BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030K07

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   3e-55   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   3e-54   Nicotiana sylvestris
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   2e-51   Solanum tuberosum [potatoes]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    181   2e-51   Nicotiana tomentosiformis
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    181   4e-51   Nicotiana tomentosiformis
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            180   8e-51   Solanum lycopersicum
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  173   3e-49   Citrus sinensis [apfelsine]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             171   1e-48   
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            173   4e-48   Solanum lycopersicum
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             173   5e-48   Citrus clementina [clementine]
emb|CDY19294.1|  BnaC01g31860D                                          171   2e-47   Brassica napus [oilseed rape]
emb|CDY39494.1|  BnaA01g24940D                                          171   2e-47   Brassica napus [oilseed rape]
emb|CDP11782.1|  unnamed protein product                                171   3e-47   Coffea canephora [robusta coffee]
emb|CDP11780.1|  unnamed protein product                                170   4e-47   Coffea canephora [robusta coffee]
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   7e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   1e-46   Nelumbo nucifera [Indian lotus]
emb|CDY19295.1|  BnaC01g31850D                                          164   1e-46   Brassica napus [oilseed rape]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   3e-46   Brassica rapa
emb|CDY38631.1|  BnaA05g19560D                                          168   3e-46   Brassica napus [oilseed rape]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   4e-46   Camelina sativa [gold-of-pleasure]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    167   6e-46   Arabis alpina [alpine rockcress]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   6e-46   
ref|XP_003605914.1|  Transparent testa 12 protein                       167   7e-46   Medicago truncatula
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   7e-46   Brassica rapa
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   9e-46   
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            166   1e-45   Glycine max [soybeans]
emb|CDY69153.1|  BnaAnng29470D                                          162   2e-45   Brassica napus [oilseed rape]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    166   2e-45   Cicer arietinum [garbanzo]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            166   2e-45   Vitis vinifera
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            164   2e-45   
ref|XP_007045634.1|  MATE efflux family protein isoform 2               164   3e-45   
emb|CBI28937.3|  unnamed protein product                                166   3e-45   Vitis vinifera
emb|CBI28939.3|  unnamed protein product                                162   3e-45   Vitis vinifera
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   8e-45   Cucumis sativus [cucumbers]
emb|CDP17486.1|  unnamed protein product                                163   1e-44   Coffea canephora [robusta coffee]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-44   Cucumis melo [Oriental melon]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               163   2e-44   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-44   
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             162   2e-44   
gb|KEH39009.1|  MATE efflux family protein                              162   3e-44   Medicago truncatula
emb|CAN69305.1|  hypothetical protein VITISV_021605                     159   3e-44   Vitis vinifera
ref|XP_002883313.1|  mate efflux family protein                         162   4e-44   
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   5e-44   Elaeis guineensis
emb|CDY33129.1|  BnaCnng07000D                                          162   5e-44   Brassica napus [oilseed rape]
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   7e-44   Brassica rapa
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             162   7e-44   Eutrema salsugineum [saltwater cress]
ref|XP_003596992.1|  Transparent testa 12 protein                       161   7e-44   Medicago truncatula
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   8e-44   Cicer arietinum [garbanzo]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    161   9e-44   Elaeis guineensis
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    161   1e-43   Vitis vinifera
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-43   Elaeis guineensis
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   2e-43   Elaeis guineensis
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            160   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-43   Prunus mume [ume]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY24250.1|  BnaC03g42230D                                          155   6e-43   Brassica napus [oilseed rape]
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   6e-43   
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    159   8e-43   Arabis alpina [alpine rockcress]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            159   9e-43   
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            159   9e-43   Glycine soja [wild soybean]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   9e-43   Phoenix dactylifera
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            158   1e-42   Vitis vinifera
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             158   2e-42   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   2e-42   Elaeis guineensis
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   3e-42   Cicer arietinum [garbanzo]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             156   5e-42   Capsella rubella
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   5e-42   Brassica rapa
emb|CDX92916.1|  BnaA03g36380D                                          156   5e-42   
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            156   6e-42   Glycine soja [wild soybean]
emb|CDY65669.1|  BnaCnng48120D                                          156   7e-42   Brassica napus [oilseed rape]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   8e-42   Camelina sativa [gold-of-pleasure]
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                   155   1e-41   Citrus sinensis [apfelsine]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   1e-41   Glycine max [soybeans]
dbj|BAJ34540.1|  unnamed protein product                                155   1e-41   Eutrema halophilum
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                   155   1e-41   Citrus sinensis [apfelsine]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   2e-41   Brassica rapa
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   4e-41   Prunus mume [ume]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   154   4e-41   Citrus sinensis [apfelsine]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       154   4e-41   Cucumis sativus [cucumbers]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             154   6e-41   Populus trichocarpa [western balsam poplar]
emb|CDY39493.1|  BnaA01g24950D                                          153   6e-41   Brassica napus [oilseed rape]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   6e-41   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             153   7e-41   Citrus clementina [clementine]
gb|ACZ55931.1|  MATE transporter 2                                      153   8e-41   Zea mays [maize]
gb|ACF85423.1|  unknown                                                 153   9e-41   Zea mays [maize]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   9e-41   Elaeis guineensis
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             153   1e-40   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-40   Cucumis melo [Oriental melon]
tpg|DAA50098.1|  TPA: putative MATE efflux family protein               151   2e-40   
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   2e-40   
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            152   2e-40   Vitis vinifera
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-40   Setaria italica
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    152   2e-40   Arabis alpina [alpine rockcress]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-40   Fragaria vesca subsp. vesca
gb|ACZ55932.1|  MATE transporter 2                                      152   2e-40   Zea mays [maize]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-40   Populus euphratica
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             152   3e-40   
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             152   3e-40   Populus trichocarpa [western balsam poplar]
ref|NP_001149176.1|  transparent testa 12 protein                       152   3e-40   Zea mays [maize]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   4e-40   Eucalyptus grandis [rose gum]
ref|NP_001148084.1|  transparent testa 12 protein                       151   4e-40   Zea mays [maize]
gb|AGT17221.1|  transparent testa 12 protein                            151   5e-40   Saccharum hybrid cultivar R570
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             151   5e-40   Prunus persica
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             150   5e-40   
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   5e-40   
ref|NP_188806.1|  MATE efflux family protein                            151   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   6e-40   Pyrus x bretschneideri [bai li]
gb|AAM20595.1|  integral membrane protein, putative                     151   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   7e-40   Pyrus x bretschneideri [bai li]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   8e-40   Cucumis melo [Oriental melon]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   8e-40   Citrus sinensis [apfelsine]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   9e-40   Prunus mume [ume]
gb|KJB57729.1|  hypothetical protein B456_009G178100                    148   9e-40   Gossypium raimondii
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               150   1e-39   
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-39   Populus euphratica
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             150   1e-39   Phaseolus vulgaris [French bean]
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              150   1e-39   Gossypium arboreum [tree cotton]
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    150   2e-39   Zea mays [maize]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       149   2e-39   Cucumis sativus [cucumbers]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   2e-39   Cucumis sativus [cucumbers]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    149   3e-39   Gossypium raimondii
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   3e-39   Populus euphratica
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   3e-39   Cicer arietinum [garbanzo]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   3e-39   Cucumis melo [Oriental melon]
gb|KJB57730.1|  hypothetical protein B456_009G178100                    149   4e-39   Gossypium raimondii
emb|CDM85992.1|  unnamed protein product                                149   4e-39   Triticum aestivum [Canadian hard winter wheat]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    149   4e-39   Gossypium raimondii
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   5e-39   
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   6e-39   
gb|KGN43522.1|  Mate efflux family protein                              148   7e-39   Cucumis sativus [cucumbers]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             148   7e-39   Citrus clementina [clementine]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       147   9e-39   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   9e-39   Brachypodium distachyon [annual false brome]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-38   Fragaria vesca subsp. vesca
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              147   1e-38   Gossypium arboreum [tree cotton]
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   1e-38   
gb|KJB69294.1|  hypothetical protein B456_011G014800                    147   1e-38   Gossypium raimondii
gb|EEC75610.1|  hypothetical protein OsI_12322                          147   1e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                       147   1e-38   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-38   
gb|ABF97220.1|  MATE efflux family protein, expressed                   147   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    147   2e-38   Citrus sinensis [apfelsine]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    147   2e-38   Gossypium raimondii
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             147   2e-38   
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-38   
gb|AAS01962.1|  putative MATE efflux family protein                     147   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   2e-38   Prunus mume [ume]
gb|ABF97209.1|  MATE efflux family protein, expressed                   146   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   3e-38   Populus euphratica
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   3e-38   Malus domestica [apple tree]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   146   3e-38   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   3e-38   Citrus sinensis [apfelsine]
gb|EEC75606.1|  hypothetical protein OsI_12318                          146   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   4e-38   Populus euphratica
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   4e-38   
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             145   4e-38   Phaseolus vulgaris [French bean]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   6e-38   Sesamum indicum [beniseed]
gb|KDP20759.1|  hypothetical protein JCGZ_21230                         142   6e-38   Jatropha curcas
gb|KDP20755.1|  hypothetical protein JCGZ_21226                         143   7e-38   Jatropha curcas
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    145   7e-38   
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                145   7e-38   Erythranthe guttata [common monkey flower]
ref|XP_002518495.1|  multidrug resistance pump, putative                145   8e-38   Ricinus communis
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             144   9e-38   
emb|CDM86677.1|  unnamed protein product                                144   1e-37   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            144   1e-37   Triticum urartu
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   1e-37   Pyrus x bretschneideri [bai li]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           144   1e-37   Nicotiana tabacum [American tobacco]
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       144   1e-37   Cucumis sativus [cucumbers]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            144   1e-37   
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   1e-37   Nicotiana sylvestris
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    144   2e-37   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               144   2e-37   
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   2e-37   
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   2e-37   Prunus mume [ume]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   2e-37   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   2e-37   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   2e-37   
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                     143   2e-37   Eucalyptus grandis [rose gum]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    143   3e-37   Brachypodium distachyon [annual false brome]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   3e-37   Setaria italica
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   3e-37   
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    143   3e-37   
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   4e-37   Eucalyptus grandis [rose gum]
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   4e-37   Populus euphratica
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   5e-37   Nicotiana tomentosiformis
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   6e-37   Populus euphratica
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   6e-37   Populus euphratica
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         142   6e-37   Jatropha curcas
gb|AHI48506.1|  multidrug and toxic extrusion transporter               142   9e-37   Vaccinium corymbosum [American blueberry]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            142   9e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    141   1e-36   Solanum tuberosum [potatoes]
tpg|DAA50097.1|  TPA: putative MATE efflux family protein               135   1e-36   
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    142   1e-36   Nicotiana sylvestris
ref|XP_006389638.1|  MATE efflux family protein                         141   2e-36   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    141   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    141   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   2e-36   
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                   135   2e-36   Citrus sinensis [apfelsine]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    140   2e-36   Nicotiana tomentosiformis
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   3e-36   
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   3e-36   Vitis vinifera
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   3e-36   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   5e-36   Pyrus x bretschneideri [bai li]
ref|XP_007026056.1|  MATE efflux family protein                         140   5e-36   
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   5e-36   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   5e-36   Solanum tuberosum [potatoes]
ref|XP_002518493.1|  multidrug resistance pump, putative                139   6e-36   Ricinus communis
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   9e-36   Solanum lycopersicum
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   1e-35   
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   1e-35   Populus euphratica
emb|CDM86696.1|  unnamed protein product                                139   1e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007026057.1|  MATE efflux family protein                         139   1e-35   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                139   1e-35   Erythranthe guttata [common monkey flower]
gb|EPS61219.1|  hypothetical protein M569_13580                         132   2e-35   Genlisea aurea
emb|CDM86692.1|  unnamed protein product                                138   2e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   2e-35   Sesamum indicum [beniseed]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   2e-35   Solanum tuberosum [potatoes]
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                138   2e-35   Erythranthe guttata [common monkey flower]
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         141   2e-35   Jatropha curcas
gb|ABK24492.1|  unknown                                                 137   4e-35   Picea sitchensis
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    137   4e-35   Tarenaya hassleriana [spider flower]
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                137   4e-35   Erythranthe guttata [common monkey flower]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             137   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   5e-35   Solanum lycopersicum
emb|CDM86687.1|  unnamed protein product                                136   9e-35   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   2e-34   Nicotiana sylvestris
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            135   2e-34   Glycine soja [wild soybean]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   2e-34   Glycine max [soybeans]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          135   2e-34   Sorghum bicolor [broomcorn]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   2e-34   Zea mays [maize]
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    134   3e-34   Nicotiana tomentosiformis
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    134   3e-34   Nicotiana tomentosiformis
gb|EPS67796.1|  hypothetical protein M569_06975                         134   4e-34   Genlisea aurea
gb|EMT19998.1|  hypothetical protein F775_52364                         137   5e-34   
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       134   7e-34   Populus euphratica
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       134   7e-34   Populus euphratica
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       134   7e-34   Solanum lycopersicum
gb|ADE77677.1|  unknown                                                 134   8e-34   Picea sitchensis
gb|KDP20757.1|  hypothetical protein JCGZ_21228                         131   1e-33   Jatropha curcas
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       133   1e-33   Zea mays [maize]
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       133   2e-33   Morus notabilis
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    132   2e-33   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       132   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       132   4e-33   Solanum tuberosum [potatoes]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       131   5e-33   Oryza brachyantha
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    131   6e-33   Nicotiana tomentosiformis
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   7e-33   Tarenaya hassleriana [spider flower]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   1e-32   
ref|NP_001147791.1|  transparent testa 12 protein                       130   1e-32   Zea mays [maize]
emb|CBI23252.3|  unnamed protein product                                127   1e-32   Vitis vinifera
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   2e-32   Nicotiana sylvestris
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    128   2e-32   
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   2e-32   
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       129   2e-32   Populus euphratica
tpg|DAA62913.1|  TPA: putative MATE efflux family protein               130   3e-32   
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                129   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    128   7e-32   
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            128   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             128   8e-32   Populus trichocarpa [western balsam poplar]
gb|KEH36840.1|  MATE efflux family protein                              127   1e-31   Medicago truncatula
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    127   1e-31   Sesamum indicum [beniseed]
gb|EEC75604.1|  hypothetical protein OsI_12313                          126   3e-31   Oryza sativa Indica Group [Indian rice]
emb|CDY07256.1|  BnaC04g19150D                                          120   3e-31   
emb|CDY33130.1|  BnaCnng07010D                                          123   7e-31   Brassica napus [oilseed rape]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            125   9e-31   Vitis vinifera
ref|XP_002518492.1|  multidrug resistance pump, putative                125   1e-30   Ricinus communis
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             125   1e-30   Eutrema salsugineum [saltwater cress]
tpg|DAA40987.1|  TPA: putative MATE efflux family protein               125   1e-30   
ref|NP_001050520.1|  Os03g0570800                                       125   1e-30   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    124   2e-30   
emb|CDP04391.1|  unnamed protein product                                124   2e-30   
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial     119   9e-30   
emb|CDY64820.1|  BnaA08g31640D                                          121   2e-29   
emb|CDY64933.1|  BnaCnng45550D                                          121   2e-29   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   2e-29   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    121   3e-29   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   3e-29   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   3e-29   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       121   3e-29   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   3e-29   
ref|NP_564787.1|  MATE efflux family protein                            120   3e-29   
gb|AAK82541.1|  At1g61890/F8K4_9                                        120   3e-29   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             120   3e-29   
ref|XP_002886501.1|  mate efflux family protein                         120   3e-29   
ref|XP_002892653.1|  mate efflux family protein                         120   3e-29   
ref|NP_172632.1|  MATE efflux family protein                            120   4e-29   
gb|AAM98160.1|  unknown protein                                         120   4e-29   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   4e-29   
emb|CDY25329.1|  BnaC01g29980D                                          120   4e-29   
emb|CDY47166.1|  BnaA01g22920D                                          120   4e-29   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   5e-29   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            120   6e-29   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   8e-29   
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                            113   8e-29   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   8e-29   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein               119   9e-29   
emb|CDY34637.1|  BnaC08g41960D                                          119   1e-28   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      119   2e-28   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    119   2e-28   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               118   2e-28   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          118   2e-28   
gb|AGT17223.1|  MATE efflux family protein                              118   3e-28   
gb|EAY90719.1|  hypothetical protein OsI_12317                          117   4e-28   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             118   4e-28   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    119   4e-28   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             118   4e-28   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   4e-28   
emb|CDY34833.1|  BnaA09g47590D                                          117   5e-28   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg             117   7e-28   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    116   1e-27   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             116   1e-27   
emb|CDY19507.1|  BnaC09g13960D                                          116   2e-27   
emb|CDY12916.1|  BnaA09g13580D                                          116   2e-27   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   2e-27   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          115   4e-27   
dbj|BAJ90668.1|  predicted protein                                      114   5e-27   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                            115   6e-27   
ref|XP_006858200.1|  hypothetical protein AMTR_s00062p00173640          107   9e-27   
ref|NP_001142368.1|  uncharacterized protein LOC100274540               113   2e-26   
gb|EMT26283.1|  Protein TRANSPARENT TESTA 12                            106   2e-26   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     111   9e-26   
emb|CDX94061.1|  BnaC07g36950D                                          111   1e-25   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            111   1e-25   
emb|CDX94063.1|  BnaC07g36970D                                          110   1e-25   
gb|ABR18290.1|  unknown                                                 104   2e-25   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          110   3e-25   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-25   
emb|CDX98712.1|  BnaA03g44970D                                          109   4e-25   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             109   5e-25   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-25   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-24   
emb|CDX76391.1|  BnaA08g10090D                                          108   2e-24   
emb|CDX98711.1|  BnaA03g44960D                                          108   2e-24   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   2e-24   
emb|CDX98713.1|  BnaA03g44980D                                          107   2e-24   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   3e-24   
gb|ACG29464.1|  hypothetical protein                                    101   4e-24   
emb|CDY27431.1|  BnaC03g64710D                                          107   5e-24   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   5e-24   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    106   5e-24   
emb|CDY27434.1|  BnaC03g64740D                                          106   5e-24   
gb|AGT17222.1|  MATE efflux family protein                              106   8e-24   
emb|CDX76392.1|  BnaA08g10080D                                          105   1e-23   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             104   2e-23   
emb|CDX79109.1|  BnaA01g11760D                                          104   3e-23   
ref|XP_002867814.1|  mate efflux family protein                         104   4e-23   
emb|CAA17158.1|  putative protein                                       103   5e-23   
dbj|BAH19969.1|  AT4G21910                                              103   9e-23   
ref|NP_974587.1|  MATE efflux family protein                            103   9e-23   
gb|EEE59382.1|  hypothetical protein OsJ_11498                        98.6    9e-23   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-22   
ref|XP_002867813.1|  mate efflux family protein                         103   1e-22   
ref|NP_001190793.1|  MATE efflux family protein                         103   1e-22   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             102   1e-22   
gb|AAR00637.1|  hypothetical protein                                  97.1    1e-22   
emb|CDP11781.1|  unnamed protein product                                100   3e-22   
ref|XP_008646561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       101   3e-22   
emb|CBI28938.3|  unnamed protein product                                100   3e-22   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg             100   1e-21   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             100   1e-21   
gb|EAY90715.1|  hypothetical protein OsI_12314                        98.2    1e-21   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg           99.8    2e-21   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                        99.8    2e-21   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401           99.4    3e-21   
ref|NP_567640.1|  MATE efflux family protein                          99.4    3e-21   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                  99.0    4e-21   
emb|CDX67772.1|  BnaA07g18120D                                        98.6    4e-21   
gb|AAM62936.1|  unknown                                               98.6    5e-21   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     98.6    5e-21   
ref|XP_004491273.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.8    9e-21   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    1e-20   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     97.4    1e-20   
gb|ACJ36211.1|  transparent testa 12 isoform 2                        97.4    1e-20   
gb|ACJ36215.1|  transparent testa 12                                  97.4    1e-20   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.4    1e-20   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.4    2e-20   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12          97.1    2e-20   
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                          96.3    2e-20   
ref|NP_001059785.1|  Os07g0516600                                     96.7    2e-20   
dbj|BAC56017.1|  putative ripening regulated protein DDTFR18          96.7    3e-20   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg           96.7    3e-20   
gb|EEC82143.1|  hypothetical protein OsI_26198                        96.3    3e-20   
emb|CBI23254.3|  unnamed protein product                              95.9    3e-20   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.7    1e-19   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     94.7    1e-19   
gb|AHH83753.1|  multidrug and toxic extrusion transporter             94.7    1e-19   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                          94.0    2e-19   
gb|ACJ36209.1|  transparent testa 12 isoform 1                        94.0    2e-19   
gb|ACX37118.1|  MATE transporter                                      94.0    3e-19   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880        93.2    3e-19   
gb|AET00276.2|  MATE efflux family protein                            94.0    3e-19   
ref|XP_002516716.1|  multidrug resistance pump, putative              91.7    3e-19   
ref|XP_003545155.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     93.2    4e-19   
ref|XP_003617317.1|  Protein TRANSPARENT TESTA                        93.6    4e-19   
emb|CBI23251.3|  unnamed protein product                              92.0    6e-19   
ref|XP_010524117.1|  PREDICTED: protein TRANSPARENT TESTA 12          92.4    8e-19   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                       92.0    8e-19   
gb|EEC75607.1|  hypothetical protein OsI_12319                        87.0    1e-18   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     91.7    1e-18   
gb|AIW42903.1|  transparent testa 12                                  91.3    2e-18   
emb|CDP20703.1|  unnamed protein product                              90.5    2e-18   
dbj|BAJ88945.1|  predicted protein                                    85.9    2e-18   
emb|CDP04390.1|  unnamed protein product                              90.5    2e-18   
ref|XP_009588590.1|  PREDICTED: protein TRANSPARENT TESTA 12          90.9    2e-18   
ref|XP_010688832.1|  PREDICTED: protein TRANSPARENT TESTA 12          90.9    3e-18   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                 88.6    4e-18   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg           88.6    4e-18   
ref|XP_007141454.1|  hypothetical protein PHAVU_008G197000g           90.5    4e-18   
gb|KJB64207.1|  hypothetical protein B456_010G037100                  90.1    5e-18   
ref|XP_009777196.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  90.1    5e-18   
ref|XP_009777197.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...  90.1    5e-18   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.7    6e-18   
emb|CDP16070.1|  unnamed protein product                              89.7    8e-18   
gb|AIW42905.1|  transparent testa 12                                  89.4    9e-18   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                     89.4    9e-18   
ref|XP_006352054.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     89.0    1e-17   
ref|XP_007048894.1|  TT12-2 MATE transporter                          89.0    1e-17   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                 88.6    1e-17   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                 88.6    2e-17   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg           88.6    2e-17   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg           88.2    2e-17   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                 88.2    2e-17   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                 88.2    2e-17   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    3e-17   
ref|XP_002282907.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     88.2    3e-17   
gb|AIW42902.1|  transparent testa 12                                  87.8    3e-17   
ref|XP_004252047.1|  PREDICTED: protein TRANSPARENT TESTA 12          87.8    3e-17   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    3e-17   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    4e-17   
ref|XP_011026194.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.8    4e-17   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    4e-17   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  85.9    5e-17   
ref|XP_010940925.1|  PREDICTED: protein TRANSPARENT TESTA 12          87.4    5e-17   
ref|XP_009412505.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.4    5e-17   
ref|XP_002300856.1|  hypothetical protein POPTR_0002s05600g           87.0    5e-17   
ref|XP_011032739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    6e-17   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein            86.3    7e-17   
ref|XP_010244723.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     87.0    7e-17   
gb|KDO36967.1|  hypothetical protein CISIN_1g044433mg                 84.7    8e-17   
ref|NP_001067276.1|  Os12g0615700                                     86.7    8e-17   
emb|CDP16063.1|  unnamed protein product                              86.7    1e-16   
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.7    1e-16   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    1e-16   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     86.3    1e-16   
gb|EAY83897.1|  hypothetical protein OsI_39119                        85.9    1e-16   
ref|XP_007146298.1|  hypothetical protein PHAVU_006G028700g           85.9    2e-16   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.9    2e-16   
ref|XP_007048896.1|  TT12-2 MATE transporter                          85.9    2e-16   
ref|XP_009376891.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.5    2e-16   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                          86.3    2e-16   
ref|NP_001280841.1|  protein TRANSPARENT TESTA 12-like                85.5    2e-16   
gb|EEC74654.1|  hypothetical protein OsI_10313                        85.1    2e-16   
emb|CDP11775.1|  unnamed protein product                              83.6    3e-16   
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                 83.6    3e-16   
gb|EEE58464.1|  hypothetical protein OsJ_09708                        85.1    3e-16   
gb|KJB49003.1|  hypothetical protein B456_008G097100                  84.7    3e-16   
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                 83.6    3e-16   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg          82.0    3e-16   
ref|XP_010054210.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    3e-16   
ref|XP_006469118.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    3e-16   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     85.1    3e-16   
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    3e-16   
ref|NP_001190792.1|  mate efflux domain-containing protein            85.1    4e-16   
gb|KCW89807.1|  hypothetical protein EUGRSUZ_A02048                   84.7    4e-16   
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     83.2    4e-16   
emb|CDP01534.1|  unnamed protein product                              84.7    4e-16   
ref|NP_001119025.1|  mate efflux domain-containing protein            84.7    4e-16   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    4e-16   
ref|XP_009791264.1|  PREDICTED: protein TRANSPARENT TESTA 12          85.1    4e-16   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12          84.7    4e-16   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    4e-16   
gb|ADO22709.1|  TT12-1 MATE transporter                               84.7    4e-16   
ref|XP_007018128.1|  MATE efflux family protein isoform 2             84.3    4e-16   
gb|KJB49000.1|  hypothetical protein B456_008G097100                  84.7    4e-16   
ref|XP_010320933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.7    5e-16   
gb|AGC55236.1|  TT12a                                                 84.3    5e-16   
gb|KHG27493.1|  Protein TRANSPARENT TESTA 12 -like protein            84.3    5e-16   
gb|AGW32085.1|  transparent testa 12                                  84.3    5e-16   
ref|XP_007217716.1|  hypothetical protein PRUPE_ppa004566mg           84.3    5e-16   
ref|XP_007018127.1|  MATE efflux family protein isoform 1             84.3    6e-16   
gb|KJB33382.1|  hypothetical protein B456_006G008600                  82.4    6e-16   
gb|AAL06936.1|  AT5g38030/F16F17_30                                   82.0    6e-16   
ref|XP_008362333.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.3    6e-16   
gb|KJB49002.1|  hypothetical protein B456_008G097100                  84.0    6e-16   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    7e-16   
emb|CBI19217.3|  unnamed protein product                              84.3    7e-16   
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                 83.6    7e-16   
ref|XP_010999529.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    7e-16   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like     84.0    7e-16   
ref|XP_009789598.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...  83.6    8e-16   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 110/130 (85%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQAFG
Sbjct  121  VETLCGQAFG  130



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQAFG
Sbjct  121  VETLCGQAFG  130



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFG  458
            ETLCGQAFG
Sbjct  121  ETLCGQAFG  129



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQA+G
Sbjct  121  VETLCGQAYG  130



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQA+G
Sbjct  121  VETLCGQAYG  130



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 105/129 (81%), Gaps = 3/129 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFG  458
            ETLCGQAFG
Sbjct  121  ETLCGQAFG  129



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 102/134 (76%), Gaps = 8/134 (6%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S         P    V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQSHP-------PAPPAVLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFG  458
            MGSAVETLCGQA+G
Sbjct  125  MGSAVETLCGQAYG  138



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            MINYLMSMSTQIFSG LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAASLGNTGIQLFAYGLMLGMGSAVETLCGQAFG  131



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 5/120 (4%)
 Frame = +3

Query  114  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGH+GNLELAAASLGNTGIQIF YGLMLGMGSAVETLCGQA+G
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAASLGNTGIQIFVYGLMLGMGSAVETLCGQAYG  120



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 105/134 (78%), Gaps = 8/134 (6%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFG  458
            MGSAVETLCGQA+G
Sbjct  125  MGSAVETLCGQAYG  138



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFG  458
            CGQAFG
Sbjct  123  CGQAFG  128



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFG  458
            CGQAFG
Sbjct  123  CGQAFG  128



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (77%), Gaps = 9/126 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFG  458
            CGQAFG
Sbjct  112  CGQAFG  117



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (77%), Gaps = 9/126 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFG  458
            CGQAFG
Sbjct  112  CGQAFG  117



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   169 bits (429),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQ++G
Sbjct  121  VETLCGQSYG  130



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFG  458
            GMGSAVETLCGQA+G
Sbjct  118  GMGSAVETLCGQAYG  132



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 102/135 (76%), Gaps = 6/135 (4%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFG  458
            GMGSAVETLCGQA+G
Sbjct  118  GMGSAVETLCGQAYG  132



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQ++G
Sbjct  121  VETLCGQSYG  130



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 99/129 (77%), Gaps = 4/129 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAASLGNTGI+ FAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAASLGNTGIKTFAYGLMLGMGSAV  119

Query  432  ETLCGQAFG  458
            ETLCGQAFG
Sbjct  120  ETLCGQAFG  128



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFG  458
            ETLCGQAFG
Sbjct  120  ETLCGQAFG  128



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFG  458
            ETLCGQAFG
Sbjct  120  ETLCGQAFG  128



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 103/127 (81%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  117  LCGQAYG  123



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 101/130 (78%), Gaps = 4/130 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFG  458
            VETLCGQA+G
Sbjct  121  VETLCGQAYG  130



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYG  130



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY+MSMSTQIFSG
Sbjct  36   KHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINYVMSMSTQIFSG  95

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            HLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQAFG
Sbjct  96   HLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAFG  136



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFG  458
            CGQAFG
Sbjct  123  CGQAFG  128



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   167 bits (422),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 103/129 (80%), Gaps = 5/129 (4%)
 Frame = +3

Query  75   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAV
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAV  125

Query  432  ETLCGQAFG  458
            ETLCGQA+G
Sbjct  126  ETLCGQAYG  134



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VY+INYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  63   VIVYLINYLMSMSTQIFSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  122



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA ASLGNTGIQIFAYGLMLGMGSAVET
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGASLGNTGIQIFAYGLMLGMGSAVET  120

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  121  LCGQAFG  127



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQAFG
Sbjct  119  CGQAFG  124



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL+LGMGSAVETLCGQA G
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLLGMGSAVETLCGQAHG  132



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  154

Query  441  CGQAFG  458
            CGQAFG
Sbjct  155  CGQAFG  160



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGM
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGM  121

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQAFG
Sbjct  122  GSAVETLCGQAFG  134



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  127



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 3/129 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAASLGN G+Q FAYGLMLGMGSAV
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAASLGNNGVQTFAYGLMLGMGSAV  120

Query  432  ETLCGQAFG  458
            ETLCGQA+G
Sbjct  121  ETLCGQAYG  129



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  127



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYG  130



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 6/132 (5%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFG  458
            SAVETLCGQAFG
Sbjct  121  SAVETLCGQAFG  132



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYG  124



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQAFG
Sbjct  119  CGQAFG  124



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  117  LCGQAYG  123



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 5/118 (4%)
 Frame = +3

Query  111  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 6/132 (5%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFG  458
            SAVETLCGQAFG
Sbjct  121  SAVETLCGQAFG  132



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYG  124



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   161 bits (408),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +3

Query  144  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  323
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  324  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG
Sbjct  76   IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  120



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 5/118 (4%)
 Frame = +3

Query  111  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV+
Sbjct  24   PLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAVI  80

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   VYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQAFG
Sbjct  119  CGQAFG  124



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRL  224
            P   P  L+  ++  S+     PLP S   ++    +   +S  LE IL DT IP  +RL
Sbjct  3    PVASPEKLSTPLLVPSDDD--QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRL  60

Query  225  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  404
             LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYG
Sbjct  61   PLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAASSLGNNGIQVFAYG  120

Query  405  LMLGMGSAVETLCGQAFG  458
            LMLGMGSAVETLCGQAFG
Sbjct  121  LMLGMGSAVETLCGQAFG  138



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+VY
Sbjct  23   PLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVY  82

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            M+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  83   MLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 94/126 (75%), Gaps = 8/126 (6%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  260
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETL  115

Query  441  CGQAFG  458
            CGQA+G
Sbjct  116  CGQAYG  121



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA+PAV+VYMINY+M+MSTQIF
Sbjct  35   HHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLASPAVIVYMINYVMAMSTQIF  94

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +GHLGNLELAAASLGN GIQ+FAYG+MLGMGSAVETLCGQA+G
Sbjct  95   AGHLGNLELAAASLGNNGIQVFAYGVMLGMGSAVETLCGQAYG  137



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFSG
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFSG  88

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            HLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   HLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  129



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  64   HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYG  104



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 96/127 (76%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 99/137 (72%), Gaps = 11/137 (8%)
 Frame = +3

Query  81   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  227
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  228  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL  407
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGL  120

Query  408  MLGMGSAVETLCGQAFG  458
            MLGMGSAVETLCGQA+G
Sbjct  121  MLGMGSAVETLCGQAYG  137



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
             PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +LAAPAV+V
Sbjct  22   QPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFLAAPAVMV  81

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            YMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  82   YMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYG  138



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  118

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  119  LCGQAFG  125



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 98/134 (73%), Gaps = 10/134 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  236
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAASLGN GIQIFAYGL+LG
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAASLGNNGIQIFAYGLLLG  118

Query  417  MGSAVETLCGQAFG  458
            MGSAVETLCGQA+G
Sbjct  119  MGSAVETLCGQAYG  132



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  134



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 104/140 (74%), Gaps = 7/140 (5%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQ  218
            P   P  L   ++  S+     PLP S  + +    PH    +S  LESIL DT +   +
Sbjct  3    PAASPEKLRTPLLGPSDDD--QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWAR  57

Query  219  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFA  398
            RL+LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FA
Sbjct  58   RLQLATIIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFA  117

Query  399  YGLMLGMGSAVETLCGQAFG  458
            YGLMLGMGSAVETLCGQA+G
Sbjct  118  YGLMLGMGSAVETLCGQAYG  137



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQAFG
Sbjct  119  CGQAFG  124



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H +  +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF
Sbjct  35   HHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIF  94

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +GHLGNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+G
Sbjct  95   AGHLGNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYG  137



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 94/119 (79%), Gaps = 7/119 (6%)
 Frame = +3

Query  111  PLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PAV
Sbjct  23   PLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPAV  78

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             VYM+NY+MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  79   TVYMLNYVMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  137



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL  S+ +     HE   +  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNIGKPNLHE---SDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+ AYGLMLGMGSAVETLCGQAFG
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQMLAYGLMLGMGSAVETLCGQAFG  124



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS     D       +  SP   ES ++ ELE++L D   P +QRL+ AT IE KLL 
Sbjct  1    MDSSRNDGVDQALLQRQL--SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLF  57

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVETL
Sbjct  58   NLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVETL  117

Query  441  CGQAFG  458
            CGQA+G
Sbjct  118  CGQAYG  123



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  117

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  118  LCGQAYG  124



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 96/127 (76%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  117  LCGQAFG  123



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 96/127 (76%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 7/124 (6%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-------SNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            +PL  SD   S  P   +++         ELE IL +T +P  +R+  ATW+ELK L +L
Sbjct  12   EPLLVSDEPSSPQPPSFTQSFSSRHGSDGELERILSNTSVPFAKRIGPATWVELKFLFHL  71

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VY+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCG
Sbjct  72   AAPAVIVYLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCG  131

Query  447  QAFG  458
            QA+G
Sbjct  132  QAYG  135



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 93/119 (78%), Gaps = 6/119 (5%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            Y PL + D + + P     E+ N ELE +L D   P + RL+ AT IE KLL  LAAPAV
Sbjct  10   YQPLLQPDQLSALP-----ESKNCELERVLADVETPLFLRLRKATMIETKLLFKLAAPAV  64

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VVYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  65   VVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAFG  123



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 97/121 (80%), Gaps = 8/121 (7%)
 Frame = +3

Query  117  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV+VYMINYLMSMST+IFSGHLGNLELAAASLGNTGIQ+F+YGL+LGMGSAVETLCGQA+
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAASLGNTGIQVFSYGLLLGMGSAVETLCGQAY  122

Query  456  G  458
            G
Sbjct  123  G  123



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  G  458
            G
Sbjct  118  G  118



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNLE
Sbjct  41   ELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNLE  100

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  101  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  135



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 97/130 (75%), Gaps = 12/130 (9%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEE--SEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N     PL +        PH +  +E+SN ELE +L D   P   RL+ AT IE 
Sbjct  1    MDSSQNDGVNQPLLQ--------PHADHGTESSNGELERVLSDVETPLSSRLRKATMIES  52

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  53   KLLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  112

Query  429  VETLCGQAFG  458
            VETLCGQAFG
Sbjct  113  VETLCGQAFG  122



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  G  458
            G
Sbjct  118  G  118



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  116  LCGQAFG  122



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+G
Sbjct  98   GNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYG  136



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 9/120 (8%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFSGHL
Sbjct  32   KTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFSGHL  91

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  92   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYG  130



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   154 bits (388),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  116



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 95/127 (75%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQAFG
Sbjct  117  LCGQAFG  123



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  113



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 9/120 (8%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   153 bits (387),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFG  458
            CGQA+G
Sbjct  121  CGQAYG  126



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFG  458
            CGQA+G
Sbjct  121  CGQAYG  126



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   153 bits (387),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 92/118 (78%), Gaps = 5/118 (4%)
 Frame = +3

Query  111  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V 
Sbjct  23   PLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSVT  79

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VYM+NY+MSMST I SGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  80   VYMLNYVMSMSTTIISGHLGNLELAAASLGNAGIQVFAYGLMLGMGSAVETLCGQAYG  137



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             ++SMSTQIF GHLGNLELAA SLGNTGIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLLLGMGSAVETLCGQAYG  116



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  93   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYG  131



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  132



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETL  119

Query  441  CGQAFG  458
            CGQA+G
Sbjct  120  CGQAYG  125



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  88   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  130



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 95/129 (74%), Gaps = 5/129 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAASLGNTGIQ FAYGLMLGMGSAV
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAASLGNTGIQGFAYGLMLGMGSAV  118

Query  432  ETLCGQAFG  458
            ETLCGQA+G
Sbjct  119  ETLCGQAYG  127



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 6/113 (5%)
 Frame = +3

Query  138  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
              MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  73   NTMSVSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  125



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  86   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  128



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 90/103 (87%), Gaps = 1/103 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  116



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 104/147 (71%), Gaps = 18/147 (12%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  197
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAASLGN
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAASLGN  115

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TGIQIFAYG+MLGMGSAVETLCGQA+G
Sbjct  116  TGIQIFAYGIMLGMGSAVETLCGQAYG  142



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            DP P  D  +S   H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+V
Sbjct  4    DP-PRLDFKLSY--HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIV  60

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y++N ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  61   YLLNNVVSMSTQIFCGHLGNLELAAVSLGNNGIQMFAYGLMLGMGSAVETLCGQAYG  117



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            F GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   FCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  118



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  132



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   FAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  132



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLG+TGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGHTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFG  458
            CGQA+G
Sbjct  121  CGQAYG  126



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = +3

Query  141  SPP-----HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            +PP     H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINY
Sbjct  18   APPSPGSGHGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINY  77

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  78   LMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  129



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NYLMS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYG  128



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            N  MS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYG  128



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 3/104 (3%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  64   FSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  107



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  117  LCGQAYG  123



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  117  LCGQAYG  123



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  72   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYG  113



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 9/121 (7%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAY  117

Query  456  G  458
            G
Sbjct  118  G  118



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 93/114 (82%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY++
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NYLMS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSA+ETLCGQA+G
Sbjct  75   NYLMSLSTRLFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSALETLCGQAYG  128



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQA+G
Sbjct  123  GSAVETLCGQAYG  135



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  132



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N ++SMS
Sbjct  10   SKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLNNVISMS  69

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TQIF GHLGNLELAA SLGN GIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  70   TQIFCGHLGNLELAAVSLGNNGIQVFAYGLLLGMGSAVETLCGQAYG  116



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  97   NLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  134



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 92/117 (79%), Gaps = 4/117 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  123



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 88/104 (85%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  132



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  113



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +INY MS STQIFSGHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  76   IINYTMSTSTQIFSGHLGNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYG  131



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 92/120 (77%), Gaps = 4/120 (3%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAFG  123



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   CGHLGNLELAAVSLGNNGIQVFAYGLMLGMGSAVETLCGQAYG  117



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFSG
Sbjct  29   KHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFSG  88

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            H+GNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  89   HIGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAFG  129



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY+INY MS STQIFSGHLGN
Sbjct  35   NEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVYIINYAMSTSTQIFSGHLGN  94

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  95   LELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAYG  131



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 2/133 (2%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQA+G
Sbjct  123  GSAVETLCGQAYG  135



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  30   RASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGHL  89

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            G LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  90   GTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  128



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQA+G
Sbjct  123  GSAVETLCGQAYG  135



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+G
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYG  118



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+G
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYG  118



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 91/117 (78%), Gaps = 6/117 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+G
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYG  118



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  
Sbjct  7    DINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFR  60

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPA++VYM+N L+SMSTQIF GHLGNLELAA SLG+TGIQ+FA+GLMLGMGSA ETLC
Sbjct  61   LAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVSLGSTGIQVFAFGLMLGMGSATETLC  120

Query  444  GQAFG  458
            GQA+G
Sbjct  121  GQAYG  125



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = +3

Query  117  PESDG----VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            P SD     ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+
Sbjct  16   PPSDHASPPLLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVI  75

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VYMINYLMSMSTQI SGHLGNLELAA+SLGN G+QIFAYGLMLGMGSAVETLCGQA+G
Sbjct  76   VYMINYLMSMSTQIVSGHLGNLELAASSLGNNGVQIFAYGLMLGMGSAVETLCGQAYG  133



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  171  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  350
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  351  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            ELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  93   ELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  128



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            MSTQI+ GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  123



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQA+G
Sbjct  123  GSAVETLCGQAYG  135



>ref|XP_009353369.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=133

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             Y PLP +    S   HEE +AS ELE +L DTG P  QRLK A WIE KLL  LAAPA+
Sbjct  15   TYPPLPSTKSFTSKHAHEE-QASGELEQVLCDTGKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL++  G
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLVCNG  120



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 95/139 (68%), Gaps = 13/139 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFG  458
            GLMLGMGSAVETLCGQA+G
Sbjct  121  GLMLGMGSAVETLCGQAYG  139



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFG  111



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFG  111



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  SSPPHEES-------EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S+PP   +       E S +LESIL D  +P  +R+  A+ +EL+LL  LAAPAVVVYMI
Sbjct  23   SAPPPATTSGGGGGHEVSGQLESILSDGSLPWPRRVLAASAVELRLLARLAAPAVVVYMI  82

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NYLMSMSTQIFSGHLG LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  83   NYLMSMSTQIFSGHLGTLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAYG  136



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFG  111



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+G
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYG  124



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 95/139 (68%), Gaps = 13/139 (9%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFG  458
            GLMLGMGSAVETLCGQA+G
Sbjct  121  GLMLGMGSAVETLCGQAYG  139



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  4    NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  58

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  59   TFIELKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  118

Query  414  GMGSAVETLCGQAFG  458
            GMGSAVETLCGQA+G
Sbjct  119  GMGSAVETLCGQAYG  133



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  75   LELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFG  111



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 7/114 (6%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            N  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  128



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFG  458
            GMGSAVETLCGQA+G
Sbjct  137  GMGSAVETLCGQAYG  151



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 7/127 (6%)
 Frame = +3

Query  90   SNGAAYDPLPESDGVVSSPPHEESEASNE----LESILMDTGIPRWQRLKLATWIELKLL  257
            S G  + P+  S+     P  E S   +     LE++L DT +P ++RL++ATWIELKLL
Sbjct  2    SQGQLHQPILASE---QEPAAEASSNGDRVDFLLETVLSDTQLPPFKRLRMATWIELKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV VY+IN  MS+ST+IF+GHLGNLELAAA+LGN+GIQ+ AYGLMLGMGSAVET
Sbjct  59   FRLAAPAVSVYVINNSMSLSTRIFAGHLGNLELAAATLGNSGIQLLAYGLMLGMGSAVET  118

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  119  LCGQAYG  125



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 6/119 (5%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA+
Sbjct  12   VHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAI  65

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+G
Sbjct  66   LVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYG  124



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 6/119 (5%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA+
Sbjct  12   VHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAI  65

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+G
Sbjct  66   LVYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYG  124



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  138



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 7/135 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFG  458
            GMGSAVETLCGQA+G
Sbjct  137  GMGSAVETLCGQAYG  151



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  141  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TQIFSGHLGNLELAA++LGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  79   TQIFSGHLGNLELAASALGNNGIQVFAYGLMLGMGSAVETLCGQAYG  125



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 89/116 (77%), Gaps = 7/116 (6%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +IN  MSMST+IFSGHLGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYG  126



>gb|KDP20759.1| hypothetical protein JCGZ_21230 [Jatropha curcas]
Length=318

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV V
Sbjct  9    EPILQSHSQPAAALH--NEVNSMLEKVLNDTELPYLKRIMLASAIELKLLYRLAGPAVFV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            YMIN  MS+ST+IF+GHLGNL+LAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  67   YMINNFMSLSTRIFAGHLGNLQLAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAFG  123



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF GHLGN
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIFVGHLGN  78

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+G
Sbjct  79   LELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYG  115



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAVVVYLLNNVISMSTQIFCGHLG  84

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  85   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  122



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+G
Sbjct  94   LGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYG  133



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 88/110 (80%), Gaps = 3/110 (3%)
 Frame = +3

Query  138  SSPP---HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  308
            SSP    H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  M
Sbjct  14   SSPEPELHAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFM  73

Query  309  SMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            S+ST++F+GHLGNLELAAA+LGN+GIQ+ AYG MLGMGSAVETLCGQA+G
Sbjct  74   SLSTRVFAGHLGNLELAAAALGNSGIQLLAYGFMLGMGSAVETLCGQAYG  123



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  64   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  101



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYG  106



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYG  106



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 7/116 (6%)
 Frame = +3

Query  132  VVSSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            ++ S P   +E S+        LE +L DT +P ++RL++ATWIELKLL  LAAPAV+VY
Sbjct  10   IIDSEPEPAAETSSNGDGVDFLLEKVLSDTQLPPFKRLRMATWIELKLLFRLAAPAVLVY  69

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            +IN  MS+ST++F+GHLGNLELAAA LGN+G+Q+ AYGLMLGMGSAVETLCGQA+G
Sbjct  70   VINNSMSLSTRVFAGHLGNLELAAAILGNSGVQLLAYGLMLGMGSAVETLCGQAYG  125



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYG  117



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y+IN LMSMST+IFSG LGNL+LAAASLGN GIQ FAYGLMLGMGSAVETLCGQA+G
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGIQSFAYGLMLGMGSAVETLCGQAYG  118



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYG  106



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYG  117



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 7/112 (6%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYG  132



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 7/112 (6%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYG  132



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 5/119 (4%)
 Frame = +3

Query  117  PESDGVVSSPPHEESEAS-----NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            P SD  +S P      +S      ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  121



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 91/125 (73%), Gaps = 14/125 (11%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFG  458
            GQA+G
Sbjct  127  GQAYG  131



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  63   FSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYG  106



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  76   LAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYG  110



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 98/141 (70%), Gaps = 14/141 (10%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFG  458
            AYGLMLGMGSAVETLCGQA+G
Sbjct  125  AYGLMLGMGSAVETLCGQAYG  145



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 91/125 (73%), Gaps = 14/125 (11%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFG  458
            GQA+G
Sbjct  127  GQAYG  131



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQ++G
Sbjct  120  GSAVETLCGQSYG  132



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYG  117



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQ++G
Sbjct  120  GSAVETLCGQSYG  132



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQ++G
Sbjct  120  GSAVETLCGQSYG  132



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P+ +S    ++  H  +E ++ LE +L DT +P  +R+ LA+ IELKLL  LA PAV V
Sbjct  9    EPILQSRSQPAAVLH--NEVNSRLEKVLNDTELPYLKRILLASAIELKLLFPLAGPAVFV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            YMIN LMS+ST+IF+GHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  67   YMINNLMSLSTRIFAGHLGNLELAAASLGNNGIQLFAYGLMLGMGSAVETLCGQAYG  123



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S ELE +L DT +P + RL+LA+WIEL+LL  LA PAV++Y+IN  MS+ST+I+ GHL
Sbjct  42   QPSTELEGVLSDTQLPLFNRLRLASWIELRLLFRLAGPAVMMYLINNAMSVSTRIYCGHL  101

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAAASLGN GIQ+F YGLMLGMGSAVETLCGQA+G
Sbjct  102  GNLELAAASLGNQGIQLFVYGLMLGMGSAVETLCGQAYG  140



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            T++FSGHLGNLELAA SLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  75   TRVFSGHLGNLELAAVSLGNSGIQLLAYGLMLGMGSAVETLCGQAYG  121



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYG  116



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 3/100 (3%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGH
Sbjct  7    ADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFSGH  63

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  64   LGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYG  103



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYG  120



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 93/128 (73%), Gaps = 3/128 (2%)
 Frame = +3

Query  81   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  254
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  255  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVE  434
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA SL N+G+Q+F YGLMLGMGSAVE
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVSLANSGVQLFVYGLMLGMGSAVE  119

Query  435  TLCGQAFG  458
            TLCGQ++G
Sbjct  120  TLCGQSYG  127



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLG  84

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  85   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  122



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLG  84

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  85   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  122



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLG
Sbjct  25   VSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLG  84

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  85   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  122



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA SLGN
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGN  69

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFG  458
            TGIQ+FAYGLMLGMGSA ETLCGQA+G
Sbjct  70   TGIQVFAYGLMLGMGSATETLCGQAYG  96



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAY  119



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF GHLG
Sbjct  24   VSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCGHLG  83

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+G
Sbjct  84   NLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYG  121



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPA++VY+IN  MS+ST++F+GHLGNLELAAA+LG + IQ+ AYGLMLGMGSAVETL
Sbjct  60   RLAAPAILVYLINNAMSLSTRVFAGHLGNLELAAATLGKSSIQL-AYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQA+G
Sbjct  119  CGQAYG  124



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF GHLG
Sbjct  24   VSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCGHLG  83

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+G
Sbjct  84   NLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYG  121



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLG
Sbjct  25   VSSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLG  84

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+G
Sbjct  85   NLELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYG  122



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYMIN  MS+ST++F
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYMINNAMSLSTRVF  93

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  94   CGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYG  136



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYG  116



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYG  116



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score =   139 bits (351),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  88   LGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  127



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYG  116



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  171  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  350
            +ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGNL
Sbjct  27   SELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGNL  86

Query  351  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            ELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+G
Sbjct  87   ELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYG  122



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAAASLGNTG+Q F +G+MLGMGSAVETLCGQA+G
Sbjct  94   LELAAASLGNTGVQGFVFGIMLGMGSAVETLCGQAYG  130



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             LELAAASLGNTG+Q FAYGLMLGMGSAVETLCGQA+G
Sbjct  73   TLELAAASLGNTGVQTFAYGLMLGMGSAVETLCGQAYG  110



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 88/126 (70%), Gaps = 4/126 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            +D +    + PL       S  P      S+ LE  L D  +  + R++ ATWIEL +L 
Sbjct  9    IDCAENEVHQPLLHYYKSFSPEPC----VSDLLEDTLSDNSLSLFWRIQRATWIELGILF  64

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAVVVY+ N L+SMSTQIF GHLGNLELAAASLGN GIQ FAYGLMLGMGSAVETL
Sbjct  65   HLAAPAVVVYLFNNLISMSTQIFCGHLGNLELAAASLGNNGIQTFAYGLMLGMGSAVETL  124

Query  441  CGQAFG  458
            CGQA+G
Sbjct  125  CGQAYG  130



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 9/127 (7%)
 Frame = +3

Query  84   DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVET
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVET  115

Query  438  LCGQAFG  458
            LCGQA+G
Sbjct  116  LCGQAYG  122



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+G
Sbjct  62   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYG  100



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  150  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
              GHLG LELAAASLGNTG+Q  AYGLMLGMGSAVETLCGQA+G
Sbjct  67   LCGHLGTLELAAASLGNTGVQTMAYGLMLGMGSAVETLCGQAYG  110



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
             PL E+      PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++V
Sbjct  12   QPLVENQ----PPPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y++N L++MSTQIF G LGNLELA ++L N GIQ+F YG+MLGMGSAVETLCGQA+G
Sbjct  68   YLLNNLLNMSTQIFCGQLGNLELAGSALANNGIQLFVYGVMLGMGSAVETLCGQAYG  124



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 5/117 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYG  116



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +3

Query  90   SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    LA
Sbjct  6    NKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFRLA  63

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
             PAV+VY++N + SMSTQIF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLCGQ
Sbjct  64   GPAVIVYLLNNVTSMSTQIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLCGQ  123

Query  450  AFG  458
            A+G
Sbjct  124  AYG  126



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLG
Sbjct  29   VSDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLG  88

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            NLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  89   NLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  126


 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 94/142 (66%), Gaps = 13/142 (9%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPR  212
            E+   +F  +   N + ++ N       P        PP      S+ELE IL +  +  
Sbjct  488  EEKREKFSTYRKINHMANNQNSLLRKHSP--------PP-----VSSELEDILSNMELSY  534

Query  213  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQI  392
             QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF GHLGNLELAAASLGNTGIQ+
Sbjct  535  SQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIFCGHLGNLELAAASLGNTGIQV  594

Query  393  FAYGLMLGMGSAVETLCGQAFG  458
            FAYGLMLGMGSAVETLCGQA+G
Sbjct  595  FAYGLMLGMGSAVETLCGQAYG  616



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRW-QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W + ++ A ++E KLLC LA PAV+VYM+NY+MSM+TQIFSGH
Sbjct  20   DDKNRLEVILSNADDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGH  79

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  80   LGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAYG  119



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +3

Query  123  SDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            ++ ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN 
Sbjct  10   NNPLLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINN  69

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             MS+ T+IF+GHLG+LELAA+SLGN+G  +F YGL+LGMGSAVETLCGQA G
Sbjct  70   GMSILTRIFAGHLGSLELAASSLGNSGFNMFTYGLLLGMGSAVETLCGQAHG  121



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVETLC
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVETLC  118

Query  444  GQAFG  458
            GQA+G
Sbjct  119  GQAYG  123



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAAASLGN G+Q F +G+MLGMGSAVETLCGQA+G
Sbjct  94   LELAAASLGNMGVQGFVFGIMLGMGSAVETLCGQAYG  130



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYG  120



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             LELAAASLGN G+Q FA+GLMLGMGSAVETLCGQA+G
Sbjct  75   TLELAAASLGNCGVQTFAFGLMLGMGSAVETLCGQAYG  112



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 4/122 (3%)
 Frame = +3

Query  93   NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAA  272
             G   +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  LAA
Sbjct  8    KGPPNEPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFRLAA  63

Query  273  PAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA  452
            PA++VY++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA
Sbjct  64   PAIIVYLLNNITSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQA  123

Query  453  FG  458
            +G
Sbjct  124  YG  125



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  72

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  73   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  121



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  73

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  74   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  122



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  100

Query  420  GSAVETLCGQAFG  458
            GSAVETLCGQA+G
Sbjct  101  GSAVETLCGQAYG  113



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 81/99 (82%), Gaps = 5/99 (5%)
 Frame = +3

Query  165  ASNELESILMDTGIPR-WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            AS +LES+L  +     W     A  IEL+LL  LAAPAVV YMINYLMSMSTQIFSGHL
Sbjct  11   ASAQLESVLTSSSSSFPWA----AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFSGHL  66

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAAASLGNTG+QIFAYGLMLGMGSAVETLCGQA+G
Sbjct  67   GNLELAAASLGNTGVQIFAYGLMLGMGSAVETLCGQAYG  105



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYG  124



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYG  124



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMSTQIF GH+
Sbjct  13   EISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMSTQIFCGHV  72

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+G
Sbjct  73   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYG  111



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score =   137 bits (345),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 65/76 (86%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +3

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLM
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLM  63

Query  411  LGMGSAVETLCGQAFG  458
            LGMGSAVETLCGQA+G
Sbjct  64   LGMGSAVETLCGQAYG  79



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 6/131 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESE-----ASNELESILMDTGIPRWQRLKLATWIE  245
            M +SNG   D   + D       HE         S+ELE IL +  + R +R+  AT++E
Sbjct  1    MGTSNGCRID-YADLDESYQPILHERRSFSGETVSSELEEILSNMELSRSRRILRATFLE  59

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            LK+L  LAAPA+VVY++N+L+S+STQIF GHLGNL+LA ASLG TGIQ+F +G+MLGMGS
Sbjct  60   LKILFPLAAPAIVVYLLNFLISISTQIFCGHLGNLQLAGASLGTTGIQVFIFGIMLGMGS  119

Query  426  AVETLCGQAFG  458
            AVETLCGQA+G
Sbjct  120  AVETLCGQAYG  130



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (71%), Gaps = 5/129 (4%)
 Frame = +3

Query  72   NSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            +S ++ +    Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK
Sbjct  7    DSRIEYAEDEPYEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELK  61

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            +L  LAAPA+VVY++N+L+S+ST +F GHLGNL+LAAASLGNTG+Q F YG++ GMGSAV
Sbjct  62   ILSRLAAPAIVVYLLNFLISISTHVFCGHLGNLQLAAASLGNTGVQGFVYGIVFGMGSAV  121

Query  432  ETLCGQAFG  458
            ETLCGQA+G
Sbjct  122  ETLCGQAYG  130



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +3

Query  138  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            + S+STQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  68   VTSVSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYG  119



>gb|ADE77677.1| unknown [Picea sitchensis]
Length=517

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 82/100 (82%), Gaps = 1/100 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRL-KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W+++ + A ++E KLL  LA PA+VVYM+NY+MSM+TQIF GH
Sbjct  23   DDKNRLELILSNADNLPWRKMMRAAVFLESKLLWSLALPAIVVYMVNYIMSMATQIFCGH  82

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  83   LGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYG  122



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY++N ++SMST I 
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYLLNNVVSMSTLIL  62

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
             GHLGNL+LA+ASL N GIQ+FA+GL+LGMGSAVETLCGQA+G
Sbjct  63   CGHLGNLQLASASLSNNGIQLFAFGLLLGMGSAVETLCGQAYG  105



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 81/102 (79%), Gaps = 3/102 (3%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAEAA---ASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+G
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYG  103



>ref|XP_010093281.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB53806.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=534

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+S N   ++P+  +    S    E    S+ELE  L ++ +  ++R + AT +ELK L 
Sbjct  1    MESINNDLHEPILATKEASSILSPEA--ISSELEETLSNSDLSYFRRFQAATCLELKTLY  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY++N + SMSTQI  GHLGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  59   RLAAPAVIVYLLNNVTSMSTQILCGHLGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETL  118

Query  441  CGQAFG  458
            CGQA+G
Sbjct  119  CGQAYG  124



>ref|XP_009614258.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=432

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+G
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYG  124



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL D  +   +RL  AT +E++LL  LAAPAVVVYM+N L+S+ TQ+FSGHLGN
Sbjct  14   SRRLESILADLTMSWPRRLWSATTVEMQLLFPLAAPAVVVYMLNNLLSLGTQVFSGHLGN  73

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            LELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  74   LELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105