BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030J12

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  139   2e-36   Ipomoea batatas [batate]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   5e-32   Nicotiana sylvestris
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               127   6e-32   Nicotiana tabacum [American tobacco]
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    127   9e-32   Nicotiana tomentosiformis
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           124   6e-31   
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    124   1e-30   Solanum tuberosum [potatoes]
ref|NP_001275483.1|  HQT                                                124   1e-30   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               124   1e-30   Solanum tuberosum [potatoes]
emb|CDP02827.1|  unnamed protein product                                122   3e-30   Coffea canephora [robusta coffee]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    122   5e-30   Platycodon grandiflorus [balloon-flower]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    120   2e-29   Nicotiana tomentosiformis
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    119   4e-29   Nicotiana sylvestris
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         117   2e-28   Coffea arabica [arabica coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    117   2e-28   Coffea canephora [robusta coffee]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    117   2e-28   Coffea canephora [robusta coffee]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    117   2e-28   Coffea arabica [arabica coffee]
gb|AEK80405.1|  HQT                                                     116   7e-28   Lonicera japonica [Japanese honeysuckle]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    115   2e-27   Lonicera japonica [Japanese honeysuckle]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    113   8e-27   Cynara cardunculus var. scolymus [artichoke]
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    113   9e-27   Cynara cardunculus var. altilis [cultivated cardoon]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    112   2e-26   Cynara cardunculus var. scolymus [artichoke]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         109   2e-25   Fagopyrum tataricum [Kangra buckwheat]
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              108   3e-25   Cynara cardunculus var. scolymus [artichoke]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      108   4e-25   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006826659.1|  hypothetical protein AMTR_s00137p00027820          103   5e-25   
gb|ABR14148.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    102   6e-25   Coffea arabica [arabica coffee]
gb|AFR40280.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    102   6e-25   Populus alba [abele]
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   9e-25   Vitis vinifera
emb|CAN82918.1|  hypothetical protein VITISV_023290                     107   9e-25   Vitis vinifera
gb|AFR40289.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    102   1e-24   Populus fremontii
gb|AFR40282.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    102   1e-24   Populus alba [abele]
gb|AFR40294.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   1e-24   Populus fremontii
gb|AFR40273.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    100   1e-24   Populus trichocarpa [western balsam poplar]
gb|AFR40292.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   1e-24   Populus fremontii
gb|AFR40293.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   1e-24   Populus fremontii
gb|AFR40306.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   1e-24   Populus nigra [black poplar]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    107   1e-24   Nicotiana tomentosiformis
gb|AFR40286.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   1e-24   Populus fremontii
gb|AFR40291.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   2e-24   Populus fremontii
gb|AFR40266.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   2e-24   Populus trichocarpa [western balsam poplar]
gb|AFR40271.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   2e-24   Populus trichocarpa [western balsam poplar]
gb|AFR40272.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   2e-24   Populus trichocarpa [western balsam poplar]
gb|AFR40277.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    101   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    106   2e-24   Nicotiana sylvestris
emb|CBI25231.3|  unnamed protein product                                105   3e-24   Vitis vinifera
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    105   4e-24   Cynara cardunculus var. scolymus [artichoke]
gb|AFR40305.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    100   4e-24   Populus nigra [black poplar]
gb|KJB56501.1|  hypothetical protein B456_009G122600                    105   5e-24   Gossypium raimondii
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             104   9e-24   Eutrema salsugineum [saltwater cress]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    104   1e-23   Cynara cardunculus [cardoon]
emb|CAT00088.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    102   1e-23   Coffea arabica [arabica coffee]
gb|KJB56505.1|  hypothetical protein B456_009G122600                    103   1e-23   Gossypium raimondii
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    104   1e-23   Coffea canephora [robusta coffee]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    104   1e-23   Coffea canephora [robusta coffee]
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    103   1e-23   Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      103   2e-23   Coffea canephora [robusta coffee]
emb|CDO98242.1|  unnamed protein product                                103   2e-23   Coffea canephora [robusta coffee]
gb|AFR40295.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...  99.0    2e-23   Populus fremontii
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    103   2e-23   Coffea canephora [robusta coffee]
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    103   2e-23   Lonicera japonica [Japanese honeysuckle]
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    103   2e-23   Theobroma cacao [chocolate]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    103   2e-23   Populus euphratica
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           103   3e-23   Coffea arabica [arabica coffee]
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    103   3e-23   Hibiscus cannabinus [bimli-jute]
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    103   4e-23   Coffea arabica [arabica coffee]
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    103   4e-23   Platycodon grandiflorus [balloon-flower]
emb|CDY05770.1|  BnaC07g00330D                                          102   4e-23   
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    102   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       102   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    103   6e-23   Gossypium hirsutum [American cotton]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    102   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    102   7e-23   Populus euphratica
ref|XP_006368492.1|  transferase family protein                         102   9e-23   Populus trichocarpa [western balsam poplar]
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           102   9e-23   Medicago truncatula
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    101   1e-22   Populus tomentosa [Chinese white poplar]
emb|CDY31956.1|  BnaA07g00390D                                          101   1e-22   Brassica napus [oilseed rape]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   1e-22   Brassica rapa
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   1e-22   Solanum lycopersicum
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    101   1e-22   Ipomoea batatas [batate]
gb|ABR17170.1|  unknown                                                 101   2e-22   Picea sitchensis
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    101   2e-22   Solanum tuberosum [potatoes]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   101   2e-22   Capsicum annuum
ref|XP_007099552.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  99.0    2e-22   
gb|AFS68800.1|  hydroxycinnamoyl transferase                            101   2e-22   Lonicera japonica [Japanese honeysuckle]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    101   2e-22   Larix kaempferi [karamatsu]
ref|XP_002894568.1|  transferase family protein                         100   2e-22   Arabidopsis lyrata subsp. lyrata
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         100   2e-22   Jatropha curcas
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    100   4e-22   
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    100   4e-22   Glycine max [soybeans]
ref|XP_007099550.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  99.4    4e-22   
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...  99.8    6e-22   Pinus pinaster [cluster pine]
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...  99.8    6e-22   Pinus radiata
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.8    6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  99.8    7e-22   
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase         99.8    7e-22   Medicago truncatula
ref|XP_008461189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    1e-21   
ref|XP_010481008.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.1    1e-21   
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.4    2e-21   
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  98.6    2e-21   Glycine soja [wild soybean]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                   99.4    2e-21   Eucalyptus grandis [rose gum]
gb|KDP38692.1|  hypothetical protein JCGZ_04045                       98.2    2e-21   Jatropha curcas
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  97.4    3e-21   
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  97.8    3e-21   Erythroxylum coca [coca]
gb|KDO55352.1|  hypothetical protein CISIN_1g014116mg                 94.0    3e-21   Citrus sinensis [apfelsine]
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    4e-21   Glycine max [soybeans]
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.4    4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg           97.4    5e-21   Capsella rubella
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  97.1    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007149778.1|  hypothetical protein PHAVU_005G098400g           93.2    6e-21   Phaseolus vulgaris [French bean]
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    97.1    7e-21   Cynara cardunculus var. scolymus [artichoke]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           97.1    7e-21   Cynara cardunculus var. scolymus [artichoke]
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            97.1    7e-21   Cynara cardunculus var. scolymus [artichoke]
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.7    8e-21   Pyrus x bretschneideri [bai li]
ref|XP_007099551.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.9    9e-21   
gb|KJB71590.1|  hypothetical protein B456_011G1315001                 95.9    9e-21   Gossypium raimondii
gb|AEJ88365.1|  hydroxycinnamoyltransferase                           96.7    9e-21   Cucumis sativus [cucumbers]
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g           96.7    9e-21   Phaseolus vulgaris [French bean]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase               96.7    9e-21   Phaseolus vulgaris [French bean]
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g           96.7    1e-20   Phaseolus vulgaris [French bean]
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.3    1e-20   Citrus sinensis [apfelsine]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.3    1e-20   
ref|XP_006427659.1|  hypothetical protein CICLE_v10026558mg           93.6    1e-20   
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.3    1e-20   
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...  96.3    1e-20   
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.7    1e-20   Camelina sativa [gold-of-pleasure]
gb|KJB54981.1|  hypothetical protein B456_009G057200                  95.9    1e-20   Gossypium raimondii
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.9    2e-20   Nicotiana tomentosiformis
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.9    2e-20   Nicotiana tomentosiformis
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  95.5    2e-20   Gossypium arboreum [tree cotton]
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    3e-20   Fragaria vesca subsp. vesca
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.5    3e-20   Glycine max [soybeans]
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like     95.1    3e-20   Prunus mume [ume]
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                  95.1    3e-20   Arabis alpina [alpine rockcress]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.1    3e-20   Malus domestica [apple tree]
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  95.1    3e-20   Brassica rapa
emb|CDY22880.1|  BnaA01g18180D                                        95.1    3e-20   Brassica napus [oilseed rape]
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  95.1    3e-20   
gb|KJB71578.1|  hypothetical protein B456_011G130700                  94.0    4e-20   Gossypium raimondii
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.7    4e-20   Camelina sativa [gold-of-pleasure]
gb|KJB71581.1|  hypothetical protein B456_011G130700                  93.6    5e-20   Gossypium raimondii
gb|KJB71580.1|  hypothetical protein B456_011G130700                  93.6    5e-20   Gossypium raimondii
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase         94.4    5e-20   Medicago truncatula
gb|KJB71596.1|  hypothetical protein B456_011G132100                  94.4    5e-20   Gossypium raimondii
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like     94.4    5e-20   Pyrus x bretschneideri [bai li]
emb|CBI83579.1|  hydroxycinnamoyl transferase                         94.4    5e-20   Plectranthus scutellarioides
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.4    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.0    7e-20   Elaeis guineensis
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  94.0    7e-20   Leucaena leucocephala [cassie]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.0    7e-20   Nelumbo nucifera [Indian lotus]
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  94.0    8e-20   Gossypium arboreum [tree cotton]
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...  94.0    8e-20   Ricinus communis
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  94.0    9e-20   Glycine max [soybeans]
gb|KJB71577.1|  hypothetical protein B456_011G130700                  93.6    1e-19   Gossypium raimondii
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  93.6    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  93.6    1e-19   
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg           93.2    2e-19   Capsella rubella
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  92.8    2e-19   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  94.4    2e-19   
gb|ADG46003.1|  hydroxycinnamoyl transferase                          92.8    2e-19   Salvia miltiorrhiza [Chinese salvia]
emb|CDY44162.1|  BnaC01g22120D                                        92.4    2e-19   Brassica napus [oilseed rape]
gb|KJB68220.1|  hypothetical protein B456_010G233100                  89.7    2e-19   Gossypium raimondii
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    3e-19   Nicotiana sylvestris
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg           92.4    3e-19   Capsella rubella
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  92.4    3e-19   Phoenix dactylifera
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  92.4    3e-19   
dbj|BAF49306.1|  putative acyltransferase                             91.7    5e-19   Clitoria ternatea
dbj|BAF49305.1|  putative acyltransferase                             91.7    6e-19   Clitoria ternatea
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  91.7    6e-19   Glycine soja [wild soybean]
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g           91.7    6e-19   Populus trichocarpa [western balsam poplar]
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.7    6e-19   Glycine max [soybeans]
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760        91.7    7e-19   Amborella trichopoda
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    7e-19   Phoenix dactylifera
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg           91.3    7e-19   Prunus persica
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  91.3    8e-19   Eucalyptus grandis [rose gum]
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g           91.3    8e-19   
gb|KJB54946.1|  hypothetical protein B456_009G055900                  91.3    9e-19   Gossypium raimondii
gb|KJB54948.1|  hypothetical protein B456_009G055900                  91.3    9e-19   Gossypium raimondii
ref|XP_007149776.1|  hypothetical protein PHAVU_005G098200g           85.9    9e-19   Phaseolus vulgaris [French bean]
gb|AFF19202.1|  BAHD acyltransferase                                  90.9    1e-18   Erythroxylum coca [coca]
gb|ACD03271.1|  hydroxycinnamoyl transferase                          87.0    1e-18   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    1e-18   Populus euphratica
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  90.5    2e-18   Populus euphratica
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             88.6    2e-18   Erythranthe guttata [common monkey flower]
gb|EPS58183.1|  hypothetical protein M569_16633                       86.3    3e-18   Genlisea aurea
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.4    4e-18   Sesamum indicum [beniseed]
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.4    4e-18   
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g           89.0    4e-18   Phaseolus vulgaris [French bean]
gb|EPS58233.1|  hypothetical protein M569_16582                       85.5    5e-18   Genlisea aurea
ref|XP_007149789.1|  hypothetical protein PHAVU_005G0988000g          86.7    5e-18   Phaseolus vulgaris [French bean]
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  89.0    5e-18   Sesamum indicum [beniseed]
gb|KJB68259.1|  hypothetical protein B456_010G235000                  88.2    5e-18   Gossypium raimondii
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  89.0    6e-18   Morus notabilis
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg              89.0    6e-18   Erythranthe guttata [common monkey flower]
gb|KJB68256.1|  hypothetical protein B456_010G234800                  89.0    6e-18   Gossypium raimondii
gb|AGH61997.1|  rosmarinic acid synthase                              88.6    7e-18   Perilla frutescens [beefsteak-mint]
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase              88.6    7e-18   Trifolium pratense [peavine clover]
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg              89.4    7e-18   Erythranthe guttata [common monkey flower]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase               88.6    7e-18   Trifolium pratense [peavine clover]
gb|ABI48360.1|  putative alcohol acyltransferase 1                    88.6    8e-18   Lavandula angustifolia [lavender]
gb|KJB68255.1|  hypothetical protein B456_010G234700                  88.6    9e-18   Gossypium raimondii
gb|KJB68253.1|  hypothetical protein B456_010G234500                  88.2    1e-17   Gossypium raimondii
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  89.0    1e-17   
ref|XP_006427033.1|  hypothetical protein CICLE_v10026791mg           83.6    1e-17   
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  87.8    1e-17   Gossypium arboreum [tree cotton]
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  87.4    2e-17   
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  87.4    2e-17   Elaeis guineensis
gb|KJB68229.1|  hypothetical protein B456_010G233600                  87.0    2e-17   Gossypium raimondii
gb|KJB68227.1|  hypothetical protein B456_010G233600                  87.0    2e-17   Gossypium raimondii
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...  86.7    4e-17   Melissa officinalis [sweet balm]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    4e-17   Cicer arietinum [garbanzo]
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  86.7    4e-17   Populus euphratica
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g           86.7    4e-17   
ref|XP_007011892.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...  86.3    6e-17   
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    7e-17   
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    8e-17   Setaria italica
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.9    8e-17   Populus euphratica
gb|ADB44897.1|  hydroxycinnamoyl transferase                          85.5    1e-16   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_007149773.1|  hypothetical protein PHAVU_005G097900g           84.0    1e-16   Phaseolus vulgaris [French bean]
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.0    1e-16   
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.1    1e-16   
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  85.5    1e-16   Prunus mume [ume]
gb|AEA36976.1|  rosmarinic acid synthase                              85.5    1e-16   Lavandula angustifolia [lavender]
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...  84.3    2e-16   Glechoma hederacea [gill-over-the-ground]
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    2e-16   Prunus mume [ume]
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    2e-16   Populus euphratica
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g           84.3    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  84.3    3e-16   Eucalyptus grandis [rose gum]
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g           84.3    3e-16   
ref|XP_006436001.1|  hypothetical protein CICLE_v10033907mg           80.5    3e-16   
ref|XP_007149785.1|  hypothetical protein PHAVU_005G0986000g          78.6    4e-16   Phaseolus vulgaris [French bean]
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.6    5e-16   Nelumbo nucifera [Indian lotus]
gb|AJA31666.1|  rosmarinic acid synthase                              83.6    5e-16   Salvia miltiorrhiza [Chinese salvia]
gb|ADA60182.1|  rosmarinic acid synthase                              83.6    5e-16   Salvia miltiorrhiza [Chinese salvia]
ref|NP_001145871.1|  uncharacterized protein LOC100279386             83.6    5e-16   
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                        83.6    6e-16   Glechoma hederacea [gill-over-the-ground]
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             83.6    6e-16   Selaginella moellendorffii
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...  83.2    6e-16   Glechoma hederacea [gill-over-the-ground]
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg           83.2    6e-16   
gb|KJB68258.1|  hypothetical protein B456_010G234900                  83.2    6e-16   Gossypium raimondii
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2           83.2    6e-16   Zea mays [maize]
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg           83.2    7e-16   
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    9e-16   Prunus mume [ume]
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg           82.8    9e-16   Prunus persica
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    9e-16   Vitis vinifera
ref|XP_001756433.1|  predicted protein                                82.4    1e-15   
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            82.8    1e-15   Selaginella moellendorffii
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.4    1e-15   Prunus mume [ume]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...  82.4    1e-15   Panicum virgatum
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.4    1e-15   Prunus mume [ume]
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...  82.0    1e-15   
ref|XP_004295153.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  82.8    2e-15   Fragaria vesca subsp. vesca
gb|AGW27211.1|  rosmarinic acid synthase 6                            81.6    2e-15   Salvia miltiorrhiza [Chinese salvia]
gb|EPS67512.1|  hypothetical protein M569_07262                       81.6    3e-15   Genlisea aurea
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  81.6    3e-15   Pyrus x bretschneideri [bai li]
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...  81.6    3e-15   Plectranthus scutellarioides
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg           81.6    3e-15   Prunus persica
ref|XP_007011897.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  79.7    3e-15   
ref|XP_006427031.1|  hypothetical protein CICLE_v10027308mg           77.8    3e-15   
ref|XP_010452842.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  81.3    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006427036.1|  hypothetical protein CICLE_v10026670mg           78.2    4e-15   
gb|AGW27210.1|  rosmarinic acid synthase 5                            80.9    4e-15   Salvia miltiorrhiza [Chinese salvia]
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              80.9    4e-15   Erythranthe guttata [common monkey flower]
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                  80.9    5e-15   Arabis alpina [alpine rockcress]
gb|EMT01833.1|  Anthranilate N-benzoyltransferase protein 1           78.6    7e-15   
dbj|BAJ89730.1|  predicted protein                                    80.1    8e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                        80.1    8e-15   Glechoma hederacea [gill-over-the-ground]
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  80.1    8e-15   Oryza brachyantha
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg           80.1    1e-14   Citrus clementina [clementine]
dbj|BAJ91003.1|  predicted protein                                    76.6    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91746.1|  predicted protein                                    80.1    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGW27208.1|  rosmarinic acid synthase 3                            79.7    1e-14   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg           79.3    1e-14   
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg           79.7    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.3    1e-14   
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.3    2e-14   
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640        79.3    2e-14   
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...  79.3    2e-14   
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  79.0    2e-14   
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  79.0    2e-14   
gb|EMS50893.1|  Anthranilate N-benzoyltransferase protein 1           75.5    3e-14   
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.6    3e-14   
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.6    3e-14   
ref|XP_006656715.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.6    4e-14   
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  77.8    5e-14   
ref|XP_006465545.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    5e-14   
gb|KJB71583.1|  hypothetical protein B456_011G130900                  77.4    5e-14   
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.8    5e-14   
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...  77.8    5e-14   
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg           77.8    7e-14   
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    8e-14   
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    9e-14   
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.0    1e-13   
gb|EPS67739.1|  hypothetical protein M569_07035                       77.0    1e-13   
gb|AGW27209.1|  rosmarinic acid synthase 4                            76.6    1e-13   
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2    76.6    1e-13   
ref|NP_001169127.1|  hypothetical protein                             76.6    1e-13   
ref|XP_004964653.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.6    1e-13   
gb|EYU24589.1|  hypothetical protein MIMGU_mgv1a0237891mg             73.2    2e-13   
gb|EEE65225.1|  hypothetical protein OsJ_20376                        74.3    2e-13   
gb|EAY94737.1|  hypothetical protein OsI_16513                        73.6    2e-13   
ref|XP_010483334.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    2e-13   
gb|EAY99938.1|  hypothetical protein OsI_21941                        76.3    2e-13   
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  76.3    2e-13   
dbj|BAJ93247.1|  predicted protein                                    76.3    2e-13   
dbj|BAJ95750.1|  predicted protein                                    76.3    2e-13   
ref|XP_002866234.1|  transferase family protein                       76.3    2e-13   
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.9    3e-13   
ref|XP_006648830.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    3e-13   
ref|XP_006656713.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  74.3    3e-13   
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1           75.9    3e-13   
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.5    4e-13   
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  75.5    4e-13   
ref|XP_003629311.1|  Anthranilate N-benzoyltransferase protein        72.4    5e-13   
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.1    5e-13   
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  75.1    5e-13   
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  74.7    6e-13   
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  74.7    8e-13   
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770        74.3    8e-13   
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  74.3    8e-13   
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg           74.7    8e-13   
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3    74.3    9e-13   
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760        74.3    9e-13   
ref|NP_001053225.1|  Os04g0500700                                     74.3    1e-12   
ref|NP_001056998.1|  Os06g0184900                                     74.3    1e-12   
ref|NP_001057003.1|  Os06g0185500                                     73.9    1e-12   
emb|CAE01635.3|  OSJNBa0029H02.19                                     74.3    1e-12   
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    1e-12   
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    1e-12   
gb|EAY99941.1|  hypothetical protein OsI_21944                        73.9    1e-12   
ref|XP_003564188.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.9    1e-12   
emb|CDM84451.1|  unnamed protein product                              73.6    2e-12   
gb|EEE65224.1|  hypothetical protein OsJ_20373                        73.6    2e-12   
gb|ACN35114.1|  unknown                                               71.2    2e-12   
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1    73.6    2e-12   
ref|XP_004964652.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.2    2e-12   
ref|XP_002437977.1|  hypothetical protein SORBIDRAFT_10g005780        73.2    3e-12   
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.8    3e-12   
gb|EAZ23787.1|  hypothetical protein OsJ_07497                        72.8    4e-12   
ref|XP_006656716.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  71.2    4e-12   
ref|NP_001047408.1|  Os02g0611800                                     72.4    4e-12   
ref|XP_004964655.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.4    5e-12   
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...  72.0    5e-12   
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.0    6e-12   
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg              72.0    7e-12   
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  71.6    7e-12   
emb|CDX88644.1|  BnaA03g10050D                                        71.6    8e-12   
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  71.6    8e-12   
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  71.6    9e-12   
ref|XP_006432977.1|  hypothetical protein CICLE_v10002415mg           69.3    9e-12   
gb|AFW72297.1|  hypothetical protein ZEAMMB73_779483                  68.9    9e-12   
gb|EMT01178.1|  hypothetical protein F775_42912                       66.6    1e-11   
ref|NP_001151137.1|  LOC100284770                                     71.2    1e-11   
ref|XP_003578136.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.9    1e-11   
ref|NP_001142105.1|  hypothetical protein                             70.9    1e-11   
ref|XP_006453587.1|  hypothetical protein CICLE_v10010857mg           68.2    1e-11   
gb|EMS64907.1|  Anthranilate N-benzoyltransferase protein 3           68.2    1e-11   
emb|CDY11845.1|  BnaC03g12710D                                        71.6    2e-11   
dbj|BAK06288.1|  predicted protein                                    70.5    2e-11   
dbj|BAK06725.1|  predicted protein                                    70.5    2e-11   
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.5    2e-11   
ref|NP_001146406.1|  hypothetical protein                             70.5    2e-11   
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.5    2e-11   
ref|XP_008673709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.1    3e-11   
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780        69.7    4e-11   
dbj|BAJ87836.1|  predicted protein                                    69.7    4e-11   
tpg|DAA53444.1|  TPA: hypothetical protein ZEAMMB73_481443            69.7    4e-11   
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  69.7    4e-11   
ref|XP_006365664.1|  PREDICTED: uncharacterized protein LOC102602033  67.0    5e-11   
emb|CDX88645.1|  BnaA03g10040D                                        69.3    5e-11   
ref|XP_004973560.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  69.3    6e-11   
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  69.3    6e-11   
gb|KJB68254.1|  hypothetical protein B456_010G234600                  68.6    6e-11   
gb|EPS61293.1|  hypothetical protein M569_13504                       68.9    6e-11   
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.9    7e-11   
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.9    8e-11   
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1           68.6    8e-11   
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.6    9e-11   
ref|XP_004977868.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.6    9e-11   
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...  68.2    1e-10   
ref|NP_001132890.1|  LOC100194386                                     68.2    1e-10   
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1           68.2    1e-10   
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  68.2    1e-10   
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    2e-10   
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760        67.8    2e-10   
gb|EMT01131.1|  Anthranilate N-benzoyltransferase protein 1           67.0    3e-10   
ref|XP_002457339.1|  hypothetical protein SORBIDRAFT_03g005840        67.0    3e-10   
gb|EMT31750.1|  Anthranilate N-benzoyltransferase protein 3           64.7    4e-10   
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg           66.6    4e-10   
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.6    4e-10   
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.6    4e-10   
tpg|DAA53596.1|  TPA: hypothetical protein ZEAMMB73_852753            63.9    5e-10   
gb|ACF87435.1|  unknown                                               65.9    7e-10   
gb|EMS54072.1|  Anthranilate N-benzoyltransferase protein 3           65.9    8e-10   
ref|XP_007099549.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  62.0    8e-10   
ref|XP_007216080.1|  hypothetical protein PRUPE_ppa018070mg           62.8    8e-10   
ref|NP_001147464.1|  anthranilate N-benzoyltransferase protein 1      65.9    8e-10   
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    8e-10   
ref|XP_004956854.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    9e-10   
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    9e-10   
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.9    9e-10   
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.5    1e-09   
ref|XP_010682493.1|  PREDICTED: anthranilate N-benzoyltransferase...  63.9    1e-09   
tpg|DAA53591.1|  TPA: hypothetical protein ZEAMMB73_253092            63.2    1e-09   
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg              65.5    1e-09   
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  65.1    1e-09   
dbj|BAD08987.1|  hypothetical protein                                 62.8    1e-09   
ref|NP_001175677.1|  Os08g0543200                                     62.8    2e-09   
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972  65.9    2e-09   
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...  64.7    2e-09   
gb|AAZ80048.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  63.9    2e-09   
gb|AAZ80047.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...  63.9    2e-09   
gb|EMT11026.1|  Anthranilate N-benzoyltransferase protein 2           64.3    2e-09   
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  64.3    3e-09   
gb|EEE69087.1|  hypothetical protein OsJ_28145                        62.8    3e-09   
gb|EMS66509.1|  Anthranilate N-benzoyltransferase protein 3           62.8    3e-09   
dbj|BAK07832.1|  predicted protein                                    64.3    3e-09   
ref|NP_001150433.1|  LOC100284063                                     63.9    3e-09   
emb|CDM81864.1|  unnamed protein product                              63.9    4e-09   
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  63.9    4e-09   
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  63.5    4e-09   
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg          63.5    5e-09   
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  63.5    5e-09   
gb|AFW62334.1|  anthranilate N-benzoyltransferase protein 1           63.5    5e-09   
ref|XP_002457418.1|  hypothetical protein SORBIDRAFT_03g006970        63.2    6e-09   
ref|NP_001146402.1|  uncharacterized protein LOC100279982             62.8    8e-09   
tpg|DAA53439.1|  TPA: hypothetical protein ZEAMMB73_693497            62.8    9e-09   
ref|XP_010229741.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.8    9e-09   
ref|XP_008673747.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  62.8    9e-09   
gb|ACG32145.1|  anthranilate N-benzoyltransferase protein 1           62.4    1e-08   
gb|EAZ07852.1|  hypothetical protein OsI_30111                        62.4    1e-08   
gb|EMS55670.1|  Anthranilate N-benzoyltransferase protein 2           61.6    1e-08   
tpg|DAA53440.1|  TPA: hypothetical protein ZEAMMB73_693497            62.0    1e-08   
tpg|DAA53592.1|  TPA: hypothetical protein ZEAMMB73_253092            62.0    1e-08   
tpg|DAA53590.1|  TPA: hypothetical protein ZEAMMB73_253092            62.0    2e-08   
tpg|DAA53598.1|  TPA: hypothetical protein ZEAMMB73_741939            61.2    2e-08   
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.6    2e-08   
ref|XP_002462399.1|  hypothetical protein SORBIDRAFT_02g025010        62.0    2e-08   
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.6    2e-08   
gb|EMT10230.1|  hypothetical protein F775_52273                       61.2    2e-08   
ref|XP_008673748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.6    2e-08   
ref|XP_003565078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.6    2e-08   
gb|ACG34906.1|  anthranilate N-benzoyltransferase protein 1           61.6    2e-08   
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  61.6    2e-08   
ref|XP_008349957.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.9    3e-08   
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  61.2    3e-08   
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  61.2    3e-08   
ref|XP_004968189.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.8    4e-08   
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase   60.8    4e-08   
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...  60.8    5e-08   
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...  60.5    5e-08   
gb|AGT15915.1|  anthranilate N-benzoyltransferase protein             60.5    5e-08   
ref|XP_003567478.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  60.5    6e-08   
gb|EMT19683.1|  Anthranilate N-benzoyltransferase protein 1           60.5    6e-08   
gb|EMS49606.1|  Anthranilate N-benzoyltransferase protein 1           58.2    8e-08   
gb|ABR16341.1|  unknown                                               59.7    9e-08   
gb|EMT06789.1|  Anthranilate N-benzoyltransferase protein 1           59.3    1e-07   
gb|ABR16595.1|  unknown                                               59.3    1e-07   
ref|XP_010229918.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  59.3    1e-07   
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  58.9    2e-07   
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...  58.9    2e-07   
ref|XP_010533495.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.9    2e-07   
ref|NP_001062400.1|  Os08g0543400                                     58.9    2e-07   
ref|XP_007206604.1|  hypothetical protein PRUPE_ppa020718mg           58.5    2e-07   
gb|ABR16407.1|  unknown                                               58.9    2e-07   
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.9    2e-07   
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  58.9    2e-07   
gb|AFY17066.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...  58.5    2e-07   
gb|EAZ05968.1|  hypothetical protein OsI_28210                        56.2    2e-07   
gb|EMS65854.1|  Anthranilate N-benzoyltransferase protein 1           58.5    2e-07   
ref|XP_002457417.1|  hypothetical protein SORBIDRAFT_03g006960        58.5    2e-07   
ref|XP_002445570.1|  hypothetical protein SORBIDRAFT_07g021760        58.5    3e-07   
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...  58.2    3e-07   
gb|EMT09895.1|  Anthranilate N-benzoyltransferase protein 1           58.2    3e-07   
gb|ACI16631.1|  malate O-hydroxycinnamoyl transferase                 57.8    4e-07   
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  57.8    4e-07   
ref|XP_002319767.1|  transferase family protein                       57.8    4e-07   
ref|XP_002325454.2|  transferase family protein                       57.8    5e-07   
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase       57.8    5e-07   
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.8    5e-07   
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  57.4    5e-07   
ref|XP_003599926.1|  Malate O-hydroxycinnamoyl transferase            53.9    6e-07   
gb|AFJ04415.1|  rosmarinic acid synthase                              54.7    6e-07   
gb|EAZ41855.1|  hypothetical protein OsJ_26400                        57.0    8e-07   
dbj|BAD05328.1|  putative hydroxyanthranilate hydroxycinnamoyltra...  57.0    8e-07   
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g           57.0    9e-07   
gb|EMS47063.1|  Anthranilate N-benzoyltransferase protein 1           56.6    1e-06   
ref|XP_003553115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  56.6    1e-06   
ref|NP_001061230.1|  Os08g0205000                                     56.6    1e-06   
ref|XP_004977198.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  56.2    1e-06   
gb|KHN18128.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  55.8    2e-06   
ref|XP_003599928.1|  Anthranilate N-benzoyltransferase protein        55.8    2e-06   
dbj|BAJ92444.1|  predicted protein                                    55.8    2e-06   
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase              55.8    2e-06   
dbj|BAJ94049.1|  predicted protein                                    55.8    2e-06   



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +2

Query  182  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  361
            MASEK +I IKE+TMVKPAKPTP+K+LW SN+DL+VGRIHLL VYFYRPNGSPNFFD K 
Sbjct  1    MASEKFKISIKESTMVKPAKPTPAKRLWNSNLDLIVGRIHLLTVYFYRPNGSPNFFDSKV  60

Query  362  MKEALSRVLVSFYPMAGR  415
            MKEALS VLVSFYPMAGR
Sbjct  61   MKEALSNVLVSFYPMAGR  78



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKIMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   IMKEALSNVLVSFYPMAGR  79



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK+ +I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRLWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   IMKEALSNVLVSFYPMAGR  79



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK ++I IKE+T+VKP+KPTP+K+LW SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKVMKINIKESTLVKPSKPTPTKRLWNSNLDLIVGRIHLLTVYFYKPNGSSNFFDSK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   VMKEALSNVLVSFYPMAGR  79



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS NFFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSNFFDNK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             +KEALS VLVSFYPMAGR
Sbjct  61   VIKEALSNVLVSFYPMAGR  79



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   VMKEALSNVLVSFYPMAGR  79



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   VMKEALSNVLVSFYPMAGR  79



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEKL-RICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK+ +I IKE+T+VKP+KPTP+K++W SN+DL+VGRIHLL VYFY+PNGS +FFD K
Sbjct  1    MGSEKMMKINIKESTLVKPSKPTPTKRIWSSNLDLIVGRIHLLTVYFYKPNGSSSFFDNK  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             MKEALS VLVSFYPMAGR
Sbjct  61   VMKEALSNVLVSFYPMAGR  79



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   122 bits (307),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 54/79 (68%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  179  NMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            ++ SEK++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD +
Sbjct  49   SVGSEKMKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTR  108

Query  359  AMKEALSRVLVSFYPMAGR  415
             +KEALS VLVSFYPMAGR
Sbjct  109  VLKEALSNVLVSFYPMAGR  127



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +2

Query  182  MASEK-LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPK  358
            M SEK ++I +KE+TMV PAK TPS+KLW SN+DLVVGRIH+L VYFYRPNGS NFFD +
Sbjct  1    MGSEKKMKIKVKESTMVCPAKATPSEKLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDAR  60

Query  359  AMKEALSRVLVSFYPMAGR  415
             +KEALS VLVSFYPMAGR
Sbjct  61   VLKEALSNVLVSFYPMAGR  79



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  373
            +RI IKE+ MVKP+KPTPSK+LW SN+D++VGRIHLL VYFY+PNG SPNFFD + MKEA
Sbjct  1    MRINIKESIMVKPSKPTPSKRLWNSNLDVIVGRIHLLTVYFYKPNGTSPNFFDFRIMKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS VLVSFYPMAGR
Sbjct  61   LSNVLVSFYPMAGR  74



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  373
            ++I IKE+ MVKP+KPTPSK+LW SN+DL+VGRIHLL VYFY+PNG SPNFFD + MKEA
Sbjct  1    MKIDIKESIMVKPSKPTPSKRLWNSNLDLIVGRIHLLTVYFYKPNGISPNFFDFRIMKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS +LVSFYPMAGR
Sbjct  61   LSNILVSFYPMAGR  74



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLVSFYPMAGR
Sbjct  61   SNVLVSFYPMAGR  73



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLVSFYPMAGR
Sbjct  61   SNVLVSFYPMAGR  73



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   117 bits (294),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L VYFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLVSFYPMAGR
Sbjct  61   SNVLVSFYPMAGR  73



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   117 bits (293),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KET MV+PA+PTP+K+LW SN+DL+V RIH+L +YFY+PNGS NFFD + +KEAL
Sbjct  1    MKITVKETAMVRPAQPTPTKRLWNSNLDLLVARIHILTIYFYKPNGSANFFDTRVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLVSFYPMAGR
Sbjct  61   SNVLVSFYPMAGR  73



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = +2

Query  182  MASE----KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFF  349
            M SE     + I +K+++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR NGS NFF
Sbjct  1    MGSEGSVKTMNITVKDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFF  60

Query  350  DPKAMKEALSRVLVSFYPMAGR  415
            +P+ +KEALS VLVSFYPMAGR
Sbjct  61   EPRVLKEALSNVLVSFYPMAGR  82



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 4/82 (5%)
 Frame = +2

Query  182  MASE----KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFF  349
            M SE     + I +++++MV+PAK TP KKLW SN+DLVVGRIH+L VYFYR NGS NFF
Sbjct  1    MGSEGSVKTMNITVRDSSMVQPAKNTPEKKLWNSNLDLVVGRIHILTVYFYRSNGSQNFF  60

Query  350  DPKAMKEALSRVLVSFYPMAGR  415
            +P+ +KEALS VLVSFYPMAGR
Sbjct  61   EPRVLKEALSNVLVSFYPMAGR  82



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   113 bits (282),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K+AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKKAL  60

Query  377  SRVLVSFYPMAGR  415
            + VLVSF+PMAGR
Sbjct  61   ADVLVSFFPMAGR  73



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   113 bits (282),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K+AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKKAL  60

Query  377  SRVLVSFYPMAGR  415
            + VLVSF+PMAGR
Sbjct  61   ADVLVSFFPMAGR  73



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +KE+ MVKP+KPTP+++LW SN+DLVVGRIH+L VYFYRPNGS NFFD   +K AL
Sbjct  1    MELTVKESLMVKPSKPTPNQRLWNSNLDLVVGRIHILTVYFYRPNGSSNFFDSGVLKXAL  60

Query  377  SRVLVSFYPMAGR  415
            + VLVSF+PMAGR
Sbjct  61   ADVLVSFFPMAGR  73



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  191  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  370
            +K+ I ++ +TMVKPAK TP + LW SNVDLVV RIH   VYFYRPNGS NFFDP  +KE
Sbjct  3    KKMIINVRNSTMVKPAKETPQRSLWNSNVDLVVPRIHTPSVYFYRPNGSTNFFDPNPVKE  62

Query  371  ALSRVLVSFYPMAGR  415
            ALSR LV FYPMAGR
Sbjct  63   ALSRALVYFYPMAGR  77



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRPNG+ NFFD   MK+AL
Sbjct  18   MNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGASNFFDADVMKKAL  77

Query  377  SRVLVSFYPMAGR  415
            + VLVSFYPMAGR
Sbjct  78   ADVLVSFYPMAGR  90



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   108 bits (269),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IK ++ V+P++PTPS  +W SN+DLVVGRIH+L VYFYRPNG+ NFFD   MK+AL
Sbjct  1    MNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGASNFFDADVMKKAL  60

Query  377  SRVLVSFYPMAGR  415
            + VLVSFYPMAGR
Sbjct  61   ADVLVSFYPMAGR  73



>ref|XP_006826659.1| hypothetical protein AMTR_s00137p00027820 [Amborella trichopoda]
 gb|ERM93896.1| hypothetical protein AMTR_s00137p00027820 [Amborella trichopoda]
Length=143

 Score =   103 bits (258),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K +TMV+PA+ TP   LW SNVDLVV R+H   VYFYRPNG+PNFFD + +KEALSR
Sbjct  3    ITVKGSTMVRPAQQTPRIALWNSNVDLVVPRMHTPSVYFYRPNGAPNFFDTQVLKEALSR  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|ABR14148.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=84

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIKVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AFR40280.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40285.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   102 bits (255),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV+FYPMAGR
Sbjct  63   ALVAFYPMAGR  73



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP GS NFFDPK +KEALS+
Sbjct  3    ISVKESTMVRPAQETPQRSLWNSNVDLVVPRMHTPSVYFYRPTGSTNFFDPKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>gb|AFR40289.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40290.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40299.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40300.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40301.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40302.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40303.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40304.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40307.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40308.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40309.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40310.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40311.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40312.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40313.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=111

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40282.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40284.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVXFYPMAGR  73



>gb|AFR40294.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=104

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40273.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=74

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40292.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=102

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40293.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40297.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEXTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40306.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=94

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKESTMVKPAAETPQQRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|AFR40286.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40287.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40288.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40296.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40298.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40291.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEKTPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40266.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40267.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40268.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40269.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40270.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40274.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40275.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40276.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40278.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40279.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40281.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40283.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=111

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40271.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=106

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40272.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=109

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|AFR40277.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=110

 Score =   101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMVKPA  TP ++LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKESTMVKPATETPQQRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++E+TMV+PA+ TP + LW SNVDLVV R+H   VYFYRP+G+ NFFDP+ MKEALS+
Sbjct  3    INVRESTMVRPAEETPRRSLWNSNVDLVVPRMHTPSVYFYRPSGAANFFDPQVMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   105 bits (263),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I ++E+TMV+PAK TP   LW SNVDLVV   H   VYFYRPNG+ NFFDPK MK+AL
Sbjct  1    MKIEVRESTMVRPAKETPRINLWNSNVDLVVPNFHTPSVYFYRPNGAANFFDPKVMKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPM GR
Sbjct  61   SRALVPFYPMGGR  73



>gb|AFR40305.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=88

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW  NVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPQRGLWNXNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ MKEALS+ L
Sbjct  5    VKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSKAL  64

Query  389  VSFYPMAGR  415
            V FYPMAGR
Sbjct  65   VPFYPMAGR  73



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score =   104 bits (260),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TPS  LW SNVDL++ R H   VYFYRP GS NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLIIPRFHTPSVYFYRPTGSSNFFDPEVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I ++E+TMV+PA+ TP   LW SNVDLVV   H   VYFYRPNG+ NFFDPK MK+AL
Sbjct  1    MKIEVRESTMVRPAEETPRINLWNSNVDLVVPNFHTPSVYFYRPNGAANFFDPKVMKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPM GR
Sbjct  61   SRALVPFYPMGGR  73



>emb|CAT00088.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=232

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            + +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ MKEALS+
Sbjct  3    VNVKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  185  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  364
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  61

Query  365  KEALSRVLVSFYPMAGR  415
            K+ALSR LV FYPMAGR
Sbjct  62   KDALSRALVPFYPMAGR  78



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/77 (62%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  185  ASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  364
            A   ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +
Sbjct  2    AMGSMKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  61

Query  365  KEALSRVLVSFYPMAGR  415
            K+ALSR LV FYPMAGR
Sbjct  62   KDALSRALVPFYPMAGR  78



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  3    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  62

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  63   SRALVPFYPMAGR  75



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AFR40295.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=111

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA   P + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAXXXPQRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            +RI +KE+TMV+PA+  P + LW SNVDLVV   H   VYFY P GS NFFDPK +K+AL
Sbjct  1    MRISVKESTMVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNPTGSSNFFDPKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+ NFFDP+ MKEALS+ L
Sbjct  5    VKESTMVRPAEETPRQSLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPQVMKEALSKAL  64

Query  389  VSFYPMAGR  415
            V FYPM GR
Sbjct  65   VPFYPMGGR  73



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP ++LW SNVDLVV R H   VYFYRP G+ NFFD K +KEALS+
Sbjct  3    INVKESTMVQPAEETPRRRLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDAKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAQETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRP G+ NFFDP+ MKEALS+
Sbjct  3    INVKESTMVQPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPTGAANFFDPQVMKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA  TP + LW SNVDLVV   H   VYFYRP GS NFFD K +K+AL
Sbjct  1    MKIEVKESTMVRPAHETPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   103 bits (256),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I ++E+TMVKPA+ TP K LW SNVDLVV   H   VYFYRPNGS NFFD K +K+AL
Sbjct  1    MKIEVRESTMVKPAEETPIKTLWNSNVDLVVPNFHTPSVYFYRPNGSANFFDAKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYPM GR
Sbjct  61   SQILVPFYPMGGR  73



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPAAETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            ++ LV FYPMAGR
Sbjct  61   AKALVPFYPMAGR  73



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MKEAL
Sbjct  1    MKINIRDSTMVRPATETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score =   103 bits (256),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            +KE+TMV+PA  TP + LW +NVDLVV R H   VYFYRPNG+ NFFDP+ MKEALS+ L
Sbjct  73   VKESTMVRPAGETPRRSLWNANVDLVVPRFHTPSVYFYRPNGAANFFDPQVMKEALSKAL  132

Query  389  VSFYPMAGR  415
            V FYPMAGR
Sbjct  133  VPFYPMAGR  141



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   102 bits (254),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+ NFFD K +KEALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDAKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESTVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMA R
Sbjct  63   VLVPFYPMAAR  73



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SNVDLVV R H   VYFYRP G+PNFFD K +K ALS+
Sbjct  3    INVKESTMVQPAEETPRRGLWNSNVDLVVPRFHTPSVYFYRPTGAPNFFDAKVLKGALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP  MKEAL
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            ++ LV FYPMAGR
Sbjct  61   AKALVPFYPMAGR  73



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TPS  LW SNVDLV+ R H   VYFYRP G+ NFFDP  MKEAL
Sbjct  1    MKINIRDSTMVRPAGETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            ++ LV FYPMAGR
Sbjct  61   AKALVPFYPMAGR  73



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K +TMV+PA  TP  +LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKNSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVVKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+TMV+PA+ TP  +LW SNVDLVV   H   VYFYRPNG+ +FF+ KA+K+ L
Sbjct  1    MKISVKESTMVRPAEETPRIRLWNSNVDLVVPNFHTPSVYFYRPNGADDFFESKALKDGL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP+GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPSGSPDFFSMHILRDALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K++TMV+PA  TP  +LW SNVDLVV   H   VYFYRP GSPNFFD K +KEAL
Sbjct  1    MKIEVKKSTMVQPATETPQLRLWNSNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPM GR
Sbjct  61   SKALVPFYPMGGR  73



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I ++E+TMV+PA  TP  +LW SNVDLVV   H   VYFYRPNGS NFFD K +K+AL
Sbjct  1    MKIEVRESTMVQPATETPQIRLWNSNVDLVVPNFHTPSVYFYRPNGSANFFDGKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPM GR
Sbjct  61   SRALVPFYPMGGR  73



>ref|XP_007099552.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20480.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=224

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKPNGSSDFFDTKVLKESL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            +RI +KE+T V+PA+  P + LW SNVDLVV   H   VYFY P GS NFFDPK +K+AL
Sbjct  1    MRISVKESTTVRPAQDLPPRSLWNSNVDLVVPNFHTPSVYFYNPTGSSNFFDPKVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            SR LV FYPMAGR
Sbjct  61   SRALVPFYPMAGR  73



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMHILRDALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDLV+ R H   VYFYRP G+ NFFDP+ MK+AL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQIMKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+VKPA+ TP + LW +NVDLVV R H   VYFYRP G+P FFDP  +KE LS+
Sbjct  3    ITVKESTLVKPAEETPRRGLWNANVDLVVPRFHTPSVYFYRPTGAPTFFDPNVVKEGLSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   100 bits (249),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTMVRPAAETPLTNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>ref|XP_007027324.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07826.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +KE+TMV PA+ TP+++LW SN+DLVV R H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEVTMKESTMVCPAEETPNQRLWVSNLDLVVTRYHICTVYFYKPNGSSDFFDTKVLKESL  60

Query  377  SRVLVSFYPMAGR  415
             ++LV FYP+AGR
Sbjct  61   GKILVPFYPIAGR  73



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   100 bits (249),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRPNG  NFFD K MKEALS+
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMA R
Sbjct  63   VLVPFYPMAAR  73



>ref|XP_007099550.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20478.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=339

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV PA+ TP+++LW SN+DLVV   H+  VYFY+PNGS +FFD K +KE+L
Sbjct  1    MEITMKESTMVCPAEETPNQRLWLSNLDLVVTVYHMSTVYFYKPNGSSDFFDTKVLKESL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKSSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSK  62

Query  383  VLVSFYPMAGR  415
            +LV FYPMAGR
Sbjct  63   LLVPFYPMAGR  73



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K + MV+PA PTP + LW SNVDLVV RIH   VYFYRP GSP+FF    +++ALS+
Sbjct  3    ITVKNSQMVRPAAPTPQRDLWNSNVDLVVPRIHTASVYFYRPTGSPDFFSMNILRDALSK  62

Query  383  VLVSFYPMAGR  415
            +LV FYPMAGR
Sbjct  63   LLVPFYPMAGR  73



>ref|XP_009399564.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=444

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I ++ +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP+GS +FFD  AM++AL
Sbjct  2    VEINVRRSTMVRPAEPTPRRQLWNSNLDLVVPRFHTPSVYFYRPDGSADFFDAAAMRDAL  61

Query  377  SRVLVSFYPMAGR  415
            +R LV FYPMAGR
Sbjct  62   ARALVLFYPMAGR  74



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMA R
Sbjct  63   VLVLFYPMAAR  73



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+ +V+PA+ TP K LW SNVDLVV   H   VYFYRPNG+ NFFD K MKEALS+
Sbjct  3    INVKESMVVRPAEETPRKALWNSNVDLVVPNFHTPSVYFYRPNGTSNFFDAKIMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMA R
Sbjct  63   VLVLFYPMAAR  73



>ref|XP_008461189.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
melo]
Length=150

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP G+ NFFD + +KE LS+
Sbjct  3    ITVKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGASNFFDVEVLKEGLSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_010481008.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=143

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++T+V+PA  TP  +LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDSTIVRPAAETPVTELWNSHVDLIIAKYHSPTVYFYRPTGASNFFDPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 62/103 (60%), Gaps = 11/103 (11%)
 Frame = +2

Query  134  FLWLNFHKKDYCFNTNMASEKLR---------ICIKETTMVKPAKPTPSKKLWCSNVDLV  286
            F WL+F    + F         R         + ++E+TMV+PA  T    LW SNVDLV
Sbjct  31   FFWLSFLL--WGFRRTAGRSDTRGNIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLV  88

Query  287  VGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYPMAGR  415
            V  +H   VYFYRPNGSP+FFDPK +KE LS+ LV FYPMAGR
Sbjct  89   VPSMHTPSVYFYRPNGSPDFFDPKVLKEGLSKALVPFYPMAGR  131



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K++TMV+PA+ TP + LW SNVDLVV   H   VYFYRPNG  NFFD K MKEALS+
Sbjct  3    INVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMA R
Sbjct  63   ALVPFYPMAAR  73



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 62/103 (60%), Gaps = 11/103 (11%)
 Frame = +2

Query  134  FLWLNFHKKDYCFNTNMASEKLR---------ICIKETTMVKPAKPTPSKKLWCSNVDLV  286
            F WL+F    + F         R         + ++E+TMV+PA  T    LW SNVDLV
Sbjct  36   FFWLSFLL--WGFRRTAGRSDTRGNIVWFDMIVSVRESTMVRPAGETRIHALWNSNVDLV  93

Query  287  VGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYPMAGR  415
            V  +H   VYFYRPNGSP+FFDPK +KE LS+ LV FYPMAGR
Sbjct  94   VPSMHTPSVYFYRPNGSPDFFDPKVLKEGLSKALVPFYPMAGR  136



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = +2

Query  182  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  361
            MA ++++I +KE+++V PAK TP   +W SN+DL+V  IH+  VYFY+PNG+ NFFD + 
Sbjct  1    MALKEMKISVKESSIVLPAKDTPRTSIWTSNLDLLVPTIHIPTVYFYKPNGASNFFDSEV  60

Query  362  MKEALSRVLVSFYPMAGR  415
            +K+ALS VLV FYP+AGR
Sbjct  61   LKKALSHVLVPFYPLAGR  78



>ref|XP_007027325.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07827.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=393

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV PA+ TP+++LW SN+DLV+   H+  VYFYRPNGS +FFD K +KE+L
Sbjct  1    MEIAVKESTMVCPAEETPNRRLWVSNLDLVMTIYHVPTVYFYRPNGSSDFFDTKVLKESL  60

Query  377  SRVLVSFYPMAGR  415
             ++LV FYP+AGR
Sbjct  61   GKILVPFYPIAGR  73



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/69 (62%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            IKE+T+V+PA+ TP+ +L  SN+DL+V RIHLL VYFY+P  S NFFD K +KE LS+ L
Sbjct  3    IKESTIVRPARETPTTRLQSSNLDLLVARIHLLTVYFYKPTSSENFFDAKVLKEGLSQAL  62

Query  389  VSFYPMAGR  415
            V FYP+AGR
Sbjct  63   VHFYPVAGR  71



>gb|KDO55352.1| hypothetical protein CISIN_1g014116mg [Citrus sinensis]
Length=149

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV+PA+    + +W SNVDLVV   H   VYFYR NG+PNFFD K MKEAL
Sbjct  1    MMINVKESTMVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGAPNFFDGKVMKEAL  60

Query  377  SRVLVSFYPMAGR  415
            ++VLV FYPMAGR
Sbjct  61   TKVLVPFYPMAGR  73



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +KEAL
Sbjct  1    MKINIRDSTVVRPAAETPVINLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV+FYP+AGR
Sbjct  61   SKALVAFYPIAGR  73



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I I+++TMV+PA  TP   LW SNVDL++ R H   VYFYRP G+ NFFDP+ +K+ALS+
Sbjct  3    INIRDSTMVRPAAETPITNLWNSNVDLIIPRFHTPSVYFYRPTGASNFFDPQLLKDALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++T+V+PA  TP  KLW S+VDL+  + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDSTIVRPAAETPVTKLWNSHVDLIDAKYHTPTVYFYRPTGANNFFDPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV+FYPMAGR
Sbjct  61   SKALVTFYPMAGR  73



>ref|XP_007149778.1| hypothetical protein PHAVU_005G098400g [Phaseolus vulgaris]
 gb|ESW21772.1| hypothetical protein PHAVU_005G098400g [Phaseolus vulgaris]
Length=141

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+ MV+PA+ TP K LW S++DL+ G  H+  +YFY PNG+ NFF P  +KEAL
Sbjct  1    MTISVKESIMVQPAEATPRKVLWNSDLDLLAGNYHIPTLYFYNPNGTSNFFHPNILKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMA R
Sbjct  61   SKTLVLFYPMAAR  73



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = +2

Query  182  MASEK---LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNF  346
            M S++   + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  F
Sbjct  1    MGSDQKMMMNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKF  60

Query  347  FDPKAMKEALSRVLVSFYPMAGR  415
            FDP  MK+AL+ VLVSFYPMAGR
Sbjct  61   FDPNVMKKALADVLVSFYPMAGR  83



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = +2

Query  182  MASEK---LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNF  346
            M S++   + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  F
Sbjct  1    MGSDQKMMMNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKF  60

Query  347  FDPKAMKEALSRVLVSFYPMAGR  415
            FDP  MK+AL+ VLVSFYPMAGR
Sbjct  61   FDPNVMKKALADVLVSFYPMAGR  83



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 5/83 (6%)
 Frame = +2

Query  182  MASEK---LRICIKETTMVKPAKPTPS--KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNF  346
            M S++   + I I ++++V P++      K+LW SN+DLVVGRIH+L VYFYRPNGS  F
Sbjct  1    MGSDQKMMMNIDIMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKF  60

Query  347  FDPKAMKEALSRVLVSFYPMAGR  415
            FDP  MK+AL+ VLVSFYPMAGR
Sbjct  61   FDPNVMKKALADVLVSFYPMAGR  83



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDPKAMKE  370
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP  NG  NFFDP  +K 
Sbjct  3    VNVTVRESTMVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNQNGGSNFFDPAVLKH  62

Query  371  ALSRVLVSFYPMAG  412
            ALS+ LV FYPMAG
Sbjct  63   ALSKALVPFYPMAG  76



>ref|XP_007099551.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY20479.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=368

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV PA+ TPS+KLW SN+DLV+   H+  VY YRP GS +FFD K +K++L
Sbjct  1    MEIAVKESTMVCPAEETPSRKLWVSNLDLVMTIYHISTVYCYRPTGSSDFFDTKVLKDSL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPIAGR  73



>gb|KJB71590.1| hypothetical protein B456_011G1315001, partial [Gossypium raimondii]
Length=350

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMTRYHIPTVYYYKPNGSSDFFDSGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPIAGR  73



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K++TMV PA+ TP K LW SNVDLVV  +H   VYFYRP G  NFFD + +KE LS+
Sbjct  3    ITVKDSTMVTPAEETPHKSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRPNG+ NFFD   +KEALSR
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRPNGASNFFDGNILKEALSR  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+    + LW SNVDLVV   H   VYFYRPNG+ NFFD   +KEALSR
Sbjct  3    ITVKESTMVRPAEELHRRLLWNSNVDLVVPNFHTPSVYFYRPNGASNFFDGNILKEALSR  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = +2

Query  170  FNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFF  349
            ++ ++   K+ I IK++TMV+PA+ TP + LW SNVDLVV   H   VYFYRP+G+ NFF
Sbjct  13   YHCDLEGRKMIINIKQSTMVRPAEETPRRPLWNSNVDLVVPNFHTPSVYFYRPSGASNFF  72

Query  350  DPKAMKEALSRVLVSFYPMAGR  415
            D   MK ALS+ LV FYPMA R
Sbjct  73   DTAVMKAALSKALVPFYPMAAR  94



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INLKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  370
            + + ++E+T+VKPA+ TP K LW  NVDLV+  IH   VYFYR  PNG+ NFFDP  +K 
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNXNVDLVIPSIHTPSVYFYRXNPNGASNFFDPAVLKH  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV FYPMAGR
Sbjct  63   ALSKALVPFYPMAGR  77



>ref|XP_006427659.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
 gb|ESR40899.1| hypothetical protein CICLE_v10026558mg [Citrus clementina]
Length=189

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA  TP   LW +NVDLVV R H   VYFYRP G+ NFFD   +K+ALS+
Sbjct  3    INVKESTMVRPAAETPRVALWNANVDLVVPRFHTPSVYFYRPTGAANFFDAGVLKDALSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I IK++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP G  NFFD + +KE LS+
Sbjct  3    ITIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I IK++TMV PA+ TP + LW SNVDLVV  +H   VYFYRP G  NFFD + +KE LS+
Sbjct  3    ITIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +2

Query  152  HKKDYCFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN  331
            H     F  N     ++I I+++T+++PA  TP   LW SNVDL++ R H   VYFYRP 
Sbjct  27   HSIKLFFACNNPYATMKINIRDSTIIRPAAETPVTNLWNSNVDLIIPRFHTPSVYFYRPT  86

Query  332  GSPNFFDPKAMKEALSRVLVSFYPMAGR  415
            G  NFFDP+ +K+ALS+ LV FYP+AGR
Sbjct  87   GVSNFFDPQVLKDALSKALVPFYPIAGR  114



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
             + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RPNGS NFFD + +KEA
Sbjct  3    DMEITIKESSMVYPAEETPKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFDTRVLKEA  62

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYPMAGR
Sbjct  63   LSKVLVPFYPMAGR  76



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  373
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP +G+ NFFD   +KEA
Sbjct  1    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS+ LV FYPMAGR
Sbjct  61   LSKALVPFYPMAGR  74



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  373
            ++I +KE TMVKPA  TP   LW SNVDLVV   H   VYFYRP +G+ NFFD   +KEA
Sbjct  8    MKIVVKELTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSGASNFFDSNVLKEA  67

Query  374  LSRVLVSFYPMAGR  415
            LS+ LV FYPMAGR
Sbjct  68   LSKALVPFYPMAGR  81



>gb|KHG19404.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Gossypium arboreum]
Length=433

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE++MV PA+ TP  +LW SN++L++   H+  VYF+RPNGS NFFD   +KEAL
Sbjct  1    MEITIKESSMVHPAEETPKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFDTGVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VLV FYPMAGR
Sbjct  61   SKVLVPFYPMAGR  73



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +++TTMV+PA+ TP ++LW SN+DLVV R H   VYFYRPNGS  FFD   ++ AL R
Sbjct  4    INLRQTTMVRPAEQTPRRRLWNSNLDLVVPRFHTPSVYFYRPNGSRGFFDAAVLRSALGR  63

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  64   ALVPFYPMAGR  74



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPS-KKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            + + +KE+T+VKPA+ T   + LW +NVDLV+  IH   +YFYRPNG+ NFFDP+ +K A
Sbjct  4    VNVTVKESTIVKPAEETTEPRSLWNANVDLVIPSIHTPSIYFYRPNGASNFFDPRVLKHA  63

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYPMAGR
Sbjct  64   LSKVLVPFYPMAGR  77



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +2

Query  167  CFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNF  346
            C     +S ++ I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NF
Sbjct  18   CLLCEQSSREMIINVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNF  77

Query  347  FDPKAMKEALSRVLVSFYPMAGR  415
            FD K +KEALS+VLV FYPMAGR
Sbjct  78   FDGKVLKEALSKVLVPFYPMAGR  100



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 3/76 (4%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN---GSPNFFDPKAMK  367
            + + ++ETT+VKPA  TP K LW SNVDLV+  IH   VYFYRPN    S NFFDP  +K
Sbjct  3    VNVSVRETTLVKPAAETPRKALWNSNVDLVIPSIHTPSVYFYRPNQNGASSNFFDPAVLK  62

Query  368  EALSRVLVSFYPMAGR  415
             ALS+ LV FYPMAGR
Sbjct  63   LALSKALVPFYPMAGR  78



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  224  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYP  403
            MV+PA  TPS  LW SNVDLV+ R H   VYFYRP G  NFFDP+ MK+ALS+ LV FYP
Sbjct  1    MVRPASETPSTYLWNSNVDLVIPRFHTPSVYFYRPTGGSNFFDPQVMKDALSKALVPFYP  60

Query  404  MAGR  415
            MAGR
Sbjct  61   MAGR  64



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDPKAMKE  370
            + + ++E+TMVKPA+ TP K LW SNVDLV+  IH   VYFYRP  NG  NFFDP  +K 
Sbjct  3    VNVIMRESTMVKPAEETPKKTLWNSNVDLVIPSIHTASVYFYRPNQNGGSNFFDPVVLKH  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV FYPMA R
Sbjct  63   ALSKALVLFYPMARR  77



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRPNG+ NFFDP  +KEAL
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRPNGASNFFDPHVLKEAL  60

Query  377  SRVLVSFYPMAG  412
            ++ LV FYP AG
Sbjct  61   AKALVPFYPFAG  72



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I  +  TMV+PA  TPS  LW SNVDL++ R H   VYFYRPNG+ NFFDP  +KEAL
Sbjct  1    MKINTRNATMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRPNGASNFFDPHVLKEAL  60

Query  377  SRVLVSFYPMAG  412
            ++ LV FYP AG
Sbjct  61   AKALVPFYPFAG  72



>ref|XP_007027321.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07823.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=437

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+T+V PA+ TP+++LW SN DLV+   H+  VYFY+PNGS N FD K +KE+L
Sbjct  1    MEIAVKESTIVCPAEETPNRRLWVSNFDLVMIMYHISTVYFYKPNGSTNIFDTKVLKESL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPIAGR  73



>gb|KJB71578.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=315

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKPNGSSDFFDTGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I ++T+V+PA  TP+  LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINILDSTIVRPAAETPTTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>gb|KJB71581.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=324

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKPNGSSDFFDTGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>gb|KJB71580.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=306

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKPNGSSDFFDTGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++++TMV+P++    + +W SNVDLVV   H   VYFYRPNG+ NFFD K +KEALS+
Sbjct  3    INVRDSTMVRPSEEVTQRTVWNSNVDLVVPNFHTPSVYFYRPNGASNFFDAKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>gb|KJB71596.1| hypothetical protein B456_011G132100 [Gossypium raimondii]
Length=437

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R HL  +Y+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMTRYHLPTIYYYKPNGSSDFFDTCRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPIAGR  73



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR--PNGSPNFFDPKAMKE  370
            + + ++E+T+VKPA+ TP K LW SNVDLV+  IH   VYFYR  PNG+ NFFD   +K 
Sbjct  3    VNVTVRESTLVKPAEETPKKALWNSNVDLVIPSIHTPSVYFYRPNPNGTSNFFDAAVLKH  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV FYPMAGR
Sbjct  63   ALSKALVPFYPMAGR  77



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I ++++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+ NFFD   MK AL
Sbjct  1    MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LVSFYPMAGR
Sbjct  61   GRALVSFYPMAGR  73



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I++ T+V+PA  TP   LW S+VDL++ + H   VYFYRP G+ NFFDP+ +K+AL
Sbjct  1    MKINIRDFTIVRPAAETPVTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKALVPFYPMAGR  73



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  KETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLV  391
            + +TMV+PA+PTP ++LW SN+DLVV R H   VYFYRP+GS +FFD + ++ AL++ LV
Sbjct  6    RRSTMVRPAEPTPRRRLWNSNLDLVVPRFHTPSVYFYRPDGSADFFDAERLRAALAKALV  65

Query  392  SFYPMAGR  415
             FYPMAGR
Sbjct  66   PFYPMAGR  73



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +K +TMV+PA+ TP + LW SNVDLVV   H   VYFYRP G+ NFFD + MK+AL++
Sbjct  3    INVKASTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPTGAANFFDAEVMKQALAK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+ TP + LW SN DLVV R H  +VYF+R NGS +FF+   +KEALS+
Sbjct  3    INMKESTMVRPAESTPEQTLWISNADLVVRRSHTPIVYFFRSNGSADFFNLHLLKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYP+AGR
Sbjct  63   VLVPFYPVAGR  73



>gb|KHG20214.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=436

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRNLWNSNLDIVMIRYHIPTVYYYKPNGSSDFFDAGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+V P++ TP   LW SNVDLVV R H   VYFYRP G+ NFFDP  +K AL +
Sbjct  3    INVKESTLVPPSEETPRVGLWNSNVDLVVPRFHTPSVYFYRPTGASNFFDPDVLKAALGK  62

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  63   ALVPFYPMAGR  73



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  182  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKA  361
            ++S ++ I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K 
Sbjct  20   LSSREMIINVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKV  79

Query  362  MKEALSRVLVSFYPMAGR  415
            +KEALS+VLV FYPMAGR
Sbjct  80   LKEALSKVLVPFYPMAGR  97



>gb|KJB71577.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
 gb|KJB71579.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=436

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+ +V+PA+ TP + LW SN+D+V+ R H+  VY+Y+PNGS +FFD   +KEAL
Sbjct  1    MEITIKESAIVRPAEDTPKRSLWNSNLDIVMIRYHIPTVYYYKPNGSSDFFDTGRLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S++LV FYP+AGR
Sbjct  61   SKILVPFYPVAGR  73



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++ +TMV+PA+PT  ++LW SN+DLVV R H   VYFYRP+GS  FFD   M+++L+R
Sbjct  4    INVRRSTMVRPAEPTQRRRLWNSNLDLVVPRFHTPSVYFYRPDGSAGFFDAAVMRQSLAR  63

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  64   ALVPFYPMAGR  74



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVY-FYRPNGSPNFFDPKAMKEA  373
            ++I I  +TMV+PA+ TP+++LW SN+DLV+ R H+ +VY FY+ +GS NFFD + +KE+
Sbjct  1    MKITINGSTMVRPARDTPNRRLWNSNLDLVISRYHVALVYFFYKSDGSSNFFDTQLLKES  60

Query  374  LSRVLVSFYPMAGR  415
            LS +LV FYPMAGR
Sbjct  61   LSNLLVPFYPMAGR  74



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++TMV+PA  TP   LW SNVDL++ + H   VYFYRP G  +FFDP+ +K+AL
Sbjct  1    MKIKIQDSTMVRPAAETPITSLWNSNVDLIMAKYHTPSVYFYRPTGDSSFFDPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYP+AGR
Sbjct  61   SKALVPFYPVAGR  73



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+  FFD  AMK AL
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRPSGAAGFFDTAAMKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYPMAGR
Sbjct  61   GRALVPFYPMAGR  73



>ref|XP_007027320.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
 gb|EOY07822.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Theobroma cacao]
Length=699

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  224  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYP  403
            MV P + TPS++LW SN+DL++ R H+  VYFY+PNGS NFFD K +KE+LS++LV FYP
Sbjct  1    MVCPTEETPSRRLWVSNMDLLMTRYHISTVYFYKPNGSSNFFDTKVLKESLSKILVPFYP  60

Query  404  MAGR  415
            +AGR
Sbjct  61   VAGR  64



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K++T+V+P+  TP+  LW SNVDLVV   H   VYFYRP+G+  FFD  AMK AL
Sbjct  1    MKIDVKDSTLVRPSAATPAVNLWNSNVDLVVPNFHTPSVYFYRPSGAAGFFDTAAMKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYPMAGR
Sbjct  61   GRALVPFYPMAGR  73



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+   MV+PA  TPS  LW SNVDL++ R H   VYFYR NG+ NFFDP+ +KEAL
Sbjct  1    MKINIRNAAMVRPAAETPSTYLWNSNVDLIIARYHSSSVYFYRSNGASNFFDPQVLKEAL  60

Query  377  SRVLVSFYPMAG  412
            ++ LV FYP AG
Sbjct  61   AKALVPFYPFAG  72



>gb|KJB68220.1| hypothetical protein B456_010G233100 [Gossypium raimondii]
Length=182

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            + I IKE+T+V+PA+  TP   +W SN+DL++ R H+  VYFY+PNG  +FFD   +KE 
Sbjct  1    MEISIKESTIVRPAEEHTPKGSIWNSNLDLLISRYHVSTVYFYKPNGCSDFFDTGRVKEG  60

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYP+AGR
Sbjct  61   LSKVLVPFYPIAGR  74



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKEA  373
            ++I +KE+TMVKPA  TP   LW SNVDLVV   H   VYFYRP + + NFFD   +KEA
Sbjct  1    MKIEVKESTMVKPATDTPQTNLWNSNVDLVVPNFHTPSVYFYRPLSSASNFFDSNMLKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS+ LV FYPMAGR
Sbjct  61   LSKALVPFYPMAGR  74



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I I+++T+V+PA  TP   LW SNVDL++ R H   VYFYRP    NFF+P+ +K+AL
Sbjct  1    MKINIRDSTIVRPAGETPITSLWNSNVDLIIPRFHTPSVYFYRPTSDSNFFNPQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VLV FYP+AGR
Sbjct  61   SKVLVPFYPVAGR  73



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  212  KETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLV  391
            + +T+V PA+PTP ++LW S++DLVV R H   VYFYRP+GSP+FFD + ++ AL++ LV
Sbjct  6    RRSTLVGPAEPTPRRRLWNSSLDLVVPRFHTPSVYFYRPDGSPDFFDAERLRAALAKALV  65

Query  392  SFYPMAGR  415
             FYPMAGR
Sbjct  66   PFYPMAGR  73



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+V+PA+ TP ++LW S++DLVV  +H   VYFYRP G+ NFFD   +K ALSR
Sbjct  16   INVKESTLVRPAEETPRRRLWNSSLDLVVPSVHTPSVYFYRPTGAANFFDVAVVKAALSR  75

Query  383  VLVSFYPMAGR  415
             LV FYPMAGR
Sbjct  76   ALVPFYPMAGR  86



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+TMV+PA+    + +W SNVDLVV   H   VYFYR  G+ NFFD K MKEALS+
Sbjct  3    INVKESTMVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRATGASNFFDAKIMKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE++MV+PA+ TP++ LW SNVDLVV   H   VYFY PNG+ +FF  K +K+ALS+
Sbjct  3    IKVKESSMVRPAEETPTRALWNSNVDLVVPNFHTPSVYFYTPNGASDFFHAKILKDALSK  62

Query  383  VLVSFYPMAGR  415
             LV+FYPMA R
Sbjct  63   TLVTFYPMAAR  73



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K +KEALS+
Sbjct  3    INVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKE  370
            ++ I  K++T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P NGS NFFDP+ +KE
Sbjct  3    RVEIRTKQSTIVRPAEDTPEKSLWSSNLDLLVPMVHIPTIYFYKPVNGSSNFFDPQVLKE  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV F+ MAGR
Sbjct  63   ALSKALVPFHHMAGR  77



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I +KE+T+V+PA+    + +W SNVDLVV   H   VYFYR NG+ NFFD K +KEALS+
Sbjct  3    INVKESTVVRPAEEVARRVVWNSNVDLVVPNFHTPSVYFYRSNGTSNFFDGKVLKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_006826688.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
 gb|ERM93925.1| hypothetical protein AMTR_s00137p00072760 [Amborella trichopoda]
Length=455

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +2

Query  188  SEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMK  367
            S ++ I +K++++V+P   TP  ++W SN DLVV R+H+ ++YF+R NG+PNFF+   +K
Sbjct  19   STEMIITVKQSSLVRPNAETPVLEMWISNADLVVPRMHVPLLYFFRSNGAPNFFESDLLK  78

Query  368  EALSRVLVSFYPMAGR  415
            E+LSR LVSFYP+AGR
Sbjct  79   ESLSRALVSFYPLAGR  94



>ref|XP_008777439.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=431

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            I ET +V P+  TP  ++W SN+DL+V R H   VYFYRPNG+PNFF  +AMK AL + L
Sbjct  7    ILETGLVTPSDDTPKHEIWLSNLDLLVARGHTPTVYFYRPNGAPNFFSAEAMKAALGKAL  66

Query  389  VSFYPMAGR  415
            V FYP+AGR
Sbjct  67   VPFYPLAGR  75



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG---SPNFFDPKAMK  367
            + + ++E+T+V+PA  TP   LW SNVDLV+  IH   VYFYRPN    S NFFDP  +K
Sbjct  3    VNVSVRESTLVRPAAETPKHALWNSNVDLVIPSIHTPSVYFYRPNQNGVSSNFFDPAVLK  62

Query  368  EALSRVLVSFYPMAGR  415
             ALS+ LV FYPMAGR
Sbjct  63   HALSKALVPFYPMAGR  78



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++ I +K TTMV+PA+ TP   LW +N+DLVV  +H   VYFYRP GS +FFD + +KEA
Sbjct  7    RMIINVKGTTMVRPAEDTPRCTLWNANLDLVVPSMHTPSVYFYRPTGSDDFFDSEVLKEA  66

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP+AGR
Sbjct  67   LSRALVLFYPVAGR  80



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            +++ +K++TMV+P++ TP++ LW SN+DL+V   H+  VYFY+PNGS  FF+ + +K+AL
Sbjct  1    MKVDVKQSTMVRPSRETPNRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLKDAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLV FYP AGR
Sbjct  61   SDVLVPFYPAAGR  73



>gb|KJB54946.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K +TM++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ +KEAL
Sbjct  1    MDVTVKGSTMIRPAQDTPKERQWISNLDMVMATYHVPLLFFYKPNGSSDFFKPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVPFYPMAGR  73



>gb|KJB54948.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K +TM++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ +KEAL
Sbjct  1    MDVTVKGSTMIRPAQDTPKERQWISNLDMVMATYHVPLLFFYKPNGSSDFFKPQVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVPFYPMAGR  73



>ref|XP_007149776.1| hypothetical protein PHAVU_005G098200g, partial [Phaseolus vulgaris]
 gb|ESW21770.1| hypothetical protein PHAVU_005G098200g, partial [Phaseolus vulgaris]
Length=83

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+ MV+ A+ TP K LW S++DL+VG  H   VYFY PNG  NFF P  +KEAL
Sbjct  1    MTIIVKESIMVQSAEATPRKVLWNSDLDLLVGNYHTPTVYFYNPNGVSNFFHPNILKEAL  60

Query  377  SRVLVSFYPMA  409
            S+ LV FYPM 
Sbjct  61   SKTLVLFYPMV  71



>gb|AFF19202.1| BAHD acyltransferase [Erythroxylum coca]
Length=439

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLV-VGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I IKE+T+V P++ TP ++LW S VDL+   R ++  ++FY+ NGSPNFFDP+ +KE+
Sbjct  1    MKIVIKESTLVCPSEQTPRRRLWLSAVDLLFTNRGYIPTLFFYKFNGSPNFFDPRVLKES  60

Query  374  LSRVLVSFYPMAGR  415
            LSRVLV FYP+AGR
Sbjct  61   LSRVLVPFYPVAGR  74



>gb|ACD03271.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=139

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++   +V+PA+ TP K LW SN+D +  ++ +  VYFYRP+GS NFFD KAMKE+LS+
Sbjct  3    IKVRREEIVEPAEETPKKILWTSNIDQLF-KLLIPSVYFYRPDGSTNFFDVKAMKESLSK  61

Query  383  VLVSFYPMAGR  415
             LVSFYPMAGR
Sbjct  62   ALVSFYPMAGR  72



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  191  EKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  370
            EK+++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+PNGS  FF+ + + +
Sbjct  7    EKMKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLTD  66

Query  371  ALSRVLVSFYPMAGR  415
            ALS VLV FYP AGR
Sbjct  67   ALSDVLVPFYPAAGR  81



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKE  370
            ++ I +KE+T+V+PA+ TP K LW SN+DL+V  +H+  +YFY+P NGS NFFDP+ +K+
Sbjct  3    RVEIRMKESTIVRPAEDTPEKSLWSSNLDLLVPSVHIPTIYFYKPVNGSSNFFDPQVLKD  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV F+ +AGR
Sbjct  63   ALSKALVPFHHVAGR  77



>gb|EYU24586.1| hypothetical protein MIMGU_mgv1a0064641mg, partial [Erythranthe 
guttata]
Length=269

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K + +V+PA  TP+  LW SNVDLVV   H   VYFYRP G+ +FFD   +K AL
Sbjct  1    MKIDVKRSALVRPAAATPAVSLWNSNVDLVVPNFHTPSVYFYRPTGAADFFDAAVLKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYPMAGR
Sbjct  61   GRALVPFYPMAGR  73



>gb|EPS58183.1| hypothetical protein M569_16633, partial [Genlisea aurea]
Length=142

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +  +TMV P+  TP   LW SNVDLVV   H   VYFYRP G+ +FFD + +K AL
Sbjct  1    MKIAVIGSTMVPPSSETPKVSLWNSNVDLVVPNFHTPSVYFYRPTGAADFFDAEVLKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYPMAGR
Sbjct  61   GRALVPFYPMAGR  73



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++ I +K +T+V PA+ TP   LW +NVDLVV  +H   VYFYRP GS +FFD + +KEA
Sbjct  7    RMIINVKGSTVVCPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRPTGSDDFFDSRVLKEA  66

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYPMAGR
Sbjct  67   LSRALVLFYPMAGR  80



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE+ +V PA  TP   LW SNVDLVV  IH+  VYFY P G+ NFFDP  +K AL
Sbjct  1    MKIYVKESALVLPAAVTPCVTLWNSNVDLVVCNIHIPTVYFYGPTGAVNFFDPAVLKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYP+AGR
Sbjct  61   GRALVPFYPVAGR  73



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++ I +K +TMV+PA+ TP   LW +NVDLVV  +H   VYFYRP G  +FFD + +KEA
Sbjct  7    RMIINVKGSTMVRPAEDTPRCTLWNANVDLVVPSMHTPSVYFYRPTGLDDFFDSRVLKEA  66

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP+AGR
Sbjct  67   LSRALVLFYPLAGR  80



>ref|XP_007156887.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
 gb|ESW28881.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
Length=424

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+TMV+PA+ TP K LW SN+DL+    H   VYFY+PNG+ NFF    +KEAL
Sbjct  1    MTITVKESTMVQPAEGTPRKVLWISNLDLLARDYHSPTVYFYKPNGASNFFHSNTLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMA R
Sbjct  61   SKTLVLFYPMAAR  73



>gb|EPS58233.1| hypothetical protein M569_16582, partial [Genlisea aurea]
Length=137

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +  +TMV+PA  TP   LW SNVDLV+   ++L VYFYRP G+ +FFD   +K AL
Sbjct  1    MKIDVISSTMVQPAAETPRHSLWMSNVDLVIPNAYMLTVYFYRPTGAVDFFDAGVLKAAL  60

Query  377  SRVLVSFYPMAGR  415
               LV FYP+AGR
Sbjct  61   RSALVPFYPVAGR  73



>ref|XP_007149789.1| hypothetical protein PHAVU_005G0988000g, partial [Phaseolus vulgaris]
 gb|ESW21783.1| hypothetical protein PHAVU_005G0988000g, partial [Phaseolus vulgaris]
Length=185

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+ MV+PA+ TP K LW SN+DL+    H   VYFY PNG+ NFF    +KEAL
Sbjct  1    MTIIVKESIMVQPAEATPRKVLWMSNMDLLARNYHSPSVYFYNPNGASNFFHSNILKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMA R
Sbjct  61   SKTLVLFYPMAAR  73



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +K++T+V+PA  TP   LW SN+DLVV   H   VYFYRP  + NFFD   +K AL
Sbjct  1    MKINVKDSTLVRPAAATPMVSLWNSNIDLVVPNFHTPSVYFYRPTAADNFFDAGVLKAAL  60

Query  377  SRVLVSFYPMAGR  415
             R LV FYPMAGR
Sbjct  61   GRALVPFYPMAGR  73



>gb|KJB68259.1| hypothetical protein B456_010G235000 [Gossypium raimondii]
Length=362

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K  +M++PA+ TP ++ W SN+DLV+   H+ +++FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDLVMPTDHVPLLFFYKPNGSSDFFKPQVLQEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVQFYPMAGR  73



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG--SPNFFDPKAMKE  370
            ++I +K+ T+VKPA+ TP + +W SN+DLVV  +H   VYFYRP G  S +FF+ + +KE
Sbjct  1    MKIIVKKRTIVKPAEETPRRSIWNSNLDLVVSNMHTPSVYFYRPAGSNSDHFFNAEVLKE  60

Query  371  ALSRVLVSFYPMAGR  415
            AL+RVLV+FYP+AGR
Sbjct  61   ALARVLVTFYPVAGR  75



>gb|EYU24607.1| hypothetical protein MIMGU_mgv1a006502mg [Erythranthe guttata]
Length=441

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRI-HLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I +K++T+V P   TPS KLW SNVDLV     H  ++YFYR NGS NFFDP  +  A
Sbjct  1    MKITVKKSTVVTPNAATPSGKLWISNVDLVTATTYHTRILYFYRFNGSANFFDPAVLMAA  60

Query  374  LSRVLVSFYPMAGR  415
            LSRVLV +YP+AGR
Sbjct  61   LSRVLVEYYPVAGR  74



>gb|KJB68256.1| hypothetical protein B456_010G234800 [Gossypium raimondii]
Length=445

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K  +M++PA+ TP ++ W SN+D+V+   H+ +++FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDMVITTYHVPLLFFYKPNGSSDFFKPQVLQEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVQFYPMAGR  73



>gb|AGH61997.1| rosmarinic acid synthase [Perilla frutescens]
Length=432

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            +RI +KE+TMV+PA  TPS  +W SN+DL+     H L V+FYR +G+ NFFDP  +K A
Sbjct  1    MRIEVKESTMVRPAAETPSGSVWLSNLDLLSPANYHTLSVHFYRHDGAANFFDPAVLKAA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVDFYPYAGR  74



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN-GSPNFFDPKAMKEALS  379
            I ++++TMV+P++    + LW SNVDLVV   H   VYFYR N G+ NFFD K MKEALS
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  380  RVLVSFYPMAGR  415
            +VLV FYPMAGR
Sbjct  63   KVLVPFYPMAGR  74



>gb|EYU24606.1| hypothetical protein MIMGU_mgv1a005249mg [Erythranthe guttata]
Length=492

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +2

Query  167  CFNTNMASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRI-HLLVVYFYRPNGSPN  343
            CF        ++I +K++TMV P   TPS KLW SNVDLV     H   VYFYR NG+ +
Sbjct  42   CFFPAEKVNHMKITVKKSTMVAPNAATPSGKLWLSNVDLVTATTYHTRSVYFYRFNGAAD  101

Query  344  FFDPKAMKEALSRVLVSFYPMAGR  415
            FFDP  +  ALSRVLV +YP+AGR
Sbjct  102  FFDPAVLMAALSRVLVEYYPIAGR  125



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 53/72 (74%), Gaps = 1/72 (1%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN-GSPNFFDPKAMKEALS  379
            I ++++TMV+P++    + LW SNVDLVV   H   VYFYR N G+ NFFD K MKEALS
Sbjct  3    INVRDSTMVRPSEEVTRRTLWNSNVDLVVPNFHTPSVYFYRSNNGTSNFFDAKIMKEALS  62

Query  380  RVLVSFYPMAGR  415
            +VLV FYPMAGR
Sbjct  63   KVLVPFYPMAGR  74



>gb|ABI48360.1| putative alcohol acyltransferase 1 [Lavandula angustifolia]
Length=460

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I IKE+TMV+PA  TPS  LW SN+DL+     H L V+FY  +GS NFFD  A+KEA
Sbjct  1    MKIEIKESTMVRPAAETPSGSLWLSNLDLLSPANYHTLSVHFYSHDGSANFFDATALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVDFYPYAGR  74



>gb|KJB68255.1| hypothetical protein B456_010G234700, partial [Gossypium raimondii]
Length=463

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K  +M++PA+ TP ++ W SN+D+V+   HL +++FY+PNGS +FF P+ ++EAL
Sbjct  19   MDVSVKRWSMIRPAQDTPKERQWISNLDVVMTTYHLPLLFFYKPNGSSDFFKPQVLQEAL  78

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  79   SKTLVQFYPMAGR  91



>gb|KJB68253.1| hypothetical protein B456_010G234500 [Gossypium raimondii]
Length=445

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K  +M++PA+ TP +K W SN+D+V+   HL ++ FY+PNGS +FF P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKEKQWISNLDVVMTTYHLPLLIFYKPNGSSDFFKPQVLQEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVQFYPMAGR  73



>ref|XP_007011894.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29513.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=543

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++  I  +TMV+PA+ TP+++LW SN+DLV+ R H+  V FY+ + S NFFD + +KE+L
Sbjct  1    MKTTINGSTMVRPARDTPNRRLWNSNLDLVISRYHVTSVCFYKSDASSNFFDTQLLKESL  60

Query  377  SRVLVSFYPMAGR  415
            S +LV FYPMAGR
Sbjct  61   SNILVPFYPMAGR  73



>ref|XP_006427033.1| hypothetical protein CICLE_v10026791mg [Citrus clementina]
 gb|ESR40273.1| hypothetical protein CICLE_v10026791mg [Citrus clementina]
Length=118

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-PNGSPNFFDPKAMKEA  373
            + I +KETT+++PA  TP   L  S +DL+V  IH+L VYFYR PN S +FF+   +KEA
Sbjct  1    MEIHVKETTIIRPAHETPKHCLKISELDLLVPSIHVLGVYFYRRPNNSSDFFEAGLLKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV +YPMAGR
Sbjct  61   LSKVLVPYYPMAGR  74



>gb|KHG08871.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=434

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKE  370
            ++ I IKE+T+V+P +  TP   LW SN+DL+V R H+  VYFY+PNG   FFD   +KE
Sbjct  4    EMEISIKESTIVRPVEEYTPRGSLWNSNLDLLVVRSHVPTVYFYKPNGCSGFFDTGRLKE  63

Query  371  ALSRVLVSFYPMAGR  415
            ALS+VLV FYP+AGR
Sbjct  64   ALSKVLVPFYPIAGR  78



>ref|XP_007033659.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 ref|XP_007033660.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033661.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033662.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033663.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033664.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033665.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033666.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007033667.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04585.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
isoform 1 [Theobroma cacao]
 gb|EOY04586.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04587.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04588.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04589.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04590.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04591.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04592.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY04593.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=433

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I IKE+TMV+PA+ TP++ LW SN+D +V R H+  VYFY P+GS N  D + +K +L
Sbjct  1    MEISIKESTMVRPAQETPNQWLWMSNMDEIVIRSHIPTVYFYIPDGSSNCLDVERLKGSL  60

Query  377  SRVLVSFYPMAGR  415
            SR+LV FYP+AGR
Sbjct  61   SRILVPFYPVAGR  73



>ref|XP_010942060.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Elaeis 
guineensis]
Length=434

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            + I ET +V P   TP  ++W SN+DL+V R H   VYFYRPNG PNFF  +A+K AL +
Sbjct  5    VEILETGLVTPIDDTPKHEIWLSNLDLLVARGHTPTVYFYRPNGDPNFFSVEALKAALGK  64

Query  383  VLVSFYPMAGR  415
             LV FYP+AGR
Sbjct  65   ALVPFYPLAGR  75



>gb|KJB68229.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=423

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            + I IKE+TMV PA+  TP   +W SN+D ++ R H+  VYFY+PNG  +FFD   +KE 
Sbjct  1    MEISIKESTMVHPAEEHTPKGSIWNSNLDRLISRYHVSTVYFYKPNGCSDFFDTGRVKEG  60

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYP+AGR
Sbjct  61   LSKVLVPFYPIAGR  74



>gb|KJB68227.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
 gb|KJB68228.1| hypothetical protein B456_010G233600 [Gossypium raimondii]
Length=422

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKP-TPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            + I IKE+TMV PA+  TP   +W SN+D ++ R H+  VYFY+PNG  +FFD   +KE 
Sbjct  1    MEISIKESTMVHPAEEHTPKGSIWNSNLDRLISRYHVSTVYFYKPNGCSDFFDTGRVKEG  60

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYP+AGR
Sbjct  61   LSKVLVPFYPIAGR  74



>sp|G0LD36.1|RAS_MELOI RecName: Full=Rosmarinate synthase; Short=MoRAS; AltName: Full=Hydroxycinnamoyl-CoA:hydroxyphenyllactate 
hydroxycinnamoyltransferase 
[Melissa officinalis]
 emb|CBW35684.1| hydroxycinnamoyl-CoA:hydroxyphenyllactate hydroxycinnamoyltransferase 
[Melissa officinalis]
Length=427

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/74 (57%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            +RI IK++TMVKPA  TP   +W +N+DL+     H L V+FY  +GS NFFD  A+KEA
Sbjct  1    MRIDIKDSTMVKPAAETPGGSVWLTNLDLLSPANYHTLSVHFYHHDGSENFFDAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVDFYPYAGR  74



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++++TMV+P+     + +W SNVDLVV   H   VYFYR N + NFFD K +KEALS+
Sbjct  3    INVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKIIKEALSK  62

Query  383  VLVSFYPMAGR  415
            VLV FYPMAGR
Sbjct  63   VLVPFYPMAGR  73



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            +++ +K++ MV+P++ TP + LW SN+DL+V   H+  VYFY+PNGS  FF+ + + +AL
Sbjct  1    MKVDVKQSIMVRPSRDTPKRSLWSSNLDLLVPMFHVQTVYFYKPNGSSRFFETQVLTDAL  60

Query  377  SRVLVSFYPMAGR  415
            S VLV FYP AGR
Sbjct  61   SDVLVPFYPAAGR  73



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP-NGSPNFFDPKAMKE  370
            K+ I IKE+ +V+PA+ TP K +W SN+DL+V  +H+  +YFY+P N S +FF+P+ +KE
Sbjct  3    KVDIRIKESAIVRPAEETPKKSIWSSNLDLLVPIVHVPTIYFYKPVNDSSSFFNPQVLKE  62

Query  371  ALSRVLVSFYPMAGR  415
            ALS+ LV FY MAGR
Sbjct  63   ALSKALVPFYHMAGR  77



>ref|XP_007011892.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
 gb|EOY29511.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase, 
putative [Theobroma cacao]
Length=442

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I  K++TMV PA+ T   +LW SN++L++   H+  VYF+RPNGS NFF+ + + EAL
Sbjct  1    MEITTKKSTMVYPAEETQKHRLWSSNLELLMTLHHVPTVYFFRPNGSSNFFNAQVLMEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VLV FYPMAGR
Sbjct  61   SKVLVPFYPMAGR  73



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++ I ++++TMV+P+     + +W SNVDLVV   H   VYFYR N + NFFD K +KEA
Sbjct  13   EMIINVRDSTMVRPSDEVTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKIIKEA  72

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYPMAGR
Sbjct  73   LSKVLVPFYPMAGR  86



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPN---FFDPKAMK  367
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR  G P    FFD + M+
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRGGGPEAEGFFDGERMR  60

Query  368  EALSRVLVSFYPMAGR  415
             AL+  LV FYPMAGR
Sbjct  61   RALAEALVPFYPMAGR  76



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I IKE++MV P + TP+ +L  +N+DL   + H+ +++ Y+PNGS NFF+ K +KEAL
Sbjct  1    MQIIIKESSMVLPNQDTPNHRLEVTNLDLFHAKYHVPLLFLYKPNGSSNFFEVKGLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VLVSFYP+AGR
Sbjct  61   SKVLVSFYPVAGR  73



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  203  ICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSR  382
            I ++   +V+PA+ TP K LW SN+D +  ++ +  VYFYRP+GS NFFD KAMKE+LS+
Sbjct  3    IKVRREEIVEPAEETPKKILWTSNIDQLF-KLLIPSVYFYRPDGSTNFFDVKAMKESLSK  61

Query  383  VLVSFYPMAGR  415
             LVSFYPMAGR
Sbjct  62   ALVSFYPMAGR  72



>ref|XP_007149773.1| hypothetical protein PHAVU_005G097900g [Phaseolus vulgaris]
 gb|ESW21767.1| hypothetical protein PHAVU_005G097900g [Phaseolus vulgaris]
Length=301

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  224  MVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVLVSFYP  403
            MV+ A+ TP K LW S++DL+VG  H   VYFY PNG+ NFF P  +KEALS+ LV FYP
Sbjct  1    MVQSAEATPRKVLWNSDLDLLVGNYHTPTVYFYNPNGASNFFHPNILKEALSKTLVLFYP  60

Query  404  MAGR  415
            MA R
Sbjct  61   MAAR  64



>ref|XP_008370591.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=332

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +2

Query  182  MASEKLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRP--NGSPNFFDP  355
            MA + +++ ++++TMVKP +  P + LW SN+DLV    H+  VYFYRP  N   NFFDP
Sbjct  1    MAEKVMKVSVRDSTMVKPVEEMPPRALWLSNLDLVRRVNHMPSVYFYRPDQNCRSNFFDP  60

Query  356  KAMKEALSRVLVSFYPMAGR  415
              +K ALS+ LV FYP+AGR
Sbjct  61   AVLKHALSKALVLFYPLAGR  80



>ref|XP_008790158.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Phoenix 
dactylifera]
Length=432

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  209  IKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEALSRVL  388
            + E+  V P + TP +++W SN+DL  GR H   VY YRPNG PNFF  + +K AL + L
Sbjct  4    VVESGFVVPGEETPKQEIWLSNLDLWFGRHHTATVYVYRPNGDPNFFSVEGLKAALGKAL  63

Query  389  VSFYPMAGR  415
            VSFYPMAGR
Sbjct  64   VSFYPMAGR  72



>ref|XP_008237042.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=446

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +2

Query  188  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  364
            +EK+ + IKE+TMVKPA+  TP   LW SN+DL   R     VYFYR  G  NFFD   +
Sbjct  2    AEKVTVSIKESTMVKPAEESTPRGSLWLSNLDLEYSRHDTSTVYFYRSTGDENFFDLVVL  61

Query  365  KEALSRVLVSFYPMAGR  415
            K+ALS+ LV FYPMAGR
Sbjct  62   KQALSKALVPFYPMAGR  78



>gb|AEA36976.1| rosmarinic acid synthase [Lavandula angustifolia]
Length=460

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I IKE+TMV+PA  TPS  LW SN+DL+     H L V+FY  +GS NFF   A+KEA
Sbjct  1    MKIEIKESTMVRPAAETPSGSLWLSNLDLLSPANYHTLSVHFYSHDGSANFFGAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVDFYPYAGR  74



>emb|CDG56251.1| hydroxycinnamoyl-CoA:hydroxyphenyllactate hydroxycinnamoyltransferase 
2 [Glechoma hederacea]
Length=398

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I +KE+TMV+PA  TPS  +W SN+DL+     H L V+FY  +GS +FF+  A+KEA
Sbjct  1    MKIDVKESTMVRPAAETPSGSVWLSNLDLLSPANYHTLSVHFYSHDGSADFFEAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVEFYPYAGR  74



>ref|XP_008223321.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=441

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +2

Query  188  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  364
            +EK+ + ++E+TMVKPA+  TP   LW SN DL+    H+  VYFYRP+   NFFD   +
Sbjct  2    AEKVTVRVRESTMVKPAEESTPRSPLWLSNSDLMFPPFHISTVYFYRPSSEHNFFDVGVL  61

Query  365  KEALSRVLVSFYPMAGR  415
            K+ALS+ LV FYP+AGR
Sbjct  62   KQALSKALVPFYPLAGR  78



>ref|XP_011011266.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=433

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            +++  KE+ +V+P +  P + LW SN+DL+  R +L  VY Y+PNGS NFF+   +KEAL
Sbjct  1    MKVNTKESIIVRPVQEMPKQSLWLSNMDLLHPRYYLPTVYLYKPNGSANFFEATVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
             RVLV FYP+AGR
Sbjct  61   GRVLVPFYPVAGR  73



>ref|XP_002324532.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
 gb|EEF03097.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
Length=440

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I IKE++MV P + TP+ +L  +N+DL   + H+ +++ Y+PNGS NFF+ K +KEAL
Sbjct  1    MQITIKESSMVVPTQDTPNHRLEVTNLDLFHAKYHVPLLFIYKPNGSSNFFEGKVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VL SFYP+AGR
Sbjct  61   SKVLESFYPVAGR  73



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++ I +K +TMV PAK TP    W +NVDL+V  +H   VYFYRP  S +FFD + +KEA
Sbjct  7    RMIINVKGSTMVSPAKDTPRCTQWLANVDLMVPTLHTPSVYFYRPTRSDDFFDSRVLKEA  66

Query  374  LSRVLVSFYPMAGR  415
            LS+ LV FYP+AGR
Sbjct  67   LSKALVLFYPVAGR  80



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            ++I +KE++MV P + TP  +L  +N+DL   + H+ ++Y Y+PNGS NFF+ K +KEAL
Sbjct  1    MQITVKESSMVLPTQDTPDHRLEVTNLDLFHAKYHVPLLYLYKPNGSSNFFEVKVLKEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+VL SFYP+AGR
Sbjct  61   SKVLESFYPVAGR  73



>ref|XP_006436001.1| hypothetical protein CICLE_v10033907mg, partial [Citrus clementina]
 gb|ESR49241.1| hypothetical protein CICLE_v10033907mg, partial [Citrus clementina]
Length=137

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYR-PNGSPNFFDPKAMKEA  373
            + I +KE+TM++PA+ TP   L  S +DL++   H+  VYFYR PNGS  FF+   +KEA
Sbjct  1    MEIHVKESTMIQPAQDTPKHCLRMSVLDLLMPSEHIPAVYFYRRPNGSSKFFEAGLLKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV+FYP+AGR
Sbjct  61   LSKVLVAFYPLAGR  74



>ref|XP_007149785.1| hypothetical protein PHAVU_005G0986000g, partial [Phaseolus vulgaris]
 gb|ESW21779.1| hypothetical protein PHAVU_005G0986000g, partial [Phaseolus vulgaris]
Length=64

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + I +KE+ MV+PA+ TP K LW S++DL+ G  H+  +YFY PNG+ NFF P  +KEAL
Sbjct  1    MTISVKESIMVQPAEATPRKVLWNSDLDLLAGNYHIPTLYFYNPNGTSNFFHPNILKEAL  60

Query  377  SRVL  388
            S+ L
Sbjct  61   SKTL  64



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  194  KLRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            K+ I +KE+T V PA+PTP + LW SN D +V R H+  VYF+  +GS  FF+   +K+A
Sbjct  8    KMIINVKESTTVGPAEPTPERTLWISNADQLVRRAHIPTVYFFTSDGSTGFFNLHLLKQA  67

Query  374  LSRVLVSFYPMAGR  415
            LS+VLV FYP AGR
Sbjct  68   LSKVLVPFYPTAGR  81



>gb|AJA31666.1| rosmarinic acid synthase [Salvia miltiorrhiza]
Length=427

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I I ++TMV+PA  TPS  LW SN+DL+     H L V+FYR +GS NFF+  A+KEA
Sbjct  1    MKIDITDSTMVQPAAETPSGSLWLSNLDLLSPANYHTLSVHFYRHDGSGNFFEAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            L R LV FYP AGR
Sbjct  61   LGRALVEFYPYAGR  74



>gb|ADA60182.1| rosmarinic acid synthase [Salvia miltiorrhiza]
Length=427

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I I ++TMV+PA  TPS  LW SN+DL+     H L V+FYR +GS NFF+  A+KEA
Sbjct  1    MKIDITDSTMVQPAAETPSGSLWLSNLDLLSPANYHTLSVHFYRHDGSGNFFEAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            L R LV FYP AGR
Sbjct  61   LGRALVEFYPYAGR  74



>ref|NP_001145871.1| uncharacterized protein LOC100279386 [Zea mays]
 ref|XP_008667774.1| PREDICTED: uncharacterized protein LOC100279386 isoform X1 [Zea 
mays]
 gb|ACF84552.1| unknown [Zea mays]
 gb|ACF86236.1| unknown [Zea mays]
 gb|ACL52770.1| unknown [Zea mays]
 gb|ACN28217.1| unknown [Zea mays]
 tpg|DAA37089.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 1 [Zea 
mays]
 tpg|DAA37090.1| TPA: anthranilate N-benzoyltransferase protein 2 isoform 2 [Zea 
mays]
Length=440

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG----SPNFFDPKAM  364
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR +G    +  FFD + M
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRDGPVPDAEGFFDGERM  60

Query  365  KEALSRVLVSFYPMAGR  415
            + AL+  LV FYPMAGR
Sbjct  61   RRALAEALVPFYPMAGR  77



>emb|CDG56253.1| hydroxycinnamoyltransferase 2 [Glechoma hederacea]
Length=431

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            +++ +KE+TMVKP + TP   LW SNVD ++    H   VYF+R +GS NFFD   +K A
Sbjct  1    MKMSVKESTMVKPMEETPGGSLWLSNVDFLMPDSYHTPSVYFFRHDGSANFFDAAELKAA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVHFYPFAGR  74



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPN--GSPNFFDPKAMKE  370
            + I +   TMV+PA+ TP + LW SNVDLV+ RIH   VYFYRP+  G   +F+   ++E
Sbjct  1    MEINVVRETMVRPAEATPQRVLWNSNVDLVIPRIHTASVYFYRPDPSGGEGYFEGGVLRE  60

Query  371  ALSRVLVSFYPMAGR  415
            AL++ LV FYPMAGR
Sbjct  61   ALAKALVPFYPMAGR  75



>emb|CDG56250.1| hydroxycinnamoyl-CoA:hydroxyphenyllactate hydroxycinnamoyltransferase 
1 [Glechoma hederacea]
Length=432

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVV-GRIHLLVVYFYRPNGSPNFFDPKAMKEA  373
            ++I +KE+TMV+PA  TPS  +W SN+DL+     H L V+FY  +GS +FF+  A+KEA
Sbjct  1    MKIDVKESTMVRPAAETPSGSVWLSNLDLLSPANYHTLSVHFYSHDGSADFFEAAALKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LSR LV FYP AGR
Sbjct  61   LSRALVEFYPYAGR  74



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  358
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPGQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  359  AMKEALSRVLVSFYPMAGR  415
             +K+ALS+ LV FYP+AGR
Sbjct  64   VLKQALSKALVPFYPLAGR  82



>gb|KJB68258.1| hypothetical protein B456_010G234900 [Gossypium raimondii]
Length=429

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAMKEAL  376
            + + +K  +M++PA+ TP ++ W SN+DLV+   H+ +++FY+PNGS ++  P+ ++EAL
Sbjct  1    MDVSVKRWSMIRPAQDTPKERQWISNLDLVMPTDHVPLLFFYKPNGSSDYSKPQVLQEAL  60

Query  377  SRVLVSFYPMAGR  415
            S+ LV FYPMAGR
Sbjct  61   SKTLVQFYPMAGR  73



>gb|ACG47161.1| anthranilate N-benzoyltransferase protein 2 [Zea mays]
Length=442

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 53/77 (69%), Gaps = 4/77 (5%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG----SPNFFDPKAM  364
            + I ++ +TMV+PA+ TP ++LW SN+DLVV R H   VYFYR +G    +  FFD + M
Sbjct  1    MAITVRRSTMVRPARETPRQRLWNSNLDLVVPRFHTPSVYFYRRDGPVPDAEGFFDGERM  60

Query  365  KEALSRVLVSFYPMAGR  415
            + AL+  LV FYPMAGR
Sbjct  61   RRALAEALVPFYPMAGR  77



>ref|XP_007217854.1| hypothetical protein PRUPE_ppa024073mg [Prunus persica]
 gb|EMJ19053.1| hypothetical protein PRUPE_ppa024073mg [Prunus persica]
Length=430

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  188  SEKLRICIKETTMVKPAK-PTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSPNFFDPKAM  364
            +EK+ + ++E+TMV+PA+  TP   LW SN DL     H   VYFYR +G  NFFD + +
Sbjct  2    TEKVTVSVRESTMVRPAEESTPRGSLWLSNSDLAFTPFHTSSVYFYRTSGELNFFDRRVL  61

Query  365  KEALSRVLVSFYPMAGR  415
            K+ALS+VLV F PMAGR
Sbjct  62   KQALSKVLVPFCPMAGR  78



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  358
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  359  AMKEALSRVLVSFYPMAGR  415
             +K+ALS+ LV FYP+AGR
Sbjct  64   VLKQALSKALVPFYPLAGR  82



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 6/79 (8%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNGSP------NFFDPK  358
            + + ++E+T+VKPA+ TP + LW +N+DLV+   H   VYFYR N +       NFFDP+
Sbjct  4    VNVSVRESTLVKPAEETPRQVLWMTNLDLVILGNHTPSVYFYRQNQNSVHGHHNNFFDPQ  63

Query  359  AMKEALSRVLVSFYPMAGR  415
             +K+ALS+ LV FYP+AGR
Sbjct  64   VLKQALSKALVPFYPLAGR  82



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  197  LRICIKETTMVKPAKPTPSKKLWCSNVDLVVGRIHLLVVYFYRPNG-SPNFFDPKAMKEA  373
            ++I +K+ +MV PAK TP   LW SN+D VV RIH+  VY Y+PN    NFFD   +KEA
Sbjct  1    MKIEVKKWSMVCPAKHTPKHTLWMSNLDSVVPRIHVPTVYLYKPNAFCSNFFDASRLKEA  60

Query  374  LSRVLVSFYPMAGR  415
            LS  LV FYP+AGR
Sbjct  61   LSNALVQFYPVAGR  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560060235700