAEVSKLCVPGAKIVDICQKGDKIL  56



>ref|XP_003170517.1| curved DNA-binding protein [Microsporum gypseum CBS 118893]
 gb|EFR04754.1| curved DNA-binding protein [Microsporum gypseum CBS 118893]
Length=413

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +3

Query  252  EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E   E +  L++P+ +TKYK+AA+I +K LE V   C   A++V++CEKGD  +
Sbjct  3    ETTTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIVELCEKGDKLL  56



>gb|EME42273.1| hypothetical protein DOTSEDRAFT_73192 [Dothistroma septosporum 
NZE10]
Length=421

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+DE  ++    L++P+ +TKYK+AA+I  K LE V   C   A++V++C+KGD  +
Sbjct  1    MTDEAVQD--YSLANPDTLTKYKTAAQISQKVLETVSGWCTEGAKIVELCQKGDKLL  55



>ref|XP_002848380.1| curved DNA-binding protein [Arthroderma otae CBS 113480]
 gb|EEQ31067.1| curved DNA-binding protein [Arthroderma otae CBS 113480]
Length=419

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+++++CEKGD  +
Sbjct  3    ENTEIDYTLNNPDTLTKYKTAAQISHKVLEAVSGWCVEGAKIIELCEKGDKML  55



>ref|XP_001402244.1| curved DNA-binding protein [Aspergillus niger CBS 513.88]
 emb|CAK38973.1| unnamed protein product [Aspergillus niger]
 gb|EHA20266.1| hypothetical protein ASPNIDRAFT_57446 [Aspergillus niger ATCC 
1015]
Length=406

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M++ +  E +  L++P+ +TKYK+AA+I  K LE V   C   +++V++C+KGD  +
Sbjct  1    MAETQAPEVDYTLNNPDTLTKYKTAAQISQKVLEAVAGWCVEGSKIVELCQKGDQLL  57



>ref|XP_002584182.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP80029.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=405

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+++++CEKGD  +
Sbjct  3    ESTEIDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKILELCEKGDKLL  55



>ref|XP_008718377.1| DNA-binding protein, 42 kDa [Cyphellophora europaea CBS 101466]
 gb|ETN39592.1| DNA-binding protein, 42 kDa [Cyphellophora europaea CBS 101466]
Length=411

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  LS+P+ +TKYK+AA I +K LE V S     A++V++CEKGD  +
Sbjct  3    EAAEADYSLSNPDTLTKYKTAAGISHKVLETVSSWLADGAKIVELCEKGDKLL  55



>gb|ELT89178.1| hypothetical protein CAPTEDRAFT_136142, partial [Capitella teleta]
Length=142

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E +EL +S   VVTKY +AA+I N A+ ++       ++V+D+CEKGD FI
Sbjct  6    ETEELTISDDSVVTKYNTAAKIANDAVAMLQKLTVAGSKVIDLCEKGDNFI  56



>ref|XP_003741970.1| PREDICTED: proliferation-associated protein 2G4-like [Metaseiulus 
occidentalis]
Length=381

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MS+   EE+   + +  VVTKYK+A EI+N+ L  VV  CK  A V+DICE GD  +
Sbjct  1    MSEMHEEEQTCRIDA--VVTKYKTAGEIVNRTLAKVVEMCKAGAVVLDICEAGDKML  55



>gb|EAS28237.3| DNA-binding protein, 42 kDa [Coccidioides immitis RS]
Length=414

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+++++CEKGD  +
Sbjct  3    ESAEVDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKILELCEKGDKLL  55



>ref|XP_001239820.1| hypothetical protein CIMG_09441 [Coccidioides immitis RS]
Length=405

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+++++CEKGD  +
Sbjct  3    ESAEVDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKILELCEKGDKLL  55



>ref|XP_003067352.1| curved DNA-binding protein, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER25207.1| curved DNA-binding protein, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW19615.1| curved DNA-binding protein [Coccidioides posadasii str. Silveira]
Length=414

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  255  EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E  E +  L++P+ +TKYK+AA+I +K LE V   C   A+++++CEKGD  +
Sbjct  3    ESAEVDYTLNNPDTLTKYKTAAQISHKVLEAVTGWCVEGAKILELCEKGDKLL  55



>emb|CDQ74715.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    VV++CEKGDA I
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEAAKSGVSVVNLCEKGDAHI  55



>ref|NP_997806.1| proliferation-associated 2G4-like [Danio rerio]
 gb|AAH56591.1| Proliferation-associated 2G4 ,b [Danio rerio]
 gb|AAH71536.1| Proliferation-associated 2G4 ,b [Danio rerio]
Length=394

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            +++E  ++   VVTKYK  A+I N AL+ V+   KP   V+ +CEKGDAFI
Sbjct  6    DQQEQTIADDLVVTKYKMGADIANLALKTVIEAAKPGVSVLSLCEKGDAFI  56



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  333  KALELVVSQCKPNARVVDICEKGDAFIR  416
            KAL+LVVS+CKP A++VDICEKGD FI+
Sbjct  7    KALQLVVSECKPKAKIVDICEKGDTFIK  34



>ref|XP_009039553.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
 gb|EGB05714.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
Length=395

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  261  EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            E+ ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+++C+ GD  I
Sbjct  18   EDVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLELCKFGDMVI  68



>ref|XP_001585439.1| hypothetical protein SS1G_13678 [Sclerotinia sclerotiorum 1980]
 gb|EDN98819.1| hypothetical protein SS1G_13678 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=401

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+D++ E +E+D  L++P+ +TKYK+AA I  K L+ V + C    ++V ICEKGD  +
Sbjct  1    MADKKEETQEIDYSLNNPDTLTKYKNAATISQKVLKDVTALCVAGEKIVTICEKGDKLL  59



>emb|CDQ89185.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 2/57 (4%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            MSD   EE+E  ++   VVTKYK   +I N+AL +V+ + K    V+ +CEKGDA I
Sbjct  1    MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRMVIEEAKSGVSVLSLCEKGDAHI  55



>emb|CCD54680.1| similar to curved DNA-binding protein [Botrytis cinerea T4]
 gb|EMR90380.1| putative curved dna-binding protein [Botrytis cinerea BcDW1]
Length=401

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 2/59 (3%)
 Frame = +3

Query  243  MSDEEREEKELD--LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
            M+D++ E +E+D  L++P+ +TKYK+AA I  K L+ V + C    ++V ICEKGD  +
Sbjct  1    MADKKEEPQEIDYSLNNPDTLTKYKNAATISQKVLKDVTALCVAGEKIVTICEKGDKLL  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700