BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030L20

Length=185
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04035.1|  unnamed protein product                              79.0    3e-15   Coffea canephora [robusta coffee]
ref|XP_008358916.1|  PREDICTED: root phototropism protein 2-like      75.1    6e-15   
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2           78.2    6e-15   Solanum lycopersicum
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like      78.2    6e-15   Solanum tuberosum [potatoes]
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2           76.3    2e-14   Nicotiana tomentosiformis
gb|KHG08105.1|  Root phototropism 2 -like protein                     75.5    4e-14   Gossypium arboreum [tree cotton]
gb|KJB26284.1|  hypothetical protein B456_004G235100                  75.5    4e-14   Gossypium raimondii
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2           75.1    6e-14   Nicotiana sylvestris
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like      74.7    8e-14   
gb|ADL36608.1|  BZIP domain class transcription factor                74.7    8e-14   Malus domestica [apple tree]
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...  74.7    9e-14   
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like      74.7    9e-14   Pyrus x bretschneideri [bai li]
ref|XP_010094443.1|  Root phototropism protein 2                      73.2    3e-13   Morus notabilis
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like      72.4    6e-13   Pyrus x bretschneideri [bai li]
ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like      72.4    6e-13   Sesamum indicum [beniseed]
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2           72.0    8e-13   Fragaria vesca subsp. vesca
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...  72.0    9e-13   Vitis vinifera
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2           71.6    1e-12   Eucalyptus grandis [rose gum]
gb|KDP45678.1|  hypothetical protein JCGZ_17285                       71.6    1e-12   Jatropha curcas
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g           71.2    1e-12   Phaseolus vulgaris [French bean]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like      70.9    2e-12   Glycine max [soybeans]
ref|NP_001280895.1|  root phototropism protein 2-like                 70.9    2e-12   Malus domestica [apple tree]
ref|NP_001280845.1|  root phototropism protein 2-like                 70.9    2e-12   Malus domestica [apple tree]
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...  70.9    2e-12   Prunus mume [ume]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg           70.9    2e-12   Prunus persica
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...  70.9    2e-12   Prunus mume [ume]
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like      70.5    2e-12   Cicer arietinum [garbanzo]
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g           70.5    3e-12   Phaseolus vulgaris [French bean]
gb|KHN18647.1|  Root phototropism protein 2                           68.6    4e-12   Glycine soja [wild soybean]
ref|XP_003600550.1|  Root phototropism protein                        69.7    5e-12   Medicago truncatula
gb|AFK45576.1|  unknown                                               69.3    5e-12   Medicago truncatula
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2           69.3    7e-12   Nelumbo nucifera [Indian lotus]
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg              69.3    7e-12   Erythranthe guttata [common monkey flower]
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250        69.3    8e-12   Amborella trichopoda
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein       68.9    1e-11   
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like      68.9    1e-11   Glycine max [soybeans]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein               68.6    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like      67.4    4e-11   Glycine max [soybeans]
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2           67.0    5e-11   Sesamum indicum [beniseed]
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein               66.6    6e-11   
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                 65.9    1e-10   Citrus sinensis [apfelsine]
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg           65.9    1e-10   Citrus clementina [clementine]
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like      65.9    1e-10   Populus euphratica
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like      65.5    1e-10   Populus euphratica
emb|CBI15801.3|  unnamed protein product                              62.8    1e-10   Vitis vinifera
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2           65.5    2e-10   
ref|XP_003616056.1|  Root phototropism protein                        65.5    2e-10   Medicago truncatula
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like      65.5    2e-10   Cucumis sativus [cucumbers]
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...  65.1    2e-10   Cucumis melo [Oriental melon]
gb|AAB63085.1|  unknown protein                                       62.0    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...  64.7    3e-10   
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like      63.5    8e-10   Populus euphratica
ref|XP_006410156.1|  hypothetical protein EUTSA_v10016728mg           62.8    1e-09   
emb|CDY23992.1|  BnaC03g16990D                                        63.2    1e-09   Brassica napus [oilseed rape]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like      62.8    1e-09   Cicer arietinum [garbanzo]
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2           62.8    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg           62.8    2e-09   Capsella rubella
gb|KFK22949.1|  root phototropism protein 2                           62.4    2e-09   Arabis alpina [alpine rockcress]
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like      62.0    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...  62.0    2e-09   
dbj|BAJ33924.1|  unnamed protein product                              62.0    3e-09   Eutrema halophilum
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like      62.0    3e-09   Camelina sativa [gold-of-pleasure]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                     62.0    3e-09   
emb|CDY02075.1|  BnaC04g14260D                                        61.6    3e-09   
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2           61.6    3e-09   Brassica rapa
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966           61.6    4e-09   
emb|CDY10743.1|  BnaA05g11930D                                        61.6    4e-09   Brassica napus [oilseed rape]
dbj|BAF01791.1|  hypothetical protein                                 61.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                         61.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02185.1|  hypothetical protein                                 61.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AAF33112.1|AF181683_1  RPT2                                        61.2    6e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73802.1|  hypothetical protein M569_00954                       59.3    2e-08   Genlisea aurea
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2           58.5    5e-08   Tarenaya hassleriana [spider flower]
gb|ABI34691.1|  bZIP transcription factor bZIP84                      53.5    3e-07   Glycine max [soybeans]
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...  54.7    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN61975.1|  hypothetical protein Csa_2G277660                     53.5    1e-06   
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like      53.9    2e-06   Brassica rapa
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...  53.9    2e-06   
emb|CDX84827.1|  BnaA03g14030D                                        53.5    2e-06   
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    2e-06   Cucumis melo [Oriental melon]
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    2e-06   
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    2e-06   
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    3e-06   Glycine max [soybeans]
gb|KHN36285.1|  BTB/POZ domain-containing protein                     53.1    3e-06   Glycine soja [wild soybean]
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...  53.1    3e-06   Glycine max [soybeans]
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein       52.4    6e-06   
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    9e-06   Cicer arietinum [garbanzo]
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    1e-05   Cicer arietinum [garbanzo]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like      51.6    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g           51.2    1e-05   Phaseolus vulgaris [French bean]
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...  51.2    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like      50.8    2e-05   Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                   50.8    2e-05   Eucalyptus grandis [rose gum]
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...  50.8    2e-05   Vitis vinifera
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    3e-05   Fragaria vesca subsp. vesca
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    3e-05   Glycine max [soybeans]
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980           50.4    3e-05   Selaginella moellendorffii
ref|XP_002988267.1|  hypothetical protein SELMODRAFT_447227           50.4    3e-05   Selaginella moellendorffii
gb|KHG27515.1|  hypothetical protein F383_13864                       50.1    3e-05   Gossypium arboreum [tree cotton]
emb|CAN71562.1|  hypothetical protein VITISV_007563                   50.1    4e-05   Vitis vinifera
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2           50.1    4e-05   Phoenix dactylifera
emb|CDY30615.1|  BnaAnng03900D                                        49.7    4e-05   Brassica napus [oilseed rape]
emb|CDY57361.1|  BnaC08g48680D                                        49.7    4e-05   Brassica napus [oilseed rape]
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...  49.7    5e-05   Nelumbo nucifera [Indian lotus]
emb|CBI33715.3|  unnamed protein product                              49.3    6e-05   Vitis vinifera
gb|KJB48677.1|  hypothetical protein B456_008G080700                  49.3    8e-05   Gossypium raimondii
ref|XP_010086959.1|  BTB/POZ domain-containing protein                48.9    8e-05   
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    8e-05   Brassica rapa
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    9e-05   Brassica rapa
gb|KJB48680.1|  hypothetical protein B456_008G080700                  48.9    9e-05   Gossypium raimondii
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    9e-05   Populus euphratica
ref|XP_002877714.1|  predicted protein                                48.9    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    1e-04   Populus euphratica
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                 48.9    1e-04   Citrus sinensis [apfelsine]
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...  48.9    1e-04   Citrus sinensis [apfelsine]
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg           48.9    1e-04   Citrus clementina [clementine]
gb|KDO78973.1|  hypothetical protein CISIN_1g006971mg                 48.5    1e-04   Citrus sinensis [apfelsine]
gb|EPS72379.1|  hypothetical protein M569_02379                       48.1    1e-04   Genlisea aurea
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...  48.1    1e-04   
emb|CDP02580.1|  unnamed protein product                              48.1    2e-04   Coffea canephora [robusta coffee]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600        48.1    2e-04   Amborella trichopoda
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...  47.4    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...  47.4    3e-04   
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg           47.4    3e-04   Prunus persica
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g           47.4    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_003597110.1|  Root phototropism protein                        47.4    3e-04   
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg              47.4    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...  47.0    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...  47.0    5e-04   Sesamum indicum [beniseed]
ref|XP_002533158.1|  Root phototropism protein, putative              46.6    5e-04   Ricinus communis
gb|KJB26282.1|  hypothetical protein B456_004G235100                  46.2    6e-04   Gossypium raimondii
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...  46.6    6e-04   
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg           46.2    7e-04   Eutrema salsugineum [saltwater cress]
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529           46.2    8e-04   
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843           46.2    8e-04   Selaginella moellendorffii
gb|KJB43880.1|  hypothetical protein B456_007G221600                  46.2    8e-04   Gossypium raimondii
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...  46.2    8e-04   Pyrus x bretschneideri [bai li]
gb|KJB43881.1|  hypothetical protein B456_007G221600                  45.8    9e-04   Gossypium raimondii
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...  45.8    0.001   Nicotiana sylvestris
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...  45.8    0.001   Nicotiana tomentosiformis
ref|XP_008352542.1|  PREDICTED: BTB/POZ domain-containing protein...  45.8    0.001   
gb|KDP32052.1|  hypothetical protein JCGZ_12513                       45.8    0.001   Jatropha curcas



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + ++RLSLA ERTGQWVFS  IPTDV+VEVG+A+FSLH FML
Sbjct  1    MASPLVNNSSRLSLAMERTGQWVFSQEIPTDVLVEVGKATFSLHKFML  48



>ref|XP_008358916.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=175

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + + RLSLA ERTGQW+FS  IP+DV+V+VGEA+FSLH FML
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFML  47



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PLK+   RLSLA ERTGQWVFS  IPTDVIVEVGEA+F+LH FML
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFML  47



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PLK+   RLSLA ERTGQWVFS  IPTDVIVEVGEA+F+LH FML
Sbjct  1    MATPLKNT-NRLSLAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFML  47



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P+K+   RLSLA ERTGQWVFS  IPTDV+VEVGEA+F+LH FML
Sbjct  1    MAAPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFML  47



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PL+S  +RLS A ERTGQWVFS  IPTDVIVEVGEA+F+LH FML
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFML  47



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PL+S  +RLS A ERTGQWVFS  IPTDVIVEVGEA+F+LH FML
Sbjct  1    MATPLRSN-SRLSTAMERTGQWVFSQEIPTDVIVEVGEANFNLHKFML  47



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA P+K+   RLSLA ERTGQWVFS  IPTDV+VEVGEA+F+LH FML
Sbjct  1    MAVPIKNT-NRLSLAMERTGQWVFSQEIPTDVVVEVGEANFNLHKFML  47



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + + RLSLA ERTGQW+FS  IP+DV+V+VGEA+FSLH FML
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFML  47



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + + RLSLA ERTGQW+FS  IP+DV+V+VGEA+FSLH FML
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFML  47



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + + RLSLA ERTGQW+FS  IP+DV+V+VGEA+FSLH FML
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFML  47



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL + + RLSLA ERTGQW+FS  IP+DV+V+VGEA+FSLH FML
Sbjct  1    MASPL-NGSNRLSLAMERTGQWIFSQDIPSDVVVQVGEANFSLHKFML  47



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+ +K   +RLSLA ERTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  1    MAASVK-GNSRLSLAMERTGQWVFSQDIPTDVVVEVGEANFSLHKFML  47



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASPL S   RLSLA ERTGQW+ S  IP+DV+VEVGEA+F LH FML
Sbjct  1    MASPL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFPLHKFML  47



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  65   ATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            A RLSLA ERTGQWVFS  IPTDVIVEVGEA+FSLH FML
Sbjct  2    ANRLSLAMERTGQWVFSQEIPTDVIVEVGEANFSLHKFML  41



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS  ++ + RLS+A ERTGQW+FS  IP DV+VEVGEA+FSLH FML
Sbjct  1    MASLAQNNSRRLSIAMERTGQWIFSQDIPADVVVEVGEANFSLHKFML  48



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+ LK    R SLA ERTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  1    MAASLK-GNNRRSLAMERTGQWVFSQEIPTDVVVEVGEANFSLHKFML  47



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P++ A  RLS+A ERTGQWVFS  IPTDV+V VGEA+FSLH FML
Sbjct  1    MATPVR-ANERLSIAMERTGQWVFSQEIPTDVVVRVGEANFSLHKFML  47



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PL++  +RLS+A ERTGQWVFS  IPTDV+V VGEA+FSLH FML
Sbjct  1    MATPLRNN-SRLSIAMERTGQWVFSQEIPTDVVVVVGEANFSLHKFML  47



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 37/48 (77%), Gaps = 4/48 (8%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P      RLSLA ERTGQWVFS  IPTDVIVEVGE SFSLH FML
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETSFSLHKFML  44



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/52 (71%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = +2

Query  38   NMASPLKSAAT---RLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            N   P K  AT   RLSLA ERTGQWVFS  IPTDVIVEVGE +FSLH FML
Sbjct  27   NQNKPHKFMATPNNRLSLAMERTGQWVFSQDIPTDVIVEVGETTFSLHKFML  78



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS L S   RLSLA ERTGQW+ S  IP+DV+VEVGEA+FSLH FML
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFML  47



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS L S   RLSLA ERTGQW+ S  IP+DV+VEVGEA+FSLH FML
Sbjct  1    MASSL-SGGNRLSLAMERTGQWIISQDIPSDVVVEVGEANFSLHKFML  47



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS +K   +RLS+A ERTGQW+FS  IP+DV+VEVGEA+FSLH FML
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFML  47



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS +K   +RLS+A ERTGQW+FS  IP+DV+VEVGEA+FSLH FML
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFML  47



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS +K   +RLS+A ERTGQW+FS  IP+DV+VEVGEA+FSLH FML
Sbjct  1    MASSVK-GNSRLSIAMERTGQWIFSQEIPSDVMVEVGEANFSLHKFML  47



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 4/48 (8%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P      RLSLA ERTGQW+FS  IPTDVIVEVGEA FSLH FML
Sbjct  1    MATP----PNRLSLAMERTGQWIFSQEIPTDVIVEVGEACFSLHKFML  44



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P   + TRLSLA ERTGQW+FS  IPTDVIV VGEA+FSLH F+L
Sbjct  1    MATP---SPTRLSLAMERTGQWIFSPEIPTDVIVAVGEANFSLHKFIL  45



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P      RLSLA ERTGQWVFS  IPTDVIVEVGE  FSLH FML
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFML  44



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  68   TRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
             RLSLA ERTGQWVFS  +PTDVIVEVGEA F LH FML
Sbjct  6    NRLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFML  44



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  68   TRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
             RLSLA ERTGQWVFS  +PTDVIVEVGEA F LH FML
Sbjct  6    NRLSLAMERTGQWVFSQEVPTDVIVEVGEARFCLHKFML  44



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+ +K++ +R+SLA ERTGQWVFS  IP+DV++E+GEA+F+LH FML
Sbjct  1    MATTVKNS-SRVSLAMERTGQWVFSQEIPSDVVIEIGEANFALHKFML  47



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  65   ATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            A R +LA ERTGQWVFS  +PTDVIVEVGEASFSLH FML
Sbjct  2    ANRHNLAMERTGQWVFSQEVPTDVIVEVGEASFSLHKFML  41



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  59   SAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            S   RLSLA ERTG+WVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  4    STKNRLSLAMERTGKWVFSQEIPTDVVVEVGEANFSLHKFML  45



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P+ S  +R+S A ERTGQWVFS  IPTDV+VE GEA+F+LH FML
Sbjct  1    MATPVMSN-SRMSSAMERTGQWVFSQEIPTDVVVEAGEANFNLHKFML  47



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P      RLSLA ERTGQWVFS  IPTDVIVEVGE  FSLH FML
Sbjct  1    MATP----NNRLSLAMERTGQWVFSQDIPTDVIVEVGETIFSLHKFML  44



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASP++S   RLSLA ERTG+WVFS  IPTDV+V V EASFSLH FML
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKFML  45



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P     TR SLA ERTGQWVFS  IPTDVIV VGE++FSLH F+L
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGESTFSLHKFIL  45



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            M +P+K  +  +SLA ER GQWVFS  +PTDV+VEVGE SFSLH FML
Sbjct  1    MPNPIKHNSN-ISLAMERAGQWVFSQELPTDVVVEVGEMSFSLHKFML  47



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P++S  +RLSLA ERT QWVFS  IPTDV+V V EA+FSLH FML
Sbjct  1    MATPVRSN-SRLSLAMERTDQWVFSQDIPTDVVVVVCEATFSLHKFML  47



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PL     R S A ERTGQWVFS  IPTD++V VGEA+F LH FML
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFML  45



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 35/48 (73%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+PL     R S A ERTGQWVFS  IPTD++V VGEA+F LH FML
Sbjct  1    MATPLNK---RFSSAKERTGQWVFSQEIPTDIVVAVGEANFPLHKFML  45



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASP++S   RLSLA ERTG+WVFS  IPTDV+V V EASFSLH  ML
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSML  45



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MASP++S   RLSLA ERTG+WVFS  IPTDV+V V EASFSLH  ML
Sbjct  1    MASPVRS---RLSLAMERTGKWVFSKDIPTDVVVVVCEASFSLHKSML  45



>emb|CBI15801.3| unnamed protein product [Vitis vinifera]
Length=191

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  89   ERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            ERTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  2    ERTGQWVFSQEIPTDVVVEVGEANFSLHKFML  33



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 3/48 (6%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MA+P     TR SLA ERTGQWVFS  IPTDVIV VG+ +FSLH F+L
Sbjct  1    MATP---NPTRFSLAMERTGQWVFSPEIPTDVIVAVGQTNFSLHKFIL  45



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  68   TRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +RLSLA ERTGQW+FS  IP+DVIV +GEA++SLH FML
Sbjct  7    SRLSLAMERTGQWIFSQEIPSDVIVTIGEATYSLHKFML  45



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            M+S +K    R+S+A ERTGQW+FS  IPTDV+V VGEA F LH FML
Sbjct  1    MSSSMK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFML  47



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            M+S +K    R+S+A ERTGQW+FS  IPTDV+V VGEA F LH FML
Sbjct  1    MSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFML  47



>gb|AAB63085.1| unknown protein [Arabidopsis thaliana]
Length=185

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  47   SPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +P+   +   SLA  RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  7    NPINMNSMSSSLA--RTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +M+S +K    R+S+A ERTGQW+FS  IPTDV+V VGEA F LH FML
Sbjct  84   SMSSSVK-GNNRMSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFML  131



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 1/49 (2%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +MA+P++S  +RLSL  ERT +WVFS  IPTDV+V V EA+FSLH FML
Sbjct  17   DMATPVRSN-SRLSLTMERTDRWVFSQDIPTDVVVVVCEATFSLHKFML  64



>ref|XP_006410156.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
 gb|ESQ51609.1| hypothetical protein EUTSA_v10016728mg [Eutrema salsugineum]
Length=412

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S   +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSTLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  65   ATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            ++RLSLA ERTGQW+ S  +P+DVIV VGEAS+SLH FML
Sbjct  6    SSRLSLAMERTGQWISSQELPSDVIVTVGEASYSLHKFML  45



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  83   AXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            A ERTGQWVFS  IPTD++++VGEA+FSLH FML
Sbjct  23   ALERTGQWVFSQEIPTDIVIQVGEAAFSLHKFML  56



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDVIVEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVIVEVGEANFSLHKFML  50



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S+A ERTGQW+FS  IPTDV+V VGEA F LH FML
Sbjct  1    MSIAMERTGQWIFSQDIPTDVVVAVGEAHFPLHKFML  37



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S +  RTGQWVFS  IPTDVIVEVGEA+FSLH FML
Sbjct  14   MSSSLARTGQWVFSQDIPTDVIVEVGEANFSLHKFML  50



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  47   SPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +P+   +   SLA  RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  7    NPINMNSMSSSLA--RTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  47   SPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +P+   +   SLA  RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  7    NPINMNSMSSSLA--RTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  47   SPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +P+   +   SLA  RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  7    NPINMNSMSSSLA--RTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +2

Query  47   SPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +P+   +   SLA  RTGQWVFS  IPTDV+VEVGEA+FSLH FML
Sbjct  7    NPINMNSMSSSLA--RTGQWVFSQDIPTDVVVEVGEANFSLHKFML  50



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  62   AATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            A  RLS A ERTGQWV S  IPTDV+V VG A FSLH F L
Sbjct  2    ADDRLSHAMERTGQWVLSQQIPTDVVVAVGTARFSLHKFTL  42



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S A ERT QWVFS  IPTDV+VEV EA+FSLH FML
Sbjct  12   MSSAMERTDQWVFSQDIPTDVVVEVCEANFSLHKFML  48



>gb|ABI34691.1| bZIP transcription factor bZIP84 [Glycine max]
Length=183

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  92   RTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            RTGQWVFS  IPTDVIV VG+ +FSLH F+L
Sbjct  1    RTGQWVFSPEIPTDVIVAVGQTNFSLHKFIL  31



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  65   ATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            ++RL  A E+T QWV S  IP+D+IV+VG+ +F LH FML
Sbjct  7    SSRLCAAMEKTSQWVLSQDIPSDIIVQVGDDTFRLHKFML  46



>gb|KGN61975.1| hypothetical protein Csa_2G277660 [Cucumis sativus]
Length=299

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
             ++S L  +A +  LS A +RT +W+FS  IP+DV V VGEASFSLH F L
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPL  60



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQ  FS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
             ++S L  +A +  LS A +RT +W+FS  IP+DV V VGEASFSLH F L
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPL  60



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S + +RTGQ  FS  IPTDV+VEVGEA+FSLH FML
Sbjct  14   MSSSLQRTGQLGFSQDIPTDVVVEVGEANFSLHKFML  50



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VGEASFSLH F L
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPL  57



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VGEASFSLH F L
Sbjct  21   LSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPL  57



>ref|XP_004166154.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=802

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  38   NMASPLKSAATR--LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
             ++S L  +A +  LS A +RT +W+FS  IP+DV V VGEASFSLH F L
Sbjct  10   QLSSSLNMSAKKELLSTAMKRTSEWIFSQEIPSDVTVHVGEASFSLHKFPL  60



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VGEASFSLH F L
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPL  60



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VGEASFSLH F L
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPL  60



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VGEASFSLH F L
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLHKFPL  60



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     LS A +RT +W+FS  IP+DV V+VG ASFSLH F L
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVQVGGASFSLHKFPL  60



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VGEASFS+H F L
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPL  60



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VGEASFS+H F L
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVKVRVGEASFSIHKFPL  60



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            + +A ERT QWV S   P DV+V+V EASFSLH F+L
Sbjct  10   MDMAMERTDQWVSSQDTPADVVVDVCEASFSLHKFLL  46



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VGE SFSLH F L
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVNVQVGEDSFSLHKFPL  59



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  65   ATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            ++RLS A E T  W FS  IP+D++V++G+A+F LH F+L
Sbjct  10   SSRLSAAMETTSHWDFSQDIPSDIVVQIGDATFQLHKFVL  49



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS +KS     S+A ERT QW+ S   PTDV V V +A+FSLH FML
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFML  47



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +2

Query  41   MASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            MAS +KS     S+A ERT QW+ S   PTDV V V +A+FSLH FML
Sbjct  1    MASHVKSNGGN-SIAMERTSQWLLSKKFPTDVDVIVSKANFSLHKFML  47



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     LS A +RT +W+FS  IP+DV V  GE SFSLH F L
Sbjct  15   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPL  60



>ref|XP_004288469.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=623

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     L+ A +RT +W+FS  IP+DV V VGE SFSLH F L
Sbjct  18   NMSSKKKEL---LTSALKRTSEWIFSQEIPSDVSVRVGEVSFSLHKFPL  63



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLH  172
            LS A +RT +W+FS  IP+DV V+VGEASFSLH
Sbjct  24   LSSAMKRTSEWIFSQEIPSDVNVQVGEASFSLH  56



>ref|XP_002963864.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
 gb|EFJ35735.1| hypothetical protein SELMODRAFT_141980 [Selaginella moellendorffii]
Length=631

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +2

Query  56   KSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            K   +R S   +RTGQW+ S  +PTDV+VE    SFSLH F L
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPL  53



>ref|XP_002988267.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
 gb|EFJ10686.1| hypothetical protein SELMODRAFT_447227 [Selaginella moellendorffii]
Length=631

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +2

Query  56   KSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            K   +R S   +RTGQW+ S  +PTDV+VE    SFSLH F L
Sbjct  11   KRLVSRTSYNKKRTGQWIMSADVPTDVVVEAAGTSFSLHKFPL  53



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VG  SFSLH F L
Sbjct  23   LSTAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPL  59



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V  GE SFSLH F L
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPL  45



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  83   AXERTGQWVFSXX-IPTDVIVEVGEASFSLHXFML  184
            A ERTGQWV S   IPTD+I+ VG+ SF LH FML
Sbjct  13   ATERTGQWVPSDQDIPTDIIIHVGDVSFPLHKFML  47



>emb|CDY30615.1| BnaAnng03900D [Brassica napus]
Length=499

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LSLA ERT +W+ S  IP+D+ V +G+ SFSLH  +L
Sbjct  9    LSLAMERTSEWISSQEIPSDITVHIGDTSFSLHKILL  45



>emb|CDY57361.1| BnaC08g48680D [Brassica napus]
Length=499

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LSLA ERT +W+ S  IP+D+ V +G+ SFSLH  +L
Sbjct  9    LSLAMERTSEWISSQEIPSDITVHIGDTSFSLHKILL  45



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     LS A +RT +W+FS  IP+DV V  G ASFSLH F L
Sbjct  15   NMSSKKKQL---LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPL  60



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V  GE SFSLH F L
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVHAGEVSFSLHKFPL  45



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V+VG  SFSLH F L
Sbjct  23   LSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPL  59



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV ++VG  SFSLH F L
Sbjct  24   LSTALKRTSEWIFSQEIPSDVTIDVGGVSFSLHKFPL  60



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LSLA ERT +W+ S  IP+D+ V +G+ SFSLH  +L
Sbjct  9    LSLAMERTSEWISSQEIPSDITVYIGDTSFSLHKILL  45



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LSLA ERT +W+ S  IP+D+ V +G+ SFSLH  +L
Sbjct  9    LSLAMERTSEWISSQEIPSDITVYIGDTSFSLHKILL  45



>gb|KJB48680.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=447

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  53   LKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            + S    LS A +RT +W+FS  IP+DV V+VG  SFSLH F L
Sbjct  16   MSSKKELLSSAMKRTSEWIFSQEIPSDVTVQVGGVSFSLHKFPL  59



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V  G ASFSLH F L
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPL  44



>ref|XP_002877714.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53973.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A ERT +W+ S  IP+DV V VGE SFSLH F L
Sbjct  8    LSSAMERTSEWISSQKIPSDVTVHVGETSFSLHKFPL  44



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V  G ASFSLH F L
Sbjct  8    LSTAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPL  44



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VG  SFSLH F L
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPL  60



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VG  SFSLH F L
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPL  60



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V VG  SFSLH F L
Sbjct  24   LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPL  60



>gb|KDO78973.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=457

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM++  K     LS A +RT +W+FS  IP+DV V VG  SFSLH F L
Sbjct  15   NMSNKKKEL---LSTAMKRTSEWIFSQEIPSDVTVHVGGTSFSLHKFPL  60



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query  53   LKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LK    R S A +RT +W+FS  IP+D+ ++VG+ SFSLH F L
Sbjct  7    LKKKELR-STAMKRTSEWIFSQEIPSDITIKVGDNSFSLHKFPL  49



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  77   SLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            S A ERT +W+FS  IP+D+ V  G ASFSLH F L
Sbjct  10   STAMERTSEWIFSQEIPSDITVHAGGASFSLHKFPL  45



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     LS A +RT +W+FS  IP+DVIV  G   FSLH F L
Sbjct  16   NMSSKKKEL---LSTAMKRTSEWIFSQEIPSDVIVHAGGTPFSLHKFPL  61



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 3/49 (6%)
 Frame = +2

Query  47   SPLKSAATR---LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            SPL  +  +   LS A +RT +W+FS  IP+DV V+ G A+FSLH F L
Sbjct  8    SPLIMSTKKKQLLSSAMKRTSEWIFSQEIPSDVTVQAGGATFSLHKFPL  56



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     LS A +RT +W+FS  IP+D+ + VG  SFSLH F L
Sbjct  21   NMSSKKKEL---LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPL  66



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM S  K     LS A +RT +W+FS  IP+DV + VG  SFSLH F L
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPL  62



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM S  K     LS A +RT +W+FS  IP+DV + VG  SFSLH F L
Sbjct  17   NMTSKKKEL---LSSALKRTSEWIFSQEIPSDVNIHVGGVSFSLHKFPL  62



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  77   SLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            S A +RT +W+FS  IP+DV V  G ASFSLH F L
Sbjct  10   STAMKRTSEWIFSQEIPSDVTVHAGGASFSLHKFPL  45



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT  W+FS  IP+DV V++GE+SF+LH + L
Sbjct  24   LSSAMKRTSDWIFSQEIPSDVNVQIGESSFTLHKYPL  60



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+DV V  G  SFSLH F L
Sbjct  9    LSTAMKRTSEWIFSQEIPSDVTVNAGGTSFSLHKFPL  45



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S A +RT +W+ S  IP+DV   VGEASFSLH F L
Sbjct  9    MSSAMKRTSEWISSQEIPSDVTAHVGEASFSLHKFPL  45



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+D+ V  G  SFSLH F L
Sbjct  24   LSTAMKRTSEWIFSQEIPSDITVNAGGTSFSLHKFPL  60



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM+S  K     L+ A +RT +W+FS  IP+DV V  G  SFSLH F L
Sbjct  20   NMSSKKKEL---LTTAMKRTSEWIFSQEIPSDVTVHAGGVSFSLHKFPL  65



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  107  VFSXXIPTDVIVEVGEASFSLHXFML  184
            VFS  IPTDVIVEVGEA+F+LH FML
Sbjct  6    VFSQEIPTDVIVEVGEANFNLHKFML  31



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+D+ + VG  SFSLH F L
Sbjct  27   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPL  63



>ref|XP_006404081.1| hypothetical protein EUTSA_v10010248mg [Eutrema salsugineum]
 gb|ESQ45534.1| hypothetical protein EUTSA_v10010248mg [Eutrema salsugineum]
Length=566

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +SLA +RT +W+ S  IP D+ V +GE SFSLH F +
Sbjct  8    MSLAMKRTSEWISSQEIPCDIAVHIGETSFSLHKFTV  44



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S A +RT +WV S  +PTDV+VE G  SF+LH F L
Sbjct  6    VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPL  42



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S A +RT +WV S  +PTDV+VE G  SF+LH F L
Sbjct  18   VSSAAKRTAEWVMSTDVPTDVLVEAGGVSFALHKFPL  54



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            +S A +RT +W+FS  IP+DV V+V   SFSLH F L
Sbjct  24   MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPL  60



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+D+ + VG  SFSLH F L
Sbjct  29   LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPL  65



>gb|KJB43881.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=437

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 3/49 (6%)
 Frame = +2

Query  38   NMASPLKSAATRLSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            NM++  K     +S A +RT +W+FS  IP+DV V+V   SFSLH F L
Sbjct  15   NMSAKKKEL---MSTAMKRTSEWIFSQEIPSDVTVQVAGVSFSLHKFPL  60



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT  W+FS  IP+DV V  G ++FSLH F L
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPL  62



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT  W+FS  IP+DV V  G ++FSLH F L
Sbjct  26   LSTAMKRTSDWIFSQEIPSDVTVNAGGSAFSLHKFPL  62



>ref|XP_008352542.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=448

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS A +RT +W+FS  IP+D+ + VG  SFSLH F L
Sbjct  9    LSSALKRTSEWIFSQEIPSDISINVGGVSFSLHKFPL  45



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  74   LSLAXERTGQWVFSXXIPTDVIVEVGEASFSLHXFML  184
            LS   +RT +W+FS  IP+DV V  G ASFSLH F L
Sbjct  25   LSTVMKRTSEWIFSQEIPSDVTVLAGGASFSLHKFPL  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551690658990