BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030J06

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN76413.1|  hypothetical protein VITISV_043812                     225   8e-69   Vitis vinifera
emb|CDP05334.1|  unnamed protein product                                231   2e-68   Coffea canephora [robusta coffee]
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    229   9e-68   Solanum lycopersicum
ref|XP_006587679.1|  PREDICTED: conserved oligomeric Golgi comple...    226   1e-67   
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    228   2e-67   Populus euphratica
ref|XP_010089680.1|  hypothetical protein L484_001268                   228   2e-67   Morus notabilis
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    228   2e-67   
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    228   3e-67   Cicer arietinum [garbanzo]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    228   3e-67   Cucumis melo [Oriental melon]
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         228   3e-67   Jatropha curcas
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    227   5e-67   Citrus sinensis [apfelsine]
gb|AIU51141.1|  embryo yellow protein                                   215   5e-67   Saruma henryi
ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    227   7e-67   Solanum tuberosum [potatoes]
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            227   8e-67   Glycine soja [wild soybean]
gb|AIU51131.1|  embryo yellow protein                                   226   9e-67   Manihot esculenta [manioc]
gb|AIU51119.1|  embryo yellow protein                                   226   9e-67   Glycine max [soybeans]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            226   9e-67   Glycine soja [wild soybean]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    226   9e-67   Glycine max [soybeans]
gb|AIU51115.1|  embryo yellow protein                                   226   9e-67   Carica papaya [mamon]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             226   1e-66   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   226   1e-66   Phaseolus vulgaris [French bean]
ref|XP_002510953.1|  conserved hypothetical protein                     226   1e-66   Ricinus communis
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             226   1e-66   Citrus clementina [clementine]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   226   1e-66   Citrus sinensis [apfelsine]
gb|AIU51140.1|  embryo yellow protein                                   226   1e-66   Ricinus communis
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                225   3e-66   Erythranthe guttata [common monkey flower]
gb|AIU51149.1|  embryo yellow protein                                   225   4e-66   Lactuca sativa [cultivated lettuce]
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    225   4e-66   Cucumis sativus [cucumbers]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    225   4e-66   
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    224   5e-66   Eucalyptus grandis [rose gum]
gb|KEH17632.1|  oligomeric component-related/COG complex component      224   6e-66   Medicago truncatula
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    224   8e-66   Vitis vinifera
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    221   8e-66   
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    223   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    223   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    223   1e-65   
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          220   1e-64   Amborella trichopoda
gb|AIU51114.1|  embryo yellow protein                                   220   2e-64   Gossypium raimondii
gb|AIU51112.1|  embryo yellow protein                                   219   4e-64   Sarcandra glabra
gb|AIU51152.1|  embryo yellow protein                                   219   4e-64   Platanus x hispanica [London plane tree]
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    219   5e-64   Nicotiana tomentosiformis
emb|CDX99921.1|  BnaC09g27840D                                          216   6e-64   
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    219   6e-64   Sesamum indicum [beniseed]
gb|AIU51106.1|  embryo yellow protein                                   219   7e-64   Magnolia denudata [haku-mokuren]
gb|AIU51110.1|  embryo yellow protein                                   218   7e-64   Theobroma cacao [chocolate]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    218   8e-64   
gb|AIU51154.1|  embryo yellow protein                                   218   8e-64   Houttuynia cordata [chameleon-plant]
gb|EPS73811.1|  hypothetical protein M569_00940                         218   1e-63   Genlisea aurea
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    218   1e-63   Nicotiana sylvestris
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    217   2e-63   Fragaria vesca subsp. vesca
gb|AIU51129.1|  embryo yellow protein                                   217   2e-63   Medicago truncatula
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         217   3e-63   Medicago truncatula
gb|AIU51151.1|  embryo yellow protein                                   217   3e-63   Cinnamomum camphora
gb|AIU51120.1|  embryo yellow protein                                   216   4e-63   Illicium henryi
gb|AIU51121.1|  embryo yellow protein                                   216   4e-63   Buxus sinica
emb|CDY00475.1|  BnaA10g07980D                                          216   4e-63   
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    216   5e-63   
emb|CDY56655.1|  BnaA02g11250D                                          216   7e-63   Brassica napus [oilseed rape]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    216   7e-63   Brassica rapa
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    216   8e-63   Nelumbo nucifera [Indian lotus]
gb|AIU51102.1|  embryo yellow protein                                   215   1e-62   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU51147.1|  embryo yellow protein                                   215   1e-62   Schrenkiella parvula
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             215   2e-62   Eutrema salsugineum [saltwater cress]
gb|AIU51136.1|  embryo yellow protein                                   213   5e-62   Prunus persica
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    213   5e-62   Prunus mume [ume]
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             213   6e-62   Prunus persica
gb|AIU51125.1|  embryo yellow protein                                   212   1e-61   Chimonanthus praecox [wintersweet]
emb|CDX91578.1|  BnaC02g15820D                                          211   2e-61   
ref|XP_010442641.1|  PREDICTED: conserved oligomeric Golgi comple...    207   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    211   3e-61   Tarenaya hassleriana [spider flower]
gb|AIU51116.1|  embryo yellow protein                                   211   3e-61   Capsella rubella
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             211   3e-61   Capsella rubella
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    211   3e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    211   4e-61   Arabis alpina [alpine rockcress]
gb|AIU51104.1|  embryo yellow protein                                   211   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199956.1|  COG7-like protein EYE                                 211   4e-61   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00649.1|  hypothetical protein                                   211   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AIU51103.1|  embryo yellow protein                                   211   4e-61   Arabidopsis lyrata [lyrate rockcress]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             211   4e-61   
gb|AIU51157.1|  embryo yellow protein                                   211   4e-61   Trachycarpus fortunei
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    211   4e-61   Elaeis guineensis
gb|AIU51143.1|  embryo yellow protein                                   211   5e-61   Yucca filamentosa [Adam's-needle]
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    210   8e-61   Camelina sativa [gold-of-pleasure]
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    209   1e-60   Phoenix dactylifera
gb|AIU51153.1|  embryo yellow protein                                   208   3e-60   Ginkgo biloba [ginkgo]
gb|AIU51158.1|  embryo yellow protein                                   208   4e-60   Cabomba caroliniana
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    208   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    204   2e-59   
gb|AIU51150.1|  embryo yellow protein                                   204   6e-59   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU51124.1|  embryo yellow protein                                   204   7e-59   Ceratophyllum demersum [hornwort]
gb|AIU51107.1|  embryo yellow protein                                   204   8e-59   Musa acuminata [banana]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    204   8e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51156.1|  embryo yellow protein                                   204   1e-58   Alisma plantago-aquatica
gb|AIU51127.1|  embryo yellow protein                                   204   1e-58   Asparagus officinalis
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         203   1e-58   
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    200   3e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51142.1|  embryo yellow protein                                   195   1e-55   Dioscorea oppositifolia
gb|EEC81147.1|  hypothetical protein OsI_24056                          194   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    194   4e-55   Oryza brachyantha
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        194   5e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AIU51108.1|  embryo yellow protein                                   193   1e-54   Pinellia ternata
dbj|BAJ95800.1|  predicted protein                                      192   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94393.1|  predicted protein                                      192   2e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51146.1|  embryo yellow protein                                   190   1e-53   Sorghum bicolor [broomcorn]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    190   1e-53   
gb|AIU51155.1|  embryo yellow protein                                   190   1e-53   Zea mays [maize]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          190   1e-53   Sorghum bicolor [broomcorn]
gb|AIU51128.1|  embryo yellow protein                                   188   4e-53   Aristolochia tagala
gb|AIU51144.1|  embryo yellow protein                                   188   4e-53   Setaria italica
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    188   4e-53   Setaria italica
gb|AIU51137.1|  embryo yellow protein                                   188   6e-53   Panicum virgatum
ref|XP_001770876.1|  predicted protein                                  185   8e-52   
gb|AIU51130.1|  embryo yellow protein                                   184   2e-51   Canna indica [canna]
gb|AIU51109.1|  embryo yellow protein                                   173   8e-48   Brachypodium distachyon [annual false brome]
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    174   9e-48   
gb|AIU51111.1|  embryo yellow protein                                   171   1e-46   Acorus calamus [flagroot]
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             158   3e-42   
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             155   4e-41   
gb|EEE66191.1|  hypothetical protein OsJ_22310                          149   9e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    128   2e-31   Eucalyptus grandis [rose gum]
gb|EMT03910.1|  hypothetical protein F775_26031                         119   3e-28   
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       119   3e-28   Triticum urartu
ref|XP_003055554.1|  predicted protein                                  110   5e-25   Micromonas pusilla CCMP1545
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750           93.2    4e-19   Chlorella variabilis
ref|XP_002503576.1|  predicted protein                                89.0    1e-17   Micromonas commoda
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7         87.0    5e-17   Ostreococcus tauri
ref|XP_002953697.1|  component of oligomeric golgi complex 7          87.0    6e-17   Volvox carteri f. nagariensis
ref|XP_001418731.1|  predicted protein                                84.3    5e-16   Ostreococcus lucimarinus CCE9901
ref|XP_001628559.1|  predicted protein                                83.6    8e-16   Nematostella vectensis
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  82.8    2e-15   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  82.0    4e-15   Apis dorsata [rock honeybee]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  81.3    5e-15   Apis dorsata [rock honeybee]
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  80.5    1e-14   
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  80.5    1e-14   
ref|XP_001701937.1|  component of oligomeric golgi complex 7          80.5    1e-14   Chlamydomonas reinhardtii
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  79.7    2e-14   Acromyrmex echinatior
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    3e-14   Bombus terrestris [large earth bumblebee]
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          79.3    3e-14   Acromyrmex echinatior
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  79.3    3e-14   
ref|XP_006825808.1|  PREDICTED: conserved oligomeric Golgi comple...  75.5    4e-14   Saccoglossus kowalevskii
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  78.6    5e-14   Solenopsis invicta [imported red fire ant]
ref|XP_007513783.1|  predicted protein                                78.6    6e-14   Bathycoccus prasinos
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    6e-14   
gb|EFZ22757.1|  hypothetical protein SINV_01051                       78.2    6e-14   
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  78.2    7e-14   Harpegnathos saltator
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 77.8    7e-14   Acanthamoeba castellanii str. Neff
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          77.8    8e-14   Zootermopsis nevadensis
ref|XP_637633.1|  oligomeric Golgi complex component                  77.4    1e-13   Dictyostelium discoideum AX4
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            77.4    1e-13   Coccomyxa subellipsoidea C-169
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    3e-13   
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-13   
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-13   
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-13   
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           75.1    7e-13   Lottia gigantea
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          73.9    2e-12   Crassostrea gigas
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  73.9    2e-12   Crassostrea gigas
gb|EFA86654.1|  oligomeric Golgi complex component                    72.4    6e-12   Heterostelium album PN500
ref|XP_008474492.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    1e-11   
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    1e-11   Fopius arisanus
ref|XP_007903980.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    2e-11   Callorhinchus milii [Australian ghost shark]
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    2e-11   Fopius arisanus
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    2e-11   Callorhinchus milii [Australian ghost shark]
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    2e-11   Fopius arisanus
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    3e-11   Xiphophorus maculatus
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    3e-11   Ciona intestinalis [sea vase]
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    3e-11   
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    5e-11   
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    6e-11   Stegastes partitus
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     69.3    7e-11   Gallus gallus [bantam]
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    2e-10   Takifugu rubripes [tiger puffer]
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    2e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    2e-10   
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    2e-10   Oryzias latipes [Japanese rice fish]
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    2e-10   Meleagris gallopavo [common turkey]
emb|CAG04322.1|  unnamed protein product                              67.4    2e-10   Tetraodon nigroviridis
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                67.8    2e-10   Capitella teleta
emb|CBN81326.1|  Conserved oligomeric Golgi complex subunit 7         67.0    2e-10   Dicentrarchus labrax [European sea bass]
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  67.8    3e-10   
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    3e-10   Sorex araneus [Eurasian shrew]
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Oreochromis niloticus
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Nasonia vitripennis
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Maylandia zebra
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Nasonia vitripennis
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Pundamilia nyererei
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Fukomys damarensis [Damara mole rat]
ref|NP_001015714.1|  component of oligomeric golgi complex 7          67.4    3e-10   Xenopus tropicalis [western clawed frog]
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    3e-10   Nasonia vitripennis
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   Orycteropus afer afer
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    4e-10   Poecilia reticulata
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    4e-10   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    4e-10   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   Lepisosteus oculatus
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   Poecilia formosa
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   Poecilia formosa
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   Chelonia mydas [green seaturtle]
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    4e-10   
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    5e-10   Chrysemys picta bellii
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     66.6    6e-10   Danio rerio [leopard danio]
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    7e-10   Haplochromis burtoni
gb|KFM79728.1|  Conserved oligomeric Golgi complex subunit 7          63.2    7e-10   Stegodyphus mimosarum
ref|NP_001085832.1|  component of oligomeric golgi complex 7          65.5    1e-09   Xenopus laevis [clawed frog]
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    1e-09   Alligator sinensis
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  65.5    2e-09   
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    2e-09   Microtus ochrogaster [prairie voles]
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    2e-09   
gb|KJE94721.1|  hypothetical protein CAOG_009840                      65.1    2e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_004347003.2|  hypothetical protein CAOG_05318                  64.7    3e-09   Capsaspora owczarzaki ATCC 30864
ref|XP_004360949.1|  oligomeric Golgi complex component               64.7    3e-09   Cavenderia fasciculata
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    4e-09   Esox lucius
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          63.9    5e-09   Buceros rhinoceros silvestris
emb|CDQ66102.1|  unnamed protein product                              63.5    7e-09   Oncorhynchus mykiss
ref|XP_003285944.1|  hypothetical protein DICPUDRAFT_15317            62.4    2e-08   Dictyostelium purpureum
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    2e-08   Ochotona princeps [southern American pika]
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    2e-08   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    3e-08   Aplysia californica
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  61.2    4e-08   Ixodes scapularis [blacklegged tick]
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  60.1    9e-08   
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  59.3    1e-07   Tribolium castaneum [rust-red flour beetle]
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  58.9    2e-07   
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    3e-07   Buceros rhinoceros silvestris
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    4e-07   
gb|ERL93874.1|  hypothetical protein D910_11160                       55.8    2e-06   Dendroctonus ponderosae
ref|XP_009024750.1|  hypothetical protein HELRODRAFT_178406           55.1    3e-06   Helobdella robusta
gb|EXX54575.1|  hypothetical protein RirG_233350                      54.7    5e-06   Rhizophagus irregularis DAOM 197198w
gb|ESA17025.1|  hypothetical protein GLOINDRAFT_345271                54.7    6e-06   
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          54.3    7e-06   Pteropus alecto
ref|XP_001357618.1|  GA15960                                          53.9    9e-06   Drosophila pseudoobscura pseudoobscura
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  53.9    1e-05   Latimeria chalumnae
ref|XP_002058398.1|  GJ14333                                          53.5    1e-05   Drosophila virilis
gb|EEZ99445.1|  hypothetical protein TcasGA2_TC030721                 53.1    2e-05   
ref|XP_002073360.1|  GK14089                                          53.1    2e-05   Drosophila willistoni
gb|KGB34884.1|  Conserved oligomeric Golgi complex subunit 7          52.4    2e-05   Schistosoma haematobium
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      52.8    2e-05   
ref|XP_002911600.1|  hypothetical protein CC1G_14133                  52.8    2e-05   Coprinopsis cinerea okayama7#130
ref|XP_001993908.1|  GH22206                                          52.8    2e-05   Drosophila grimshawi
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            51.6    4e-05   Trichoplax adhaerens
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  51.6    6e-05   Musca domestica
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  51.2    6e-05   Bactrocera dorsalis [papaya fruit fly]
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...  51.2    7e-05   Camelina sativa [gold-of-pleasure]
gb|KIK67210.1|  hypothetical protein GYMLUDRAFT_857700                50.8    1e-04   Gymnopus luxurians FD-317 M1
ref|XP_007323090.1|  hypothetical protein SERLADRAFT_418038           50.8    1e-04   Serpula lacrymans var. lacrymans S7.9
ref|XP_002001440.1|  GI21972                                          49.3    3e-04   Drosophila mojavensis
ref|XP_003030457.1|  hypothetical protein SCHCODRAFT_57227            49.3    3e-04   Schizophyllum commune H4-8
ref|XP_002431030.1|  conserved hypothetical protein                   48.5    6e-04   Pediculus humanus corporis [human body lice]
gb|KIK39828.1|  hypothetical protein CY34DRAFT_14142                  48.1    7e-04   Suillus luteus UH-Slu-Lm8-n1
gb|KDR75221.1|  hypothetical protein GALMADRAFT_122928                48.1    8e-04   Galerina marginata CBS 339.88
ref|XP_011399022.1|  Conserved oligomeric Golgi complex subunit 7     47.4    0.001   Auxenochlorella protothecoides



>emb|CAN76413.1| hypothetical protein VITISV_043812 [Vitis vinifera]
Length=444

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   231 bits (590),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDALSLRSSV+SILQKL KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDALSLRSSVASILQKLIKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA RDVIRLRDDALSLRSS+S+ILQKL+KAEGSSAESVATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRANRDVIRLRDDALSLRSSLSAILQKLKKAEGSSAESVATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>ref|XP_006587679.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Glycine max]
Length=636

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLRS+V+SILQKL+KAEGSSAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRSAVASILQKLKKAEGSSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLR+SVSSILQKL+KAEG+SAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRTSVSSILQKLKKAEGTSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDD++SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDSVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS ILQKL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILQKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA++L RVPRATRDVIRLRDDALSLR+SVSSILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSATSLLRVPRATRDVIRLRDDALSLRNSVSSILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYRTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51141.1| embryo yellow protein, partial [Saruma henryi]
Length=262

 Score =   215 bits (547),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQL VL
Sbjct  173  RKQLAVL  179



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA RDVIRLRDDALSLRSS+S+IL KL+KAEGSSAESVATLAKVDT
Sbjct  53   SLEEQSAAALLRVPRANRDVIRLRDDALSLRSSLSAILLKLKKAEGSSAESVATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVE+VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEEVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   227 bits (578),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA++L RVPRATRDVIRLRDDA+SLR+SVS ILQKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAASLLRVPRATRDVIRLRDDAVSLRNSVSGILQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME AYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMETAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSS+ES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDVVRLRDDAVSLRSSVAGILQKLKKAEGSSSESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVIRLRDDA+SLRS+VSSILQKL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLRVPRATRDVIRLRDDAVSLRSAVSSILQKLKKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYDTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLR SVS ILQKL+KAEGSSAES+A L+KVDT
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAISLRGSVSGILQKLKKAEGSSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSLTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR+SVS+I QKL+KAEGSSAES+A LAKVDT
Sbjct  52   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRNSVSAIFQKLKKAEGSSAESIAALAKVDT  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  172  RRQLEVL  178



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S+SAL RVPRA+RDV+RLRDDALSLRSSV++IL  L+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSSALLRVPRASRDVLRLRDDALSLRSSVANILLFLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++A+ RVPRATRDVIRLRDDALSLR SV SIL KL+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAAILRVPRATRDVIRLRDDALSLRQSVGSILLKLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+S DLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASKDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEELSA+AL RVPRATRDVIRLRDDA+SLRS+VS IL KL+KAEGSSAES+A LA+VDT
Sbjct  53   SLEELSANALLRVPRATRDVIRLRDDAVSLRSAVSGILLKLKKAEGSSAESIAALARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGL QLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLAQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRD++RLRDDA+SLR SVS ILQKL+KAEGSSAES++ LAKVDT
Sbjct  53   SLEEQSAAALLRVPRATRDIVRLRDDAVSLRHSVSGILQKLKKAEGSSAESISALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLRS+VS+ILQKL+KAEGSS+ES++ LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRSAVSAILQKLKKAEGSSSESISALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQL+VL
Sbjct  173  RKQLQVL  179



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRATRDVIRLRDDA+SLR SVSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSAAALLRVPRATRDVIRLRDDAVSLRHSVSSILLKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPKAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYET QDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETSQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+RLRDDA+SLRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRLRDDAVSLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+ELSASAL R+PRA+RDV+RLRDDA+SLRS++S ILQKL KAEGSSAES+A LAKVD 
Sbjct  53   SLDELSASALLRIPRASRDVVRLRDDAISLRSAISGILQKLEKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLS VGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSVVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDV+RL+DDA+SLR+SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSSAALLRVPRATRDVLRLQDDAVSLRNSVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRSSVS IL KL+KAEGSSAESVA LAK+DT
Sbjct  53   SLDEQSGAALLRVPRASRDVIRLRDDAVSLRSSVSGILLKLKKAEGSSAESVAALAKIDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSA+GEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAIGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES++ LAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVIRLRDDAVSLRNSVSGILLKLKKAEGSSAESISALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPR TRDV RLRDD+L+LRS++S+IL KL+KAEGSSAESVATLAKVD 
Sbjct  53   SLEEQSAAALLRVPRTTRDVSRLRDDSLTLRSALSAILLKLKKAEGSSAESVATLAKVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLAAVGEVAEFANI  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  53   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDV+RLRD+ALSLRSSV++IL  L+KAEGSSAES+ATLAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVLRLRDEALSLRSSVANILLFLKKAEGSSAESIATLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCL+AVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S++ALHRVPRA+RDV+RLRDDA+SLRS+VS IL KL+KAEG+S+ESVA LAKVDT
Sbjct  53   SLDEQSSAALHRVPRASRDVVRLRDDAVSLRSAVSGILVKLKKAEGTSSESVAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDV+RLR+DA+SLR SV+ IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSAAALLRVPRASRDVLRLREDAVSLRISVAGILDKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E SA+AL R+PRATRDV+RLRDDALSLRS+VS+IL KL+KAEGSSAE++A LAKVDT
Sbjct  53   SLDEQSAAALLRIPRATRDVVRLRDDALSLRSAVSAILLKLKKAEGSSAEAIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQL VL
Sbjct  173  RKQLAVL  179



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++A+ R+PRA+RDV+RL+DDALSLRSS++ IL  L+KAEGSSAES+ATLA+VDT
Sbjct  53   SLEEQSSAAILRIPRASRDVLRLQDDALSLRSSIAGILLFLKKAEGSSAESIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPR TRDV RLRDDAL+LRS++S+IL KL+KAEGSSAESVATLAKVD 
Sbjct  53   SLEEQSAAALLRVPRTTRDVSRLRDDALTLRSALSAILLKLKKAEGSSAESVATLAKVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANM HCL+AVGEVAEFANI
Sbjct  113  VKRRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMSHCLAAVGEVAEFANI  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATR+VIRLRDDA+SLRS+VSSIL KL+KAEG SAES+  LAK D 
Sbjct  53   SLEEQSASSLLRVPRATREVIRLRDDAVSLRSAVSSILDKLKKAEGLSAESIMALAKYDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL  VPRATRDV+RLRDDA SLRS+VS IL  L+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSSAALLHVPRATRDVVRLRDDAGSLRSAVSVILHNLQKAEGSSAESIAALAKVDV  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSSTVEDVFTSGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRD+A+SLRSSVS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLDEQSNAALLRVPRASRDVIRLRDEAISLRSSVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRD+A+SLRSS+S ILQ+L+KAEG SAES+A L+KVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDEAISLRSSLSGILQRLKKAEGCSAESIAALSKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            R+QLEVL
Sbjct  173  RRQLEVL  179



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRA+RDVIRLRDDA+SLR+SVS IL KL+KAEGSSAES+A LAKVDT
Sbjct  53   SLEEQSSAALLRVPRASRDVIRLRDDAMSLRNSVSGILLKLKKAEGSSAESIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLT+LS++VE VF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYETLQDAAGLTELSASVEGVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  52   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S SAL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD+
Sbjct  53   SLEEQSGSALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD 
Sbjct  52   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDC  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSAE +ATLA+VD 
Sbjct  52   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSAECIATLARVDC  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  112  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  171

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  172  RKQLEVL  178



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S+++L RVPRA+RDVIRLRDDA+SLR+SV+ IL KL+KAEGSSAESVA LAKVDT
Sbjct  53   SLEEQSSASLLRVPRASRDVIRLRDDAISLRNSVTGILLKLKKAEGSSAESVAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEF+N+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFSNV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+AL RVPRA+RDVIRLRDDALS R+SVS IL KL+KAEGSSAES+  LAKVD 
Sbjct  53   SLEEQSAAALLRVPRASRDVIRLRDDALSFRTSVSGILLKLKKAEGSSAESIDALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDT
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +ATLA+VDT
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIATLARVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SAS+L RVPRATRDV+RLRDDA++LRS+VSSIL KL+KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASSLLRVPRATRDVVRLRDDAVTLRSAVSSILDKLKKAEGSSAESIAALAKVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLS+TVEDVF+SGDLP AAE LA+MRHCLSAVGEVAEFANI
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSATVEDVFASGDLPLAAEHLASMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  27   ALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAA  206
            AL R+PRA+RDVIRLRD+A+SLRSSVSSIL KL+KAEGSSAES+A LAKVDTVK+RMEAA
Sbjct  61   ALLRIPRASRDVIRLRDEAVSLRSSVSSILLKLKKAEGSSAESIAALAKVDTVKQRMEAA  120

Query  207  YETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  383
            YETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+RKQLEVL
Sbjct  121  YETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANVRKQLEVL  179



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLRSSV+ ILQKL+KAEGSSA+ +ATLA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRSSVAGILQKLKKAEGSSADCIATLARVDC  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TLQDA+GLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAFKTLQDASGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_010442641.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Camelina sativa]
Length=491

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A L++VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALSRVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  A+ RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGAILRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETL++MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLSSMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSA+ +A LA+VD 
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSADCIAALARVDN  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPVACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   211 bits (536),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPLACRDVVRLRDDALALRSIISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S+ AL RVP A RDV RLR+DA+ LRS+VSSILQKL+KAEG+SAES+A LAK+DT
Sbjct  54   SLERESSDALRRVPLAVRDVARLREDAIQLRSAVSSILQKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +ATLA+VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIATLARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RDV+RLRDDAL+LRS +SSIL KL+KAEG+SAES+A LAK+DT
Sbjct  54   ALERESADALRRVPLACRDVVRLRDDALALRSVISSILLKLKKAEGTSAESIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLP+AAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPQAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E SA+AL RVPRA+RDVIR+RDDA++LRS+VS ILQKL+KAEGSSAES+A LA+VDT
Sbjct  28   SLDEQSAAALLRVPRASRDVIRVRDDAIALRSAVSGILQKLKKAEGSSAESIAALARVDT  87

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLT+LS+TVEDVF+SGDL +AAETLANMRHCLS VGEVAEFAN+
Sbjct  88   VKQRMEAAYETLQDAAGLTKLSATVEDVFASGDLSQAAETLANMRHCLSVVGEVAEFANV  147

Query  363  RKQLEVL  383
            ++QLEVL
Sbjct  148  KRQLEVL  154



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPR+TRDV+RLRDDA SLRS+V  ILQ+L+KAEGSSAES+  LA++D 
Sbjct  21   SLDEQSQAALLRVPRSTRDVVRLRDDASSLRSAVLLILQRLKKAEGSSAESITALAEIDM  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  81   VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  140

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  141  RKQLEVL  147



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL RVPRATRDV+RLRDDA+SLR SV+ ILQKL+KAEGSSAE +A LA+VD+
Sbjct  53   SLEEQSGGALLRVPRATRDVLRLRDDAVSLRGSVAGILQKLKKAEGSSAECIAALARVDS  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY+TLQDA GLTQLSSTVE VF+SGDLPRAAETLA+MR+CLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYKTLQDADGLTQLSSTVESVFNSGDLPRAAETLASMRNCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 6/127 (5%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SASAL RVPRATRDV+R+RDDA      VSSIL K +KAEGSSAES+A LAKVD 
Sbjct  53   SLEEQSASALLRVPRATRDVVRIRDDA------VSSILDKFKKAEGSSAESMAALAKVDI  106

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS+TVEDVF+SGDLP AAETLANMRHCLSAVGEVAEFAN+
Sbjct  107  VKQRMEAAYETLQDAAGLTQLSATVEDVFASGDLPLAAETLANMRHCLSAVGEVAEFANL  166

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  167  RKQLEVL  173



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S+++L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD 
Sbjct  53   SLDEQSSASLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S+++L RVPRA+RDV+RLR+DA++L++SV+ ILQKL KAEG+++ESVA LA VD 
Sbjct  53   SLDEQSSASLLRVPRASRDVVRLREDAMTLKASVTGILQKLIKAEGTASESVAALATVDI  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCL+AVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLTAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDS  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D+
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLALSKAEGTSAESIAAIAKIDS  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  S  AL RVP A RDV+RLRD+A+SLR+ VS ILQKL KA+GSSAE+++ +AK+D 
Sbjct  54   ALERESTDALRRVPVAVRDVLRLRDEAISLRAVVSGILQKLNKADGSSAEAISAIAKIDV  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME+AYETLQDAAGLTQLS+TVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  114  VKKRMESAYETLQDAAGLTQLSATVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S+ AL RVP A RDV RLR+DA+ LRS+V+SILQKL+KAEG+SAE +A LAK+DT
Sbjct  54   SLERESSDALRRVPAAVRDVARLREDAIQLRSAVNSILQKLKKAEGTSAEHIAALAKIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDL RAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLSRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S++AL RVPRATRDVI LRDDA SL S+VS IL  L+K  GSSAES+A LAKVD 
Sbjct  49   SLEEQSSAALLRVPRATRDVICLRDDAGSLCSAVSVILHNLQKRNGSSAESIAALAKVDV  108

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RME AYETLQDAAGLTQLSSTVEDVF SGDLP AAETLANMRHCLSAVGEVAEFANI
Sbjct  109  VKQRMEVAYETLQDAAGLTQLSSTVEDVFDSGDLPCAAETLANMRHCLSAVGEVAEFANI  168

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  169  RKQLEVL  175



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA+A+ RVPRATRDVIR+RDDA+SLRSS+SSIL K+++AEGS+A+S+A LAKVDT
Sbjct  53   SLEEQSAAAILRVPRATRDVIRIRDDAVSLRSSISSILGKIKQAEGSAADSIAALAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAAY+TLQDAAGLTQLSSTVEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFANI
Sbjct  113  VKFRMEAAYKTLQDAAGLTQLSSTVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANI  172

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  173  RKQLEVL  179



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA +L R+P A RD++RLRDDA +LR  VS++L  L +AEG+SAES+AT+A++DT
Sbjct  54   ALDRDSADSLRRLPLACRDLLRLRDDAHALRHLVSALLTNLAQAEGTSAESIATIARIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKRRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDA+SLRS ++S+LQ L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDAVSLRSHLASVLQSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ SA AL RVP A RDV+RLRD+A +LRS VSSIL KL+KA  +S+ESV  L+++D 
Sbjct  54   TLEKESADALRRVPLAVRDVLRLRDEAHALRSVVSSILLKLKKAGETSSESVEALSRIDA  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VKRRMEAAYETLQDAAGLTQLS+TVEDVF+SGDLPR AETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKRRMEAAYETLQDAAGLTQLSATVEDVFASGDLPRVAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RK+LEVL
Sbjct  174  RKRLEVL  180



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  SA AL RVP A RD +RLRDDAL+LRS ++S+L  L +AEGSSAES+  LA++DTV
Sbjct  55   LERDSADALRRVPLACRDALRLRDDALALRSHLASVLHSLSQAEGSSAESITALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LRS ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRSHLASVLQSLSLAEGSSAESIAALARIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E S +AL RVPRA+RDVIRLRDDA+SLRS++S IL KL+KAEGSSA ++A+LAKVDT
Sbjct  53   SLDEQSTAALLRVPRASRDVIRLRDDAVSLRSAISGILLKLKKAEGSSAAAIASLAKVDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLA+MRHCLSAVGEVAEFAN+
Sbjct  113  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLASMRHCLSAVGEVAEFANV  172

Query  363  RKQLEVL  383
            RKQL VL
Sbjct  173  RKQLAVL  179



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTV
Sbjct  55   LERDSGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLSLAEGSSAESIAALAQIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+R
Sbjct  115  KQRMEAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  18   SASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRM  197
            S  AL RVP A RD +RLRDDA++LR+ ++S+LQ L  AEGSSAES+A LA++DTVK+RM
Sbjct  59   SGDALRRVPLACRDALRLRDDAVALRAHLASVLQSLNLAEGSSAESIAALAQIDTVKQRM  118

Query  198  EAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLE  377
            EAAY TLQDAAGL QLS +VEDVFSSG+LP+AAETLA MRHCLSAVGEVAEFAN+RKQLE
Sbjct  119  EAAYTTLQDAAGLAQLSQSVEDVFSSGNLPKAAETLATMRHCLSAVGEVAEFANVRKQLE  178

Query  378  VL  383
            VL
Sbjct  179  VL  180



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE SA AL RVPRA+RDV R+RDDALSLRS+VS++LQKL++AEG+SAESVA LA+VD 
Sbjct  53   SLEEQSAQALLRVPRASRDVFRVRDDALSLRSTVSAVLQKLQQAEGTSAESVAALARVDA  112

Query  183  VKRRMEAAYETL-QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
            VK+RMEAA+ETL QDAAGL +LS++VEDVF+SG+LP+AAETLA MR CL+ VGEV EFAN
Sbjct  113  VKQRMEAAHETLQQDAAGLAKLSASVEDVFASGNLPQAAETLAQMRRCLAVVGEVPEFAN  172

Query  360  IRKQLEVL  383
            +++QLE L
Sbjct  173  VKRQLEGL  180



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+  SA AL RVP A RDV+RLRDDALSLRS VSSIL  L KAEG+SAES+A +AK+D 
Sbjct  54   ALDRESADALRRVPLACRDVLRLRDDALSLRSLVSSILLSLNKAEGTSAESIAAIAKIDI  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAYETLQDAAGLTQLS++VEDVF+SGDLPRAAETLANMRHCLSAVGEVAEFAN+
Sbjct  114  VKQRMEAAYETLQDAAGLTQLSASVEDVFASGDLPRAAETLANMRHCLSAVGEVAEFANV  173

Query  363  RKQLEVL  383
            RKQLEVL
Sbjct  174  RKQLEVL  180



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DT
Sbjct  54   ALERDSADALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGE AE   I
Sbjct  114  VKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEGAEIPQI  173

Query  363  RKQ  371
             K+
Sbjct  174  LKK  176



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  SA AL RVP A RD +RLRDDA++LRS V+S+LQ L +AEGSSAES+  LA++DT
Sbjct  54   ALERDSADALRRVPLACRDALRLRDDAVALRSHVASVLQSLSQAEGSSAESITALARIDT  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEV    N 
Sbjct  114  VKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVRNPPNF  173

Query  363  RKQLE  377
             K+L+
Sbjct  174  EKRLK  178



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            L + ++ A+  VP A RDV RLRD+ALSLRSSVSSIL KL++AEGS+AES+A LAK+DTV
Sbjct  55   LSKRTSEAMLSVPHAARDVARLRDEALSLRSSVSSILSKLKQAEGSAAESIAVLAKIDTV  114

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K+RMEAA+ TLQ+AAGLT+LS++VE VF+SGDL +AAETLA MR  L AVGEVAEFAN+R
Sbjct  115  KQRMEAAHTTLQEAAGLTELSASVESVFASGDLRQAAETLAQMRRRLFAVGEVAEFANVR  174

Query  366  KQLEVL  383
            KQLEVL
Sbjct  175  KQLEVL  180



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S +AL R+PRA RDV RL DDALSLRS+VS +L KLR AEG SA SVA L++VD 
Sbjct  52   ALEDQSTAALLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAEGLSAGSVAALSRVDL  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA++
Sbjct  112  VKQRMEAAHKTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASV  171

Query  363  RKQLEVL  383
            +++LE L
Sbjct  172  KRELEAL  178



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S +AL R+PRA RDV RL DDALSLRS+VS +L KLR AE  SA SVA L++VD 
Sbjct  52   ALEDQSTAALLRIPRALRDVSRLHDDALSLRSTVSGMLLKLRTAESLSAGSVAALSRVDL  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK+RMEAA++TL+DAAGL QL ++VE VF+SG+L  AA TLANMR CL+ VGEV EFA++
Sbjct  112  VKQRMEAAHKTLKDAAGLAQLCASVETVFASGNLDEAAGTLANMRRCLAVVGEVPEFASV  171

Query  363  RKQLEVL  383
            +++LE L
Sbjct  172  KRELEAL  178



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  129  KAEGSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLA  308
            +AEGSSAES+  LA++DTVK+RMEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA
Sbjct  61   EAEGSSAESITALARIDTVKQRMEAAYATLQDAAGLAQLSQSVEDVFSSGDLPKAAETLA  120

Query  309  NMRHCLSAVGEVAEFANIRKQLEVL  383
             MRHCLSAVGEVAEFAN+RKQLEVL
Sbjct  121  TMRHCLSAVGEVAEFANVRKQLEVL  145



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/63 (95%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAYETLQDAAGLTQLSSTVEDVF+SGDLPRAA+TLANMRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYETLQDAAGLTQLSSTVEDVFASGDLPRAADTLANMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVL  383
            EVL
Sbjct  61   EVL  63



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVL  383
            EVL
Sbjct  61   EVL  63



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  195  MEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
            MEAAY TLQDAAGL QLS +VEDVFSSGDLP+AAETLA MRHCLSAVGEVAEFAN+RKQL
Sbjct  1    MEAAYTTLQDAAGLAQLSQSVEDVFSSGDLPKAAETLATMRHCLSAVGEVAEFANVRKQL  60

Query  375  EVL  383
            EVL
Sbjct  61   EVL  63



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S + L+R+PRA  ++ R+  D  +L++ V  IL++L  AEGSS ESV  L +VD 
Sbjct  53   ALEEQSNAGLNRIPRAVAEIDRVEHDTKALQTRVQGILKRLNDAEGSSRESVRRLTRVDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAA +TL++AAGL +L ++VEDVF++G++   A+ LA+MR  L  VG V EF + 
Sbjct  113  VKGRMEAARDTLREAAGLAELMASVEDVFAAGNVRSMADVLASMRRALKVVGGVPEFQDA  172

Query  363  RKQLEVL  383
             ++++ L
Sbjct  173  PEKVDAL  179



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 84/135 (62%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLR----------DDALSLRSSVSSILQKLRKA-EGSSAE  152
            L++ S  A+ R+P A ++++R++          DD  +LR S ++ L++L  A  G +A 
Sbjct  53   LQDHSGRAMQRIPAAAKELLRIKVRVRLADRNSDDVATLRGSAAAALKQLEDAGSGQAAA  112

Query  153  SVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSA  332
             V  L  VDTVKRRME A  TL++AAGL+ L   V+D F+SG+L R A+TLA MR  L+ 
Sbjct  113  VVGQLQAVDTVKRRMEDACSTLKEAAGLSALFQQVDDHFASGNLRRVADTLAGMRRGLAV  172

Query  333  VGE-VAEFANIRKQL  374
            VG+ VAEF   R +L
Sbjct  173  VGDSVAEFRGGRDRL  187



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 81/127 (64%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S + L R+PRA  ++ R+  ++ +L++ ++ IL++L +AE  S  SV  L  +D 
Sbjct  53   ALEEQSVAGLQRIPRAVAEIDRVELESKNLQTRIAGILKRLDEAETGSRASVNLLRDIDA  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RME   +TL +AAGL +L  + +DVF+ G++   A+ +A+MR  L  VG V EF + 
Sbjct  113  VKGRMELTRDTLAEAAGLAELMRSADDVFAGGNVRSMADIVASMRRSLKVVGSVPEFEDA  172

Query  363  RKQLEVL  383
             +++E L
Sbjct  173  PERVEAL  179



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 75/119 (63%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  A  RVPRATR++ R+     +LR    ++L +L + E  S  SV  L ++D 
Sbjct  64   ALEERSREATSRVPRATREIERVERRVEALREETRAMLTRLDEVEEVSRASVDALRQLDA  123

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
             KRRME+A ETLQ+  GL  L + V+ +F+SG++   ++ LA M+  L+ VG+V EFA+
Sbjct  124  AKRRMESAKETLQETNGLADLMANVDGIFASGNIRSMSDALARMKRALAVVGDVPEFAD  182



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L + SA A+ R+P A +++ RL+ D   ++  V  + Q +++    +  SVA ++++  
Sbjct  52   TLSDNSAQAMRRIPFAIQEIYRLQGDIQGMQDQVQVMAQTVQRDATEAQSSVAHISELHR  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME+A  +L+ A  L+ L   VEDVF++GDLP+ AE LA+MR  LS VG+V EF   
Sbjct  112  VKANMESACNSLKQATELSGLFVKVEDVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAG  171

Query  363  RKQLEVL  383
            R++L  L
Sbjct  172  RQKLRAL  178



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S   + RVP+A +++  +      L   V  IL +L + E  S  SV  L ++D 
Sbjct  90   SLEERSREGVARVPKAVKEIEVVEGRVKRLHEEVRGILDRLDEVESESRASVEALRQLDA  149

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
             K+RME+A ETLQ+A GL  L ++V+ +F+SG++   +E+LA M+  L+ VG+V EFA+
Sbjct  150  AKQRMESARETLQEANGLADLMASVDGIFASGNIRNMSESLARMKRGLAVVGDVPEFAD  208



>ref|XP_001628559.1| predicted protein [Nematostella vectensis]
 gb|EDO36496.1| predicted protein [Nematostella vectensis]
Length=713

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  A++ +PR  R++  ++ +A  LR  +  + + ++K E ++A+S+  L ++DT
Sbjct  51   ALEETSVQAVNNIPRVVREIDNVQHEASLLREQMHMVKEDIKKVEENTAQSMKMLMELDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  M+AA + LQ+A   T LSS V+ VF SGD+   ++ L  M   L+ + +V ++A  
Sbjct  111  VKSHMQAASQGLQEADNWTTLSSDVDKVFESGDIIAISDKLVGMHKSLNVLQDVPDYAER  170

Query  363  RKQLEVL  383
            R+ LE L
Sbjct  171  RRMLEGL  177



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  ++ES+  L ++DT
Sbjct  53   SLEETSQQALQNLPRVLRDVEAVRQEAGFLKDQMQLVKEDIKKVEEDTSESMKMLLEIDT  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM+AA + LQ+A   T L + V++VF+S D+   A+ L  M+H LS +    ++   
Sbjct  113  IKSRMKAASDALQEADNWTTLMADVDEVFASKDVQLIADKLLAMQHSLSMLAHCGDYDER  172

Query  363  RKQLEVL  383
             + LEVL
Sbjct  173  CQSLEVL  179



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 47/127 (37%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  77   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDR  136

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  137  IKTDLQTAKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  196

Query  363  RKQLEVL  383
            + QLE L
Sbjct  197  KLQLEGL  203



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 47/127 (37%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMIAVKQEIEKVEKDTASSMATLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQTAKQGLHEADNWTVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  13   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDK  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  73   IKTDLQTAKQGLHEADNWSVLANDVEEVFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  132

Query  363  RKQLEVL  383
            + QLE L
Sbjct  133  KLQLEGL  139



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL K+D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQFLQQEALALREKMVAVKQEIEKVEKDTASSMATLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE++F SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQTAKQGLHEADNWSVLANDVEEIFESGDVEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L + SA A+ R+P A +++ RL+ D   ++  V  +   +++    +  SV  ++++  
Sbjct  54   TLSDNSAQAMRRIPFAIQEIYRLQGDIQGMQDQVQVLAGSVQRDATDARGSVEHISQLHL  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME A  +L++A  L+ L   VE+VF++GDLP+ AE LA+MR  LS VG+V EF   
Sbjct  114  VKANMENACNSLKEATELSGLFVKVEEVFAAGDLPKVAEILASMRRSLSLVGDVPEFRAG  173

Query  363  RKQLEVL  383
            R++L  L
Sbjct  174  RQKLRAL  180



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  51   ALEETSQSVLSSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDK  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  111  IKTDLQIAKQGLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD + L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  180  ALEETSQSVLSSLPRILRDTLLLQQETLALREKMVAVKQEIAKIEKDTASSMAMLEKIDR  239

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  240  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  299

Query  363  RKQLEVL  383
            + QLE L
Sbjct  300  KLQLEGL  306



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +AL+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  99   ALEETSQSVLSSLPRVLRDTQLLQQEALALREKMVAVKQEIEKVEKDTASSMATLERIDK  158

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  159  IKTDLQIAKQGLHEADNWSILANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVIDYEDK  218

Query  363  RKQLEVL  383
            + QLE L
Sbjct  219  KLQLEGL  225



>ref|XP_006825808.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like, 
partial [Saccoglossus kowalevskii]
Length=207

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S  AL   PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  60   SLEETSQQALQNFPRVLRDVEAVRQEAAFLQEQMQMVKEDIKKVEQDTAQSMQMLLELDV  119

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM++A   L++A   T L + ++D+F S D+   A+ L  M+H LS +    ++   
Sbjct  120  IKSRMQSASSALKEADNWTTLMADIDDLFQSQDVHAIAKKLLAMQHSLSLLAHCGDYEER  179

Query  363  RKQLEVL  383
             + LE L
Sbjct  180  AQYLETL  186



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE  S   + R+P A  ++  L ++  SL ++V +I + L + E  S +S+  L K+D V
Sbjct  68   LERESQLGVKRIPTAIGEIEVLEENVESLTNTVKNISRSLDETEFPSKQSIERLRKIDEV  127

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RME A +TL +AAGL +L  +V+ VF+  ++   A+ L  M+  L+ VG+V EFA+ R
Sbjct  128  KSRMERARDTLSEAAGLAELMHSVDSVFNGENVSNMADALVRMKRGLAIVGDVPEFADGR  187

Query  366  KQLEVL  383
             ++ VL
Sbjct  188  DRIAVL  193



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ +A++L   + ++ Q++ K E  +A S+ATL ++D 
Sbjct  79   ALEETSQSVLSSLPRVLRDTQLLQQEAIALSEKMVAVKQEIEKVEKDTASSMATLERIDK  138

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++AA + L +A   + L++ VE+VF SGD+   A  L +M+  L+ +  V ++ + 
Sbjct  139  IKTDLQAAKQGLHEADNWSVLANDVEEVFESGDIEAIANKLFSMQKSLAMLVNVVDYEDK  198

Query  363  RKQLEVL  383
            + QLE L
Sbjct  199  KFQLEGL  205



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+ATL ++D 
Sbjct  53   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKIEKDTASSMATLERIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  113  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  172

Query  363  RKQLEVL  383
            + QLE L
Sbjct  173  KLQLEGL  179



>ref|XP_011154014.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Harpegnathos 
saltator]
 gb|EFN88360.1| Conserved oligomeric Golgi complex subunit 7 [Harpegnathos saltator]
Length=735

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_004351649.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22872.1| hypothetical protein ACA1_397180 [Acanthamoeba castellanii str. 
Neff]
Length=699

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 73/124 (59%), Gaps = 0/124 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL E SA +L  +P++ R +  +R +A +L++ ++S  + L K EG++  S+  LA +DT
Sbjct  29   SLREFSAKSLRNIPKSIRSIESVRKEASALQTQITSFAETLEKIEGNADNSLEVLAALDT  88

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ME     L +A  L +LS  V++VF + D  R A+ +  M+  L  + E+ +F + 
Sbjct  89   VKMSMEKCSSILVEAEKLKRLSEDVDNVFRTNDFRRIADHILGMKQSLDILKEIPQFQDN  148

Query  363  RKQL  374
            ++QL
Sbjct  149  QRQL  152



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +PR  RD   L  +AL LR  + S+ Q++ K E  +A+S+ TL ++D 
Sbjct  51   ALEDTSQQVLQSLPRVMRDTEILHQEALLLRDKMHSVKQEIAKVEQDTAQSMKTLERIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++AA E L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  111  IKTELQAAKEALHEADNWTVLATDLEEVFESGDIQSISAKLVSMQQSLRILANVPDYEDR  170

Query  363  RKQLEVL  383
              QLE L
Sbjct  171  HLQLEGL  177



>ref|XP_637633.1| oligomeric Golgi complex component [Dictyostelium discoideum 
AX4]
 sp|Q54LC8.1|COG7_DICDI RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Dictyostelium discoideum]
 gb|EAL64108.1| oligomeric Golgi complex component [Dictyostelium discoideum 
AX4]
Length=996

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLA---K  173
            SLE +++ +L  VP++ R+V R+R ++L L++ + SI  K+ +    S +S+ T++   K
Sbjct  79   SLESITSESLLIVPKSIREVDRIRKESLHLKNRIKSISSKIGEMNNDSPQSMETVSVIEK  138

Query  174  VDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF  353
            +D VK RME +  +L++A  L   S TV+ +FSS D    ++ L  ++  LS + +V EF
Sbjct  139  LDQVKSRMEISIRSLKEAEKLLSFSKTVDQLFSSNDYLMISDKLEEVKQSLSVLSDVPEF  198

Query  354  ANIRKQLEV  380
                K+  V
Sbjct  199  REQSKKFNV  207



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE  S  AL R+P A ++V  +R D   L++ VS  L  +  A  ++  +VA + +++ 
Sbjct  55   ALEIDSTRALQRIPAAVQEVSHVRGDVTGLKADVSRGLGTVSAAASAATGNVALIVELER  114

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RMEAA  TL++A  L+   + VE VF+ GDL R A TLA++R  L+ VG+V EF   
Sbjct  115  VKNRMEAACSTLKEATELSAHFTQVEAVFAEGDLQRIAATLASIRQGLALVGDVPEFKGG  174

Query  363  RKQLEVL  383
              +L+ L
Sbjct  175  AARLQAL  181



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_011264701.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camponotus floridanus]
 gb|EFN62526.1| Conserved oligomeric Golgi complex subunit 7 [Camponotus floridanus]
Length=735

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  51   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  111  IKTELQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + L+LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  63   ALEETSQSVLSSLPRILRDTQLLQQETLALREKMVAVKQEIAKVEKDTASSMAMLEKIDR  122

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ +E+VF SGD+   +  L +M+  L  +  V ++ + 
Sbjct  123  IKTELQTAKQGLHEADNWTVLANDMEEVFESGDIEAISNKLFSMQKSLVMLANVVDYEDK  182

Query  363  RKQLEVL  383
            + QLE L
Sbjct  183  KLQLEGL  189



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S S L  +PR  RD   L+ + ++LR  + ++ Q++ K E  +A S+A L K+D 
Sbjct  21   ALEETSQSVLSSLPRILRDTQLLQQETVALREKMVAVKQEIAKVERDTASSMAMLEKIDR  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  ++ A + L +A   T L++ VE+VF SGD+   +  L +M+  L+ +  V ++ + 
Sbjct  81   IKTELQTAKQGLHEADNWTVLANDVEEVFESGDIEAISNKLFSMQKSLAMLANVVDYEDK  140

Query  363  RKQLEVL  383
            + QLE L
Sbjct  141  KLQLEGL  147



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LEE S  AL  +PR  R++  +R +A  L+  +  + + ++K E S+A+S+  L K+D +
Sbjct  53   LEEASQQALQNLPRVMREIDAVRQEASLLQDQMRMVKEDIQKVEQSTAQSMQVLLKLDGI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+   E L++A   T LS+ VE+VF S D+    + L  M+  L  + +  ++A+  
Sbjct  113  KGRMKTTAEALKEADNWTTLSADVEEVFHSNDIQAITDKLTGMQQSLQMLVDTPDYADRC  172

Query  366  KQLEVL  383
            + LE L
Sbjct  173  QHLEKL  178



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +
Sbjct  73   IEETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAI  132

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  
Sbjct  133  KSRMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRC  192

Query  366  KQLEVL  383
            + LE L
Sbjct  193  QHLETL  198



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  A+  +PR  R++  ++ +A  L+  +  + Q ++K E  +A+S+ TL K+D +
Sbjct  53   IEETSQQAVQNLPRVIRELDAVKQEAALLQDQMKMVKQDIQKVEHDTAKSMQTLLKLDAI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM +A E L++A   T LSS VE+VF S D+      L  M++ L  + +  ++A+  
Sbjct  113  KSRMTSAAEALREADNWTTLSSDVEEVFQSQDIKAITLKLKGMQNSLLMLVDTPDYADRC  172

Query  366  KQLEVL  383
            + LE L
Sbjct  173  QHLETL  178



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  ++ +L  VP+A R++ R+R +++SL+  V  I Q +     +++++VA ++ +DT
Sbjct  82   SLENKASDSLLYVPKAVREIDRVRKESVSLKQKVKHINQTIASMHANTSDTVARISSLDT  141

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            V++R++    +L +A  L   SS ++ +F S D  + A+TL  ++  L+ + ++ EF   
Sbjct  142  VRKRIDQCIISLNEAEKLLSFSSGLDKLFQSADYLKIADTLEGVKQSLAVLSDIPEFREQ  201

Query  363  RKQLE  377
            ++  +
Sbjct  202  QRHFQ  206



>ref|XP_008474492.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Diaphorina citri]
Length=272

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LEE++   +  +PR  RD   L  +A  L+  +S++ Q++   E ++  S+A+L ++D +
Sbjct  52   LEEMNEQVVASLPRIMRDANVLSQEAEMLQQKMSAVKQEIIDVEKNTRASMASLERIDKI  111

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K  + +A ++L +A   T +++ +E++F  GD+   A  + +M+ CL+ +    ++ + R
Sbjct  112  KSELLSAKQSLHEADNWTLMTTDIEEIFERGDIEGIAAKIVSMQQCLAVLTHTPDYEDKR  171

Query  366  KQLEVL  383
             QLE L
Sbjct  172  LQLETL  177



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  65   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  124

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  125  VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  184

Query  363  RKQLEVL  383
            + QLE L
Sbjct  185  KLQLEGL  191



>ref|XP_007903980.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Callorhinchus milii]
Length=687

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D 
Sbjct  53   AIEETSHQALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDE  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQAAADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  51   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  111  VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_007903979.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Callorhinchus milii]
Length=766

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PRA RDV  L+ +A  L+  +  + + +RK E  +A+S+  L ++D 
Sbjct  53   AIEETSHQALQNMPRALRDVEALKQEASFLKDQMILVKEDIRKFEQETAQSMQVLVEIDE  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA + LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQAAADALQEADKWSTLSADIEETFKTQDVATISAKLTSMQSSLAMLADTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S S L  +PR  RD   L+ +AL+L+  ++++ Q++ K E  +A S+  L K+  
Sbjct  13   SLEETSQSVLSSLPRILRDTQLLQQEALALKDKMATVKQEIAKVEKDTALSMTALEKMAR  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK  ++ A ++L +A   + L++ +E+VF SGD+ +    + +M+  LS +    ++ + 
Sbjct  73   VKTELQVAKQSLHEADNWSVLANDLEEVFESGDIEKIGGKVFSMQKSLSMLANAVDYEDK  132

Query  363  RKQLEVL  383
            + QLE L
Sbjct  133  KLQLEGL  139



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  ALH +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALHNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_002128341.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ciona 
intestinalis]
Length=765

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE+S  A+  +PR  RDV  L+ +A  L   +  + +++R  E  ++ S+  L K+D+
Sbjct  51   SLEEISQQAVGNLPRVLRDVETLKKEATFLWQQMQQVKEEIRSVEQRTSHSMEVLVKIDS  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            V+ R+E A   L++A   + L+S +ED+F SGD+   A  L +M+  L  +    ++ + 
Sbjct  111  VRSRVEQASAALKEADNWSSLASAIEDIFRSGDIEAVAAQLQSMQASLVVLRNSPDYDDK  170

Query  363  RKQLEVL  383
               LE L
Sbjct  171  VLHLEAL  177



>ref|XP_008559723.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microplitis 
demolitor]
Length=771

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/127 (30%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++E+ S S L  +PR  R+   L+ +A+SL+  +S +  ++ K E  ++ S+ +LAK+D 
Sbjct  51   NIEDTSQSVLASLPRIFRETQLLQQEAVSLKDKMSVVKDEIAKIEKDTSLSINSLAKIDK  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +E A ++L +A   + L++ VED F +GD+   ++ + +M+  LS +    ++   
Sbjct  111  IKCDLEKAKQSLHEADNWSVLANEVEDSFETGDIEMISKKIFSMQKSLSMLTNTIDYEEK  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RD+  L+ +A  L+  ++ + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSIQALQNMPRVLRDIEALKQEASFLKDQMTMVKEDIKKFEQDTLQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  LA M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDVAVISSKLAAMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
              QLE L
Sbjct  173  CVQLEAL  179



>ref|XP_008299300.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Stegastes 
partitus]
Length=769

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ LS + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLSMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|NP_001264493.1| conserved oligomeric Golgi complex subunit 7 [Gallus gallus]
Length=769

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D V
Sbjct  54   VEEASQQALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRV  113

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E+LQ+A   T LS+ +E+   + D+   A  L +M+  L+ + +  +++   
Sbjct  114  KSRMQLAAESLQEADKWTTLSADIEETLKTQDVSAIAAKLTSMQSSLAMLVDTPDYSEKC  173

Query  366  KQLEVL  383
              LE L
Sbjct  174  VHLEAL  179



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEETSNQALQNMPRVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLAIISSKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   ALEETSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L+ M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIILISNKLSGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_011372750.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
vampyrus]
Length=834

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  LR +A  LR  +  + + +RK E  +++S+  L  +D 
Sbjct  81   AVEETSLQALQNMPRVLRDVEALRQEASFLREQMVLVKEDIRKFEQDTSQSMQVLVDIDQ  140

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A ++LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + + A+++  
Sbjct  141  VKSRMQLAAQSLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLAMLVDTADYSEK  200

Query  363  RKQLEVL  383
               LE L
Sbjct  201  CVYLEAL  207



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEAFFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFALISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_010717801.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Meleagris 
gallopavo]
Length=769

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE S  ALH +PR  R+V  LR +A  LR  +  + + +R+ E  +A+S+  L ++D V
Sbjct  54   VEEASQQALHSMPRVLREVEALRQEAAFLREQMVLVKEDIRRFEEDTAQSMQVLVEIDRV  113

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E+LQ+A   T LS+ +E+   + D+   +  L +M+  L+ + +  +++   
Sbjct  114  KSRMQLAAESLQEADKWTTLSADIEETLKTQDVSAISAKLTSMQSSLAMLVDTPDYSEKC  173

Query  366  KQLEVL  383
              LE L
Sbjct  174  VHLEAL  179



>emb|CAG04322.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEETSNQALQNMPKVLRDVESLKQEASFLKDQMVLVKEDIRKFEQDTVQSMQVLVEIDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLALISSKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +EE    +++ +PR  R++  L+ +A+ L+  +  I   ++K E  +++S+ TL K+DTV
Sbjct  51   IEESCLQSVNNLPRVMRELEALKQEAVLLQDQMKMIKFDIQKVEQDTSQSMLTLLKLDTV  110

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+ A E LQ+A   T L S ++D++ SG++   A  L  ++  L  + +V ++    
Sbjct  111  KTRMKDASEALQEADNWTSLLSGLDDIYESGNVNEIAAKLVGLQQSLLILTDVPDYEERC  170

Query  366  KQLEVL  383
            + LE L
Sbjct  171  QYLETL  176



>emb|CBN81326.1| Conserved oligomeric Golgi complex subunit 7 [Dicentrarchus labrax]
Length=445

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_002711891.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryctolagus 
cuniculus]
Length=847

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  131  AVEETSHQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQ  190

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  191  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLAMLVDTPDYSEK  250

Query  363  RKQLEVL  383
               LE L
Sbjct  251  CVHLEAL  257



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  ++ + + +RK E  +++S+  L ++D 
Sbjct  54   AVEETSHQALQNMPKVLRDVEALKQEASFLKEQMTLVKEDIRKFEQDTSQSMKVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLIGMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_003438511.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oreochromis 
niloticus]
Length=769

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_008202373.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Nasonia vitripennis]
Length=749

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  64   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  123

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  124  IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  183

Query  363  RKQLEVL  383
            + QLE L
Sbjct  184  KLQLEGL  190



>ref|XP_008202376.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Nasonia vitripennis]
Length=698

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  13   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  72

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  73   IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  132

Query  363  RKQLEVL  383
            + QLE L
Sbjct  133  KLQLEGL  139



>ref|XP_004571418.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Maylandia zebra]
Length=769

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_008202375.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Nasonia vitripennis]
Length=706

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  21   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  80

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  81   IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  140

Query  363  RKQLEVL  383
            + QLE L
Sbjct  141  KLQLEGL  147



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_005748533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pundamilia nyererei]
Length=769

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQNSLAMLVDTPDYSDK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_010621761.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fukomys 
damarensis]
 gb|KFO33512.1| Conserved oligomeric Golgi complex subunit 7 [Fukomys damarensis]
Length=770

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE+S  AL  +P+  RDV  L+ +A  L+  +  + + ++K E  +++S+  L ++D 
Sbjct  54   AVEEMSHQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLTMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|NP_001015714.1| component of oligomeric golgi complex 7 [Xenopus (Silurana) tropicalis]
 gb|AAH89645.1| MGC107838 protein [Xenopus (Silurana) tropicalis]
Length=768

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE+S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   SVEEISHQALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEMDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A ++LQ+A   + LS+ +E+ F + ++   +E L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAADSLQEADKWSTLSADIEETFKTQNITVISEKLTSMQVSLTMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVYLEAL  179



>ref|XP_008202374.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Nasonia vitripennis]
Length=737

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLEE S + L  +P+  RD   L+ +AL+L+  + ++ ++L   E  +  S+  L K+D 
Sbjct  52   SLEETSQNVLSNMPKVLRDTQLLQQEALALKEKMQTVKKELENVEKGTTSSIQMLEKLDK  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K       E  +++      ++ +ED+F SGD+ + A+TL  M+  LS +    ++ + 
Sbjct  112  IKTEYINKTEGQRESDNWAAATNEIEDIFESGDVEKIADTLCGMQKSLSVLINTPDYEDK  171

Query  363  RKQLEVL  383
            + QLE L
Sbjct  172  KLQLEGL  178



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHLALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + DL   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDLAVISAKLTGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEASFLKEQMILVKEDIKKFEQDTAQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVISAKLTGMQNSLMMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_010791235.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Notothenia 
coriiceps]
Length=769

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++  
Sbjct  113  VKGRMQLAAEALQEADKWSTLSADIEETFKTQDMAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M   L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLSVISSKLTSMTSSLAMLADTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDLEVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVELDR  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  53   AVEETSHQALQNMPKVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTSQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDIGVISAKLTGMQNSLAMLVDTPQYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  54   AVEETSHQALQNMPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVELDR  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|NP_001070861.1| conserved oligomeric Golgi complex subunit 7 [Danio rerio]
 gb|AAI24681.1| Component of oligomeric golgi complex 7 [Danio rerio]
 gb|AAI24605.1| Component of oligomeric golgi complex 7 [Danio rerio]
Length=767

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   SIEESSNQALQNMPRVLRDIEALKQEASFLKDQMILVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D+   +  L  M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDVAVISSKLTAMQGSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
              QLE L
Sbjct  173  CVQLEAL  179



>ref|XP_005935571.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Haplochromis burtoni]
Length=769

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVMVKEDIKKFEQETVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E LQ+A   + LS+ +E+ F + D    +  L +M+  L+ + +  ++++ 
Sbjct  113  VKSRMQLAAEALQEADKWSTLSADIEETFKTQDFKVISSKLTSMQSSLAMLVDTPDYSDK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>gb|KFM79728.1| Conserved oligomeric Golgi complex subunit 7, partial [Stegodyphus 
mimosarum]
Length=159

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+ +      +PR  R++  ++++A  L+  +SS+   + K E  +++++ TL K+D 
Sbjct  51   SLEKTAEQVNQNIPRIAREIEVMQNEAKLLQHQMSSVKGDVMKVEHDASQAMQTLLKIDH  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCL  326
            VK  M+ A + L++A   T LS+ VE++F SGD+   A  L  M++ L
Sbjct  111  VKSCMQEASKALREADNWTTLSADVEEIFDSGDINAIAMKLVGMQNSL  158



>ref|NP_001085832.1| component of oligomeric golgi complex 7 [Xenopus laevis]
 gb|AAH73403.1| MGC80865 protein [Xenopus laevis]
Length=768

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            S+EE+S  AL  +PR  RDV  +R +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   SVEEISHQALQNMPRVLRDVEAVRQEASFLKEQMILVKEDIKKFEQDTAQSMHVLVEMDK  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+   + ++   +E L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETLKTQNISVISEKLTSMQVSLTMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVYLEAL  179



>ref|XP_006027196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Alligator 
sinensis]
Length=769

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AVEETSHQALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLASESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_006268482.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Alligator mississippiensis]
Length=771

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RD+  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AVEETSHQALQNMPRVLRDMEALKQEATFLKEQMILVKEDIKKFEEDTAQSMQVLVEIDR  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVSVISAKLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+  RDV  L+ +A  L+  +  + + +RK E  +++S+  L ++D 
Sbjct  54   AVEETSLQALQNMPKVLRDVEALKQEASFLKEQMILVKEDIRKFEQDTSQSMQVLVEIDQ  113

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +E+ F + D+   +  L  M++ L  + +  +++  
Sbjct  114  VKSRMQLAAESLQEADKWSTLSADIEETFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEK  173

Query  363  RKQLEVL  383
               LE L
Sbjct  174  CVHLEAL  180



>ref|XP_010731365.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Larimichthys crocea]
Length=769

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++  
Sbjct  113  VKSRMHLAADALQEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>gb|KJE94721.1| hypothetical protein CAOG_009840 [Capsaspora owczarzaki ATCC 
30864]
Length=1209

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+     +  +PR  RD+  +R +A++LR  + ++   L+  E  +  S+  L +VD 
Sbjct  432  SLEDAGQRVIQAMPRTLRDIDTIRVEAIALRERMGTVASDLQAVESGTYASMKVLLEVDA  491

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVG  338
            V+ RMEAA  +L+ A     L++ V+ + +SGD+    + L  MR CLS++G
Sbjct  492  VRDRMEAATVSLRQAGTWATLAAEVDTMLTSGDVAAVRQHLHEMRLCLSSMG  543



>ref|XP_004347003.2| hypothetical protein CAOG_05318 [Capsaspora owczarzaki ATCC 30864]
Length=1021

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE+     +  +PR  RD+  +R +A++LR  + ++   L+  E  +  S+  L +VD 
Sbjct  97   SLEDAGQRVIQAMPRTLRDIDTIRVEAIALRERMGTVASDLQAVESGTYASMKVLLEVDA  156

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVG  338
            V+ RMEAA  +L+ A     L++ V+ + +SGD+    + L  MR CLS++G
Sbjct  157  VRDRMEAATVSLRQAGTWATLAAEVDTMLTSGDVAAVRQHLHEMRLCLSSMG  208



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 35/127 (28%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAES-VATLAKVD  179
            SLE  S+ +L  VP+A R++ ++R ++L L++ + SI Q +     +S  + V T+A +D
Sbjct  78   SLENRSSESLLYVPKAVREIDKVRKESLQLKTRIKSITQSIDSMYSNSLHTAVDTIASLD  137

Query  180  TVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFAN  359
            TV+ R+++   +L +A  L   S+ ++ +F++ +    A+ L  ++  L  + ++ EF  
Sbjct  138  TVRTRIDSCIRSLNEAEKLLHFSAQLDQLFAAAEYLAIAQRLDEIKTSLQLLSDIPEFRE  197

Query  360  IRKQLEV  380
              KQ  +
Sbjct  198  QSKQFAI  204



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  52   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQ  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + DL   +  L  M++ L+ + +  +++  
Sbjct  112  VKSRMHLAADALQEADKWSTLSADIEETFKTQDLAVISSKLTAMQNSLAMLVDTPDYSEK  171

Query  363  RKQLEVL  383
               LE L
Sbjct  172  CVHLEAL  178



>gb|KFO84349.1| Conserved oligomeric Golgi complex subunit 7, partial [Buceros 
rhinoceros silvestris]
Length=697

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 70/124 (56%), Gaps = 0/124 (0%)
 Frame = +3

Query  12   ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  191
            E S  AL  +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK 
Sbjct  5    ETSHQALQNMPRVLREVEVLKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKS  64

Query  192  RMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQ  371
            RM+ A E+LQ+A   + LS+ +E+   + D+P  +  L +M+  L+ + +  +++     
Sbjct  65   RMQLAAESLQEADKWSTLSADIEETLKTQDVPVISAKLTSMQSSLAMLVDTPDYSEKCVH  124

Query  372  LEVL  383
            LE L
Sbjct  125  LEAL  128



>emb|CDQ66102.1| unnamed protein product [Oncorhynchus mykiss]
Length=768

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + +RK E  + +S+  L ++D 
Sbjct  52   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVELDQ  111

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM  A + LQ+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++  
Sbjct  112  VKSRMHLASDALQEADKWSTLSADIEETFKTQDMAVISSKLTAMQNSLAMLVDTPDYSEK  171

Query  363  RKQLEVL  383
               LE L
Sbjct  172  CVHLEAL  178



>ref|XP_003285944.1| hypothetical protein DICPUDRAFT_15317 [Dictyostelium purpureum]
 gb|EGC37553.1| hypothetical protein DICPUDRAFT_15317 [Dictyostelium purpureum]
Length=919

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/115 (30%), Positives = 63/115 (55%), Gaps = 3/115 (3%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSS---VSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAY  209
            VP+A R++ R+R + +++++    +SS + +L      S + V+ + K D +K RME++ 
Sbjct  109  VPKAIREIDRIRKEIINIKNKMKLISSKIDELNAQSPQSTQVVSLIQKYDQIKSRMESSM  168

Query  210  ETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQL  374
             +LQ+A  L   SS V+ +FS+ D    +  L   +  LS + +V EF    K+ 
Sbjct  169  RSLQEAEKLLSFSSQVDQLFSTNDFLVISNKLEEAKQSLSVLSDVPEFREQSKKF  223



>ref|XP_004586873.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ochotona 
princeps]
Length=771

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +P+   D+  L+ +A  L+  +  + + ++K E  +++S+  L ++D 
Sbjct  55   AVEETSHQALQNMPKVLCDIEALKQEASFLKEQMILVKEDIQKFEQDTSQSMQVLVEIDQ  114

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+ A E+LQ+A   + LS+ +ED F + D+   +  L  M++ L  + +  +++  
Sbjct  115  VKSRMQLAAESLQEADKWSTLSADIEDTFKTQDVAVISAKLTGMQNSLVMLVDTPDYSEK  174

Query  363  RKQLEVL  383
               LE L
Sbjct  175  CVHLEAL  181



>ref|XP_008312851.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cynoglossus 
semilaevis]
Length=769

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  ++ +A  L+  +  + + ++K E  +  S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVDAVKQEASFLKEQMVLVKEDIQKFEQDTVRSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM+ A + LQ+A   + LS+ +E+ F + D    +  L +M++ L+ + +  +++  
Sbjct  113  IKSRMQVAADALQEADKWSTLSADIEETFKTQDFAVISSKLTSMQNSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LEE S  AL  +PR  R++  ++ ++  L+  +  + Q ++K E  +++S+ +L K+D +
Sbjct  53   LEEASQQALQNLPRVVRELDAIKQESSLLQDQMRIVKQDIQKVEQDTSQSMQSLLKLDRI  112

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RM+   + L++A   T LS+ +++VF S ++      L+ M+  L  + +  ++ +  
Sbjct  113  KSRMKTTADALKEADNWTTLSADMDEVFQSQNVDDITAKLSGMQQSLHMLADTPDYVDKC  172

Query  366  KQLEVL  383
            + LE L
Sbjct  173  QHLEKL  178



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ +      +P+  RDV  ++ +A  L+  ++++ + + K E  S+ S+ TL ++DT
Sbjct  51   ALEDTAQQVQQNLPKVLRDVETMQQEAALLKLQMAAVQKDIAKVEQDSSTSMKTLLELDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K RM  A + L++A   T LS+ V+ VF SGD+      L  ++  L  + +V +F + 
Sbjct  111  IKLRMLEANQALREADNWTTLSADVDQVFQSGDVQAITARLVGLQTSLEILVDVPDFEHR  170

Query  363  RKQLEVL  383
             ++LE L
Sbjct  171  LQRLESL  177



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A E+L
Sbjct  1    MPRVLRDVEALKQEATFLKEQMILVKEDIKKFEEDTAQSMKVLVELDQVKSRMQLAAESL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  383
            Q+A   + LS+ +E+ F + D+   +  L  M++ L+ + +  +++     LE L
Sbjct  61   QEADKWSTLSADIEETFKTQDVSVISAKLTGMQNSLAMLVDTPDYSEKCVHLEAL  115



>ref|XP_974190.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tribolium 
castaneum]
Length=726

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/127 (26%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT
Sbjct  51   ALEDTSQQILMSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDT  110

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +  A + L ++   T L + +E+VF S ++   +  +  M+  L  +  V+++ + 
Sbjct  111  IKNELNMAKQGLHESDNWTILVNDLEEVFDSKNIENISAKIIGMQRSLQLLVNVSDYEDR  170

Query  363  RKQLEVL  383
            + QLE L
Sbjct  171  KLQLEGL  177



>ref|XP_006912615.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
alecto]
Length=755

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +3

Query  12   ELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKR  191
            E S  AL  +PR  RDV  LR +A  LR  +  I + +RK E  +++S+  L  +D VK 
Sbjct  51   ETSLQALQNMPRVLRDVEALRQEASFLREQMVLIKEDIRKFEQDTSQSMQVLVDIDQVKS  110

Query  192  RMEAAYETLQDAAGLTQLSSTVEDVFSS  275
            RM+ A ++LQ+A   + LS+ +E+ F +
Sbjct  111  RMQLAAQSLQEADKWSTLSADIEETFKT  138



>ref|XP_010144199.1| PREDICTED: conserved oligomeric Golgi complex subunit 7, partial 
[Buceros rhinoceros silvestris]
Length=703

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  R+V  L+ +A  L+  +  + + ++K E  +A+S+  L ++D VK RM+ A E+L
Sbjct  1    MPRVLREVEVLKQEATFLKEQMVLVKEDIKKFEEDTAQSMQVLVEIDRVKSRMQLAAESL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  383
            Q+A   + LS+ +E+   + D+P  +  L +M+  L+ + +  +++     LE L
Sbjct  61   QEADKWSTLSADIEETLKTQDVPVISAKLTSMQSSLAMLVDTPDYSEKCVHLEAL  115



>ref|XP_010731364.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Larimichthys crocea]
Length=705

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 64/115 (56%), Gaps = 0/115 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  L+ +A  L+  +  + + ++K E  + +S+  L ++D VK RM  A + L
Sbjct  1    MPRVLRDVEALKQEASFLKEQMVLVKEDIKKFEQDTVQSMQVLVEIDQVKSRMHLAADAL  60

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIRKQLEVL  383
            Q+A   + LS+ +E+ F + DL   +  L +M++ L+ + +  +++     LE L
Sbjct  61   QEADKWSTLSADIEETFKTQDLAVISSKLTSMQNSLAMLVDTPDYSEKCVHLEAL  115



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/127 (26%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SLE  S   L  +P+   D   L+ +AL L+  +  + +++ + E  + +S+ T+ K+D 
Sbjct  17   SLENSSQQVLASLPKIMHDAKILQQEALVLKEKMGQVKEEIVQIEQDTRKSINTIEKLDE  76

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K ++  A + L ++   T L + +E++F S ++   +  +  M+  L  +  VA+F + 
Sbjct  77   MKNQLTIAKQGLHESDNWTVLVNDLEEIFDSKNIEAISSKILGMQSSLKLLVNVADFEDR  136

Query  363  RKQLEVL  383
            + QLE L
Sbjct  137  KLQLEGL  143



>ref|XP_009024750.1| hypothetical protein HELRODRAFT_178406 [Helobdella robusta]
 gb|ESN97278.1| hypothetical protein HELRODRAFT_178406 [Helobdella robusta]
Length=573

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 14/133 (11%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            +E+    A++ +PR T+++  +R +A  L+  +      ++K E  +A S+  L  +D V
Sbjct  51   IEDGCQQAINNLPRVTKELEAVRQEASLLQEQMKMAKYDIQKVEHDTANSMQNLMMLDQV  110

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLP--------------RAAETLANMRHC  323
            K RM+ A + L++A   T LSS V++VF S DL               +  E L N    
Sbjct  111  KSRMKLASDALKEADNWTTLSSDVDEVFDSQDLEAHILTNVPDYTDRCQYLEMLKNRLEA  170

Query  324  LSAVGEVAEFANI  362
            +S+   VA FA +
Sbjct  171  MSSTAVVAAFATL  183



>gb|EXX54575.1| hypothetical protein RirG_233350 [Rhizophagus irregularis DAOM 
197198w]
Length=994

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE         +PR   D+  +++DA  L+S VS +  +L   E  + +++  L  +D V
Sbjct  107  LERTVEDVTKSMPRIITDLQVMQEDATKLKSGVSLVKSQLNNVEEGTEKALDRLKYLDLV  166

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RMEA+ + L++A   + L     ++F+S D  +A+  L      L       E+   R
Sbjct  167  KTRMEASRDVLKEAENWSNLEQEASNIFASQDYQKASARLMEAEKSLVIFQNTPEYEERR  226

Query  366  KQLEVL  383
            K L  L
Sbjct  227  KLLTEL  232



>gb|ESA17025.1| hypothetical protein GLOINDRAFT_345271 [Rhizophagus irregularis 
DAOM 181602]
Length=925

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 35/126 (28%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
            LE         +PR   D+  +++DA  L+S VS +  +L   E  + +++  L  +D V
Sbjct  107  LERTVEDVTKSMPRIITDLQVMQEDATKLKSGVSLVKSQLNNVEEGTEKALDRLKYLDLV  166

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K RMEA+ + L++A   + L     ++F+S D  +A+  L      L       E+   R
Sbjct  167  KTRMEASRDVLKEAENWSNLEQEASNIFASQDYQKASARLMEAEKSLVIFQNTPEYEERR  226

Query  366  KQLEVL  383
            K L  L
Sbjct  227  KLLTEL  232



>gb|ELK12106.1| Conserved oligomeric Golgi complex subunit 7 [Pteropus alecto]
Length=660

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTVKRRMEAAYETL  218
            +PR  RDV  LR +A  LR  +  I + +RK E  +++S+  L  +D VK RM+ A ++L
Sbjct  1    MPRVLRDVEALRQEASFLREQMVLIKEDIRKFEQDTSQSMQVLVDIDQVKSRMQLAAQSL  60

Query  219  QDAAGLTQLSSTVEDVFSS  275
            Q+A   + LS+ +E+ F +
Sbjct  61   QEADKWSTLSADIEETFKT  79



>ref|XP_001357618.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002020468.1| GL13495 [Drosophila persimilis]
 gb|EAL26752.1| GA15960 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW39280.1| GL13495 [Drosophila persimilis]
Length=742

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 61/110 (55%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L  D   L+  +S++ Q++   +  + E +ATL +++T
Sbjct  56   AVEESSRQVVSSMPRIAKESTTLHSDVSQLQEKMSAMRQEVAAVQNETGECMATLERLNT  115

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSA  332
            ++ +++AA E+LQ++ G   L + +ED F   DL    E L  ++  L A
Sbjct  116  LQTKLQAAKESLQESDGWGNLLAELEDGFERNDLKGVCEKLIALQKSLHA  165



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S  AL  +PR  RDV  L+ +A  L+  +  + + ++K E  +A+S+  L ++D 
Sbjct  53   AIEESSNQALQNMPRVLRDVEALKQEASFLKEQMILVEEDIKKFEQDTAQSMQVLVEIDQ  112

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            VK RM+AA E LQ+A   + LS+ +E+ F + D+   +  L +M+  L+ + +  +++  
Sbjct  113  VKARMQAAAEALQEADKWSTLSAEIEETFKTQDIALISTRLTSMQSSLAMLVDTPDYSEK  172

Query  363  RKQLEVL  383
               LE L
Sbjct  173  CVHLEAL  179



>ref|XP_002058398.1| GJ14333 [Drosophila virilis]
 gb|EDW58366.1| GJ14333 [Drosophila virilis]
Length=751

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 70/125 (56%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D  +L+  +S++ Q++   +  + + +ATL +++T
Sbjct  57   AVEESSQQVVASMPRIAKEATTLQCDVAALQQKMSAMRQEVAAVQEETGDCMATLERLNT  116

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   D+    + L  ++  L A  ++   A  
Sbjct  117  LQTKLQAAKESLQESDGWGNLLAELEDCFERNDMKGVCDKLTALQKSLQAQEQLPGHAER  176

Query  363  RKQLE  377
            + Q+E
Sbjct  177  QTQVE  181



>gb|EEZ99445.1| hypothetical protein TcasGA2_TC030721, partial [Tribolium castaneum]
Length=695

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 67/127 (53%), Gaps = 3/127 (2%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LE+ S   L  +P+  RD   L  +A  L+  ++++  ++ K E  + +S+ T+ K+DT
Sbjct  41   ALEDTSQQILMSLPKIIRDTKNLNQEAAILKEKMAAVRSEIVKIEQDTGKSINTIEKLDT  100

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            +K  +  A + L ++   T L    ++VF S ++   +  +  M+  L  +  V+++ + 
Sbjct  101  IKNELNMAKQGLHESDNWTILG---KEVFDSKNIENISAKIIGMQRSLQLLVNVSDYEDR  157

Query  363  RKQLEVL  383
            + QLE L
Sbjct  158  KLQLEGL  164



>ref|XP_002073360.1| GK14089 [Drosophila willistoni]
 gb|EDW84346.1| GK14089 [Drosophila willistoni]
Length=736

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 68/125 (54%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  + ++ Q++   +  + E +ATL +++T
Sbjct  58   AVEESSQQVVSSMPRIAKEAATLQRDVQELQEKMLAMRQEVAAVQDETGECMATLERLNT  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   DL    E L  ++  L A  ++A  A  
Sbjct  118  LQSKLQAAKESLQESDGWGNLLAELEDGFERNDLKGICEKLTALQKSLQAQEQLAGHAER  177

Query  363  RKQLE  377
              Q+E
Sbjct  178  LTQVE  182



>gb|KGB34884.1| Conserved oligomeric Golgi complex subunit 7 [Schistosoma haematobium]
Length=413

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +L+     A+  +PR  R++  +R DAL+L + + + LQ   + + +S   V +L ++D 
Sbjct  78   TLDHTCQEAIVSIPRVLREIDAVRIDALTLEADLKT-LQDDNQLDDNSQNIVNSLVELDR  136

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
             +R  ++A + L++      L   ++++F  GDL +   ++  M  CL++   + ++   
Sbjct  137  TRRNAQSAADALRETDRWINLMQCIDELFEVGDLDQLCSSIEGMSQCLASFIHLNDYDER  196

Query  363  RKQLE  377
             KQ++
Sbjct  197  VKQVD  201



>gb|EHJ78638.1| putative component of oligomeric golgi complex 7 [Danaus plexippus]
Length=668

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 69/134 (51%), Gaps = 8/134 (6%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            SL+E +   +  +PR  ++   L+ +A  L+  + S+ Q ++  E  +  S+ +L K+D 
Sbjct  56   SLDETATQIVSSIPRTLQEASSLQLEAALLQEQLKSLEQNVQGVEEQTGHSIKSLQKIDQ  115

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLAN-------MRHCLSAVGE  341
            +K R+E A  +L++A     L+ ++ED   SG +P   E LA        M   L A+ +
Sbjct  116  LKTRLENAASSLREADKWVALAQSLEDTLDSG-VPTNKEKLATLAEQVHAMTTSLEALSD  174

Query  342  VAEFANIRKQLEVL  383
             AE+ + R QL  L
Sbjct  175  SAEYESKRLQLTTL  188



>ref|XP_002911600.1| hypothetical protein CC1G_14133 [Coprinopsis cinerea okayama7#130]
 gb|EFI28106.1| hypothetical protein CC1G_14133 [Coprinopsis cinerea okayama7#130]
Length=930

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 61/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKA-EGSSAESVATLAKVDTVKRRMEAAYET  215
            +PR   DV  ++D ALSL+SS+  +L+K +      ++ ++  L ++DT+K RME+A E 
Sbjct  124  IPRLAYDVHFMKDGALSLQSSLVEVLKKSKDVVPPDTSAALDNLHQLDTIKNRMESAREV  183

Query  216  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF-------ANIRKQL  374
            LQ+A   + L   V  +       +AAE L+     +       E+        N++ QL
Sbjct  184  LQEAESWSTLEMEVTTLIGERSYAKAAERLSEASKSMVVFQNTPEYDPRRALMVNLQNQL  243

Query  375  E  377
            E
Sbjct  244  E  244



>ref|XP_001993908.1| GH22206 [Drosophila grimshawi]
 gb|EDV94644.1| GH22206 [Drosophila grimshawi]
Length=766

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 69/125 (55%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR +++   L+ D   L+  +S++ Q++   +  +   +ATL +++T
Sbjct  65   AVEESSQQVVASMPRISKEAATLQSDVAMLQQKMSAMRQEVAAVQEETGGCMATLERLNT  124

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++AA E+LQ++ G   L + +ED F   DL    + L  ++  L A  ++   A  
Sbjct  125  LQSKLQAAKESLQESDGWGNLLAELEDCFERNDLKGVCDKLTALQKSLQAQEQLPGHAER  184

Query  363  RKQLE  377
            + Q+E
Sbjct  185  QTQVE  189



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +LEE S   +  +PR  R++  +  +   L+  ++S+   + K E  ++ES+  L ++D+
Sbjct  58   TLEEESQQMVQNLPRVLREIEGVYKETTLLKDQMNSVKNDIEKVEIETSESMKMLVELDS  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDL  284
            +K RM+AA   +Q+A   + L S V+ +   GD+
Sbjct  118  IKSRMQAASNVIQEADNWSVLVSDVDGICKRGDI  151



>ref|XP_005188405.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musca 
domestica]
Length=751

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 61/110 (55%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +P+  +DV  L  D  SL+  +  + Q++   +  + E +ATL K+++
Sbjct  63   AVEESSQQLVANLPKIVKDVKSLHADVRSLQGRMLEMRQEVAAVQEETGECMATLEKLNS  122

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSA  332
             + +++ A E+LQ++ G   L S +ED F   DL    + ++ ++  L+A
Sbjct  123  KQIKLQTAKESLQESDGWGNLLSQLEDSFEKNDLKSVCDKISALQKSLAA  172



>ref|XP_011207193.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Bactrocera 
dorsalis]
Length=754

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/125 (22%), Positives = 67/125 (54%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE     +  +PR  ++ + L+ +   L+  + ++ +++   +  + + +ATL +++T
Sbjct  67   AVEETGQKLVSGMPRVIKESLLLQAEVEELKKRMQAMRKEMTDVQEETGDCMATLERLNT  126

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANI  362
            ++ +++ A E+LQ++ G   L S +ED F   ++  A E L +++  L    ++   A  
Sbjct  127  IQSKLQKAKESLQESDGWGNLISELEDCFEHNNMKGAFEKLLSLQKSLQVQEQLPGHAER  186

Query  363  RKQLE  377
              Q+E
Sbjct  187  LTQVE  191



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +3

Query  312  MRHCLSAVGEVAEFANIRKQLEVL  383
            MR+CLSAVGEVAEFAN+RKQLEVL
Sbjct  1    MRNCLSAVGEVAEFANVRKQLEVL  24



>gb|KIK67210.1| hypothetical protein GYMLUDRAFT_857700 [Gymnopus luxurians FD-317 
M1]
Length=883

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 64/121 (53%), Gaps = 8/121 (7%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKA-EGSSAESVATLAKVDTVKRRMEAAYET  215
            +PR + D+  ++D A+SL+ S++++  + R A  G++A ++  L ++DT+KR MEAA E 
Sbjct  86   IPRLSYDLHFIKDSAMSLQGSLATVHARSRAAVPGTTASALEQLRRLDTMKRHMEAAREV  145

Query  216  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF-------ANIRKQL  374
            L++A   + L   V  + +     +AA  L+     +       E+        N++ QL
Sbjct  146  LREAESWSTLELEVTSLLTERKYAKAASRLSEANKSMVVFQNTPEYDPRRTLLVNLQNQL  205

Query  375  E  377
            E
Sbjct  206  E  206



>ref|XP_007323090.1| hypothetical protein SERLADRAFT_418038 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN94848.1| hypothetical protein SERLA73DRAFT_162884 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO20345.1| hypothetical protein SERLADRAFT_418038 [Serpula lacrymans var. 
lacrymans S7.9]
Length=958

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = +3

Query  42   PRATRDVIRLRDDALSLRSSVSSILQKLRKA-EGSSAESVATLAKVDTVKRRMEAAYETL  218
            PR T D+  +RD+ALSL+  ++ +  K + +   ++A ++  L  +DT+K RMEAA E L
Sbjct  146  PRLTYDLHFMRDNALSLQGDLTKVQSKSKNSIPEATASALDRLQHLDTIKTRMEAAREVL  205

Query  219  QDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF  353
            ++A   + L S V  + +  +  +AAE L      +      +E+
Sbjct  206  REAESWSTLESEVTSLLTETNYEKAAERLNEANRSMVVFQNTSEY  250



>ref|XP_002001440.1| GI21972 [Drosophila mojavensis]
 gb|EDW16901.1| GI21972 [Drosophila mojavensis]
Length=754

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            ++EE S   +  +PR  ++   L+ D   L+  +S++ Q++   +  + + +ATL ++++
Sbjct  58   AVEESSQQVVASMPRIAKEAATLQCDVALLQQKMSAMRQEVAAVQEETGDCMATLERLNS  117

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSA  332
            ++ +++AA E+LQ++ G   L S +ED F   D+    + L  ++  L A
Sbjct  118  LQSKLQAAKESLQESDGWGNLLSELEDCFERNDMKGVCDKLRALQKSLQA  167



>ref|XP_003030457.1| hypothetical protein SCHCODRAFT_57227 [Schizophyllum commune 
H4-8]
 gb|EFI95554.1| hypothetical protein SCHCODRAFT_57227 [Schizophyllum commune 
H4-8]
Length=864

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 61/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKA-EGSSAESVATLAKVDTVKRRMEAAYET  215
            VPR T D+  +RD A+SL+SS+  + Q+ +     ++  ++  L  +DT+KR ME A E 
Sbjct  75   VPRLTYDLHFMRDGAVSLQSSLLQVRQRSKNVVAPATGAALDQLKSLDTIKRNMEEAREV  134

Query  216  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF-------ANIRKQL  374
            L++A   + L   V  + +  +  +AAE L+     +       E+        N++ QL
Sbjct  135  LREAESWSTLELEVTSLLAEQNYAKAAERLSEANKSMVVFQNTPEYDPRRALMVNLQNQL  194

Query  375  E  377
            E
Sbjct  195  E  195



>ref|XP_002431030.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB18292.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=731

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 26/124 (21%), Positives = 62/124 (50%), Gaps = 0/124 (0%)
 Frame = +3

Query  6    LEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDTV  185
             E  +   +H +P+  +D  +L +DA  L+  ++++  ++ K + ++  ++++L K+D V
Sbjct  52   FESTARDVIHHLPKINKDAGKLSEDAGDLQDKMNAVRDEIDKIKKNTDMTISSLEKIDRV  111

Query  186  KRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEFANIR  365
            K  +    E L +A   T LS+ ++      D+      +  M+  LS +    ++ + +
Sbjct  112  KMELMKYKEALHEADKWTMLSNDIKAALDVRDIDTVTCKVLTMQQSLSILTNAHDYEDKK  171

Query  366  KQLE  377
             +LE
Sbjct  172  LELE  175



>gb|KIK39828.1| hypothetical protein CY34DRAFT_14142 [Suillus luteus UH-Slu-Lm8-n1]
Length=848

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 12/132 (9%)
 Frame = +3

Query  3    SLEELSASALHRVPRATRDVIRLRDDALSLRSSVSSILQKLRKAEGSSAESVATLAKVDT  182
            +++E+S SA    PR T D+  +RD A+SL +++S++  ++    G+S  ++  L  +DT
Sbjct  64   TIDEVSRSA----PRLTYDLHFMRDGAISLHTALSTVTARIPAGSGTST-ALDRLQTLDT  118

Query  183  VKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF---  353
             KRRMEA  + L++A   + L + V  + +     +AAE L+     +       E+   
Sbjct  119  AKRRMEAVRDVLREAESWSSLEAEVTALLAERAYDKAAERLSEASRSMPVFAGTPEYEPR  178

Query  354  ----ANIRKQLE  377
                 +++ QLE
Sbjct  179  RALMVSLQNQLE  190



>gb|KDR75221.1| hypothetical protein GALMADRAFT_122928 [Galerina marginata CBS 
339.88]
Length=884

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 61/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  39   VPRATRDVIRLRDDALSLRSSVSSILQKLRKA-EGSSAESVATLAKVDTVKRRMEAAYET  215
            +PR   D+  ++D A +L++++ ++LQ+ R A    ++ ++  L  +DT+K RMEA+ E 
Sbjct  77   IPRLAYDLHFMKDGASTLQNALVAVLQRSRDAVPKETSAALDNLHHLDTIKGRMEASREV  136

Query  216  LQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMRHCLSAVGEVAEF-------ANIRKQL  374
            LQ+A   + L   V  +       +AAE L+     +       E+        N++ QL
Sbjct  137  LQEAESWSTLEHEVTSLILEKSYAKAAERLSEANKSMVVFQNTPEYDPRRTLMVNLQNQL  196

Query  375  E  377
            E
Sbjct  197  E  197



>ref|XP_011399022.1| Conserved oligomeric Golgi complex subunit 7 [Auxenochlorella 
protothecoides]
 gb|KFM26126.1| Conserved oligomeric Golgi complex subunit 7 [Auxenochlorella 
protothecoides]
Length=476

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  138  GSSAESVATLAKVDTVKRRMEAAYETLQDAAGLTQLSSTVEDVFSSGDLPRAAETLANMR  317
            G  A++V TL +++ VK RM+ A +TL++A+GL  L   ++ +F+  DLP  A  LA M+
Sbjct  124  GPGAQAVDTLRQLERVKGRMQTAADTLEEASGLASLFHRMDSLFADEDLPAIAAALAGMQ  183

Query  318  HCL  326
              L
Sbjct  184  RGL  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567734137750