BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030H23

Length=495
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          160   4e-45   Citrus sinensis [apfelsine]
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             159   5e-45   Citrus clementina [clementine]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               155   3e-43   Elaeis guineensis
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         153   1e-42   Jatropha curcas
ref|NP_001056102.1|  Os05g0526400                                       150   1e-41   
gb|EAY98759.1|  hypothetical protein OsI_20691                          150   2e-41   Oryza sativa Indica Group [Indian rice]
emb|CDP12094.1|  unnamed protein product                                150   2e-41   Coffea canephora [robusta coffee]
gb|ABC69764.1|  unknown                                                 149   2e-41   Vitis pseudoreticulata
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               150   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               150   2e-41   Vitis vinifera
ref|XP_002511930.1|  conserved hypothetical protein                     150   3e-41   Ricinus communis
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               148   2e-40   Elaeis guineensis
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          147   2e-40   Oryza brachyantha
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   147   3e-40   Citrus sinensis [apfelsine]
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               147   4e-40   Vitis vinifera
gb|KJB24635.1|  hypothetical protein B456_004G154600                    144   4e-40   Gossypium raimondii
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             147   5e-40   Citrus clementina [clementine]
ref|NP_001130478.1|  Seed maturation protein                            146   6e-40   Zea mays [maize]
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   147   7e-40   Citrus sinensis [apfelsine]
gb|KJB24636.1|  hypothetical protein B456_004G154600                    142   8e-40   Gossypium raimondii
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               146   9e-40   Nicotiana sylvestris
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               146   9e-40   Solanum lycopersicum
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             147   1e-39   
ref|XP_002509881.1|  conserved hypothetical protein                     145   1e-39   Ricinus communis
ref|XP_006374287.1|  hypothetical protein POPTR_0015s05710g             144   2e-39   
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               145   2e-39   Phoenix dactylifera
ref|XP_006374288.1|  hypothetical protein POPTR_0015s05710g             143   2e-39   
gb|EAY75742.1|  hypothetical protein OsI_03655                          145   3e-39   Oryza sativa Indica Group [Indian rice]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    144   3e-39   Gossypium raimondii
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          145   3e-39   Solanum tuberosum [potatoes]
gb|KJB06452.1|  hypothetical protein B456_001G157900                    142   3e-39   Gossypium raimondii
ref|XP_009626481.1|  PREDICTED: reticulon-like protein B5 isoform X2    142   4e-39   
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               144   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               144   4e-39   Nicotiana sylvestris
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 144   4e-39   Elaeis guineensis
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               144   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               144   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             144   6e-39   
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    144   6e-39   Nicotiana tomentosiformis
gb|KHG04885.1|  Reticulon-like protein B5                               144   8e-39   Gossypium arboreum [tree cotton]
ref|XP_007051689.1|  Reticulon family protein                           144   8e-39   
gb|KJB37517.1|  hypothetical protein B456_006G208500                    142   1e-38   Gossypium raimondii
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               143   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             143   1e-38   
gb|KJB06451.1|  hypothetical protein B456_001G157900                    143   1e-38   Gossypium raimondii
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               144   1e-38   Elaeis guineensis
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               142   2e-38   Solanum lycopersicum
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    142   2e-38   Nicotiana sylvestris
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               142   2e-38   Phoenix dactylifera
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    142   3e-38   Nicotiana sylvestris
gb|KJB06453.1|  hypothetical protein B456_001G157900                    143   3e-38   Gossypium raimondii
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               142   3e-38   Sesamum indicum [beniseed]
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               142   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG15548.1|  Reticulon-like protein B3                               141   5e-38   Gossypium arboreum [tree cotton]
dbj|BAJ89699.1|  predicted protein                                      141   5e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001149653.1|  LOC100283279                                       141   5e-38   Zea mays [maize]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          141   7e-38   Solanum tuberosum [potatoes]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        141   7e-38   Theobroma cacao [chocolate]
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                140   9e-38   Erythranthe guttata [common monkey flower]
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          140   9e-38   Oryza brachyantha
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               140   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW80460.1|  hypothetical protein ZEAMMB73_353444                    137   1e-37   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         140   1e-37   Jatropha curcas
gb|EMS62606.1|  Reticulon-like protein B1                               140   1e-37   Triticum urartu
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             140   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010462752.1|  PREDICTED: reticulon-like protein B5 isoform X2    137   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          140   1e-37   Solanum tuberosum [potatoes]
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               140   1e-37   Brassica rapa
emb|CDY42012.1|  BnaC04g00900D                                          140   2e-37   Brassica napus [oilseed rape]
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               140   2e-37   Elaeis guineensis
ref|NP_001239711.1|  uncharacterized protein LOC100811024               140   2e-37   Glycine max [soybeans]
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               140   2e-37   Nicotiana tomentosiformis
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               140   2e-37   Sesamum indicum [beniseed]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               140   2e-37   
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          139   3e-37   Oryza brachyantha
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               139   3e-37   Brachypodium distachyon [annual false brome]
ref|NP_001044177.1|  Os01g0736900                                       139   3e-37   
gb|ACF87936.1|  unknown                                                 138   3e-37   Zea mays [maize]
tpg|DAA52789.1|  TPA: seed maturation protein                           140   3e-37   
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               139   4e-37   Camelina sativa [gold-of-pleasure]
gb|KHG29253.1|  Reticulon-like protein B5                               139   4e-37   Gossypium arboreum [tree cotton]
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               139   4e-37   Populus euphratica
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               139   4e-37   Nicotiana sylvestris
ref|NP_001150474.1|  seed maturation protein                            139   5e-37   
gb|KHG24129.1|  Reticulon-like protein B3                               139   5e-37   Gossypium arboreum [tree cotton]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               139   5e-37   
ref|XP_010439153.1|  PREDICTED: reticulon-like protein B1 isoform X2    137   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               139   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          139   6e-37   Setaria italica
ref|XP_002880222.1|  reticulon family protein                           138   7e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               138   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               138   7e-37   Phoenix dactylifera
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               138   7e-37   Camelina sativa [gold-of-pleasure]
gb|EAY73097.1|  hypothetical protein OsI_00974                          139   9e-37   Oryza sativa Indica Group [Indian rice]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    138   9e-37   Solanum tuberosum [potatoes]
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               138   9e-37   Brassica rapa
gb|AFK39432.1|  unknown                                                 135   9e-37   Lotus japonicus
dbj|BAB32723.1|  unknown protein                                        139   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             138   1e-36   Capsella rubella
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    138   1e-36   Glycine max [soybeans]
ref|XP_002320163.1|  reticulon family protein                           138   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               138   1e-36   Nicotiana tomentosiformis
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                138   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               138   1e-36   Camelina sativa [gold-of-pleasure]
gb|ABK94480.1|  unknown                                                 137   2e-36   Populus trichocarpa [western balsam poplar]
emb|CDY52012.1|  BnaC06g42920D                                          137   2e-36   Brassica napus [oilseed rape]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    137   2e-36   
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    138   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010462746.1|  PREDICTED: reticulon-like protein B5 isoform X1    134   2e-36   
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               138   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               138   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_010112604.1|  Reticulon-like protein                             137   3e-36   Morus notabilis
dbj|BAJ98297.1|  predicted protein                                      137   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          137   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001118533.1|  reticulon-like protein B5                          135   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    140   3e-36   
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               137   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               137   3e-36   Solanum lycopersicum
ref|NP_198975.1|  reticulon-like protein B4                             137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007218267.1|  hypothetical protein PRUPE_ppa008259mg             137   4e-36   
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               137   4e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               136   4e-36   Prunus mume [ume]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               136   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               136   4e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          136   5e-36   Cicer arietinum [garbanzo]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               136   5e-36   Tarenaya hassleriana [spider flower]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    137   5e-36   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               136   5e-36   Brassica rapa
emb|CDY57657.1|  BnaC01g15350D                                          137   5e-36   Brassica napus [oilseed rape]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               135   9e-36   Pyrus x bretschneideri [bai li]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               135   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             137   1e-35   
ref|NP_176592.1|  reticulon-like protein B3                             135   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             135   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             135   1e-35   
ref|NP_566065.1|  reticulon-like protein B5                             135   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             135   1e-35   Capsella rubella
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               135   1e-35   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY44123.1|  BnaA01g13310D                                          135   1e-35   Brassica napus [oilseed rape]
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             135   1e-35   Phaseolus vulgaris [French bean]
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     134   2e-35   Eucalyptus grandis [rose gum]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        135   2e-35   
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               135   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             134   2e-35   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     134   2e-35   Eucalyptus grandis [rose gum]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         134   2e-35   Jatropha curcas
gb|ACU23452.1|  unknown                                                 134   2e-35   Glycine max [soybeans]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               134   2e-35   Eucalyptus grandis [rose gum]
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     134   2e-35   Eucalyptus grandis [rose gum]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                134   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             134   3e-35   Eutrema salsugineum [saltwater cress]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               135   3e-35   Brassica rapa
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    134   3e-35   Arabis alpina [alpine rockcress]
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          135   3e-35   Glycine max [soybeans]
emb|CDY10954.1|  BnaA03g46130D                                          134   3e-35   Brassica napus [oilseed rape]
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               134   3e-35   Prunus mume [ume]
ref|XP_002299504.1|  reticulon family protein                           134   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             134   4e-35   Eutrema salsugineum [saltwater cress]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             134   4e-35   Prunus persica
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               134   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               134   4e-35   Cucumis melo [Oriental melon]
ref|XP_002874678.1|  VIRB2-interacting protein 2                        134   4e-35   Arabidopsis lyrata subsp. lyrata
emb|CDY25557.1|  BnaC09g11820D                                          134   5e-35   Brassica napus [oilseed rape]
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     132   5e-35   Eucalyptus grandis [rose gum]
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          134   5e-35   Cucumis sativus [cucumbers]
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     134   5e-35   Eucalyptus grandis [rose gum]
ref|NP_194094.1|  VIRB2-interacting protein 1                           134   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15986.1|  Reticulon-like protein B5                               133   6e-35   Glycine soja [wild soybean]
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               133   6e-35   Populus euphratica
ref|NP_001241367.1|  uncharacterized protein LOC100796111               133   6e-35   Glycine max [soybeans]
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             134   7e-35   Capsella rubella
emb|CDY34396.1|  BnaA09g11380D                                          133   7e-35   Brassica napus [oilseed rape]
emb|CDY05135.1|  BnaC03g29330D                                          134   7e-35   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             133   7e-35   
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             133   8e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010105716.1|  Reticulon-like protein                             133   9e-35   
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               133   9e-35   Brachypodium distachyon [annual false brome]
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               133   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               132   1e-34   Eucalyptus grandis [rose gum]
gb|KJB24286.1|  hypothetical protein B456_004G137000                    130   1e-34   Gossypium raimondii
emb|CDY08353.1|  BnaC09g12430D                                          132   1e-34   Brassica napus [oilseed rape]
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               132   1e-34   Brassica rapa
dbj|BAJ33905.1|  unnamed protein product                                133   2e-34   Eutrema halophilum
ref|XP_011073415.1|  PREDICTED: reticulon-like protein B1 isoform X2    130   2e-34   
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    132   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               132   2e-34   Populus euphratica
gb|EPS71452.1|  hypothetical protein M569_03311                         132   2e-34   Genlisea aurea
ref|XP_002869770.1|  VIRB2-interacting protein 1                        132   2e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               132   3e-34   Brassica rapa
ref|NP_191715.2|  reticulon-like protein B6                             131   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               131   3e-34   Solanum lycopersicum
gb|KJB52681.1|  hypothetical protein B456_008G272900                    128   3e-34   Gossypium raimondii
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               132   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    131   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               131   3e-34   Pyrus x bretschneideri [bai li]
gb|AFK42129.1|  unknown                                                 130   3e-34   Medicago truncatula
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    131   3e-34   Arabis alpina [alpine rockcress]
ref|NP_192861.1|  reticulon-like protein B2                             132   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               132   4e-34   Camelina sativa [gold-of-pleasure]
emb|CDY24806.1|  BnaA08g15040D                                          131   5e-34   Brassica napus [oilseed rape]
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    131   5e-34   Sesamum indicum [beniseed]
ref|XP_002887921.1|  reticulon family protein                           130   7e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               130   7e-34   Pyrus x bretschneideri [bai li]
gb|KJB24287.1|  hypothetical protein B456_004G137000                    129   7e-34   Gossypium raimondii
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               130   8e-34   Malus domestica [apple tree]
gb|EMS62854.1|  Reticulon-like protein B1                               130   1e-33   Triticum urartu
gb|ACJ84486.1|  unknown                                                 130   1e-33   Medicago truncatula
gb|KJB19086.1|  hypothetical protein B456_003G084400                    129   1e-33   Gossypium raimondii
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               130   1e-33   
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               130   1e-33   Malus domestica [apple tree]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          130   1e-33   Setaria italica
ref|NP_001030913.1|  reticulon-like protein B6                          130   1e-33   
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               130   1e-33   Fragaria vesca subsp. vesca
gb|EMT19773.1|  Reticulon-like protein B1                               130   1e-33   
gb|KJB24285.1|  hypothetical protein B456_004G137000                    130   2e-33   Gossypium raimondii
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               129   2e-33   Populus euphratica
gb|KJB19089.1|  hypothetical protein B456_003G084400                    128   2e-33   Gossypium raimondii
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          129   2e-33   Solanum tuberosum [potatoes]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               129   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_004980276.1|  PREDICTED: uncharacterized protein LOC101782657    131   2e-33   Setaria italica
gb|KJB19088.1|  hypothetical protein B456_003G084400                    129   2e-33   Gossypium raimondii
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               129   3e-33   Malus domestica [apple tree]
gb|AFK41983.1|  unknown                                                 129   3e-33   Medicago truncatula
gb|KJB19087.1|  hypothetical protein B456_003G084400                    129   3e-33   Gossypium raimondii
gb|KJB52680.1|  hypothetical protein B456_008G272900                    125   3e-33   Gossypium raimondii
emb|CDJ26559.1|  unnamed protein product                                129   3e-33   Triticum aestivum [Canadian hard winter wheat]
gb|KJB52682.1|  hypothetical protein B456_008G272900                    127   3e-33   Gossypium raimondii
gb|KJB19091.1|  hypothetical protein B456_003G084400                    128   3e-33   Gossypium raimondii
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               128   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    128   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG20258.1|  Reticulon-like protein B3                               128   7e-33   Gossypium arboreum [tree cotton]
gb|KJB52679.1|  hypothetical protein B456_008G272900                    128   7e-33   Gossypium raimondii
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                128   7e-33   Erythranthe guttata [common monkey flower]
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               128   7e-33   Nicotiana sylvestris
emb|CDY41666.1|  BnaC03g62180D                                          128   9e-33   Brassica napus [oilseed rape]
gb|KHF99856.1|  Reticulon-like protein B1                               125   1e-32   Gossypium arboreum [tree cotton]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               127   1e-32   
gb|AFK48295.1|  unknown                                                 125   1e-32   Lotus japonicus
emb|CAN77759.1|  hypothetical protein VITISV_034907                     127   2e-32   Vitis vinifera
gb|KDO86332.1|  hypothetical protein CISIN_1g025719mg                   126   2e-32   Citrus sinensis [apfelsine]
emb|CDP08746.1|  unnamed protein product                                127   2e-32   Coffea canephora [robusta coffee]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             127   2e-32   Citrus clementina [clementine]
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   127   2e-32   Citrus sinensis [apfelsine]
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               127   2e-32   Vitis vinifera
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             127   2e-32   Prunus persica
gb|AFK34557.1|  unknown                                                 127   2e-32   Medicago truncatula
emb|CDY38194.1|  BnaA09g11950D                                          126   3e-32   Brassica napus [oilseed rape]
gb|EMT06999.1|  Reticulon-like protein B1                               126   4e-32   
emb|CDM81762.1|  unnamed protein product                                126   4e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010092876.1|  Reticulon-like protein                             125   6e-32   Morus notabilis
gb|KHN40449.1|  Reticulon-like protein B5                               125   6e-32   Glycine soja [wild soybean]
ref|NP_001185307.1|  reticulon-like protein B3                          125   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          125   1e-31   Cucumis sativus [cucumbers]
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          125   1e-31   Setaria italica
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               125   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               124   1e-31   Fragaria vesca subsp. vesca
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               125   1e-31   Pyrus x bretschneideri [bai li]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               125   1e-31   Glycine max [soybeans]
gb|EMS49910.1|  Reticulon-like protein B3                               126   1e-31   Triticum urartu
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             124   2e-31   Capsella rubella
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               124   2e-31   Malus domestica [apple tree]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               124   2e-31   Malus domestica [apple tree]
ref|XP_002303615.1|  reticulon family protein                           124   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               124   3e-31   Sesamum indicum [beniseed]
ref|XP_002876621.1|  reticulon family protein                           124   3e-31   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          124   3e-31   Sorghum bicolor [broomcorn]
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               123   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               123   4e-31   Populus euphratica
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               122   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               122   7e-31   Camelina sativa [gold-of-pleasure]
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    122   8e-31   Arabis alpina [alpine rockcress]
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             121   9e-31   Phaseolus vulgaris [French bean]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               122   9e-31   Brassica rapa
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               122   1e-30   Eucalyptus grandis [rose gum]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               122   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             122   1e-30   Phaseolus vulgaris [French bean]
ref|NP_001239653.1|  uncharacterized protein LOC100793862               122   1e-30   Glycine max [soybeans]
dbj|BAH57206.1|  AT1G64090                                              121   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               122   2e-30   Brassica rapa
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               122   2e-30   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               121   2e-30   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             120   3e-30   
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               120   4e-30   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               120   6e-30   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               120   7e-30   
gb|EPS69502.1|  hypothetical protein M569_05265                         119   7e-30   
gb|AFK42059.1|  unknown                                                 120   9e-30   
gb|KJB52211.1|  hypothetical protein B456_008G250900                    118   1e-29   
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             119   1e-29   
gb|ACN40158.1|  unknown                                                 119   1e-29   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          119   1e-29   
gb|ABR17571.1|  unknown                                                 119   2e-29   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          119   2e-29   
gb|KJB52210.1|  hypothetical protein B456_008G250900                    119   2e-29   
gb|KHN21799.1|  Reticulon-like protein B1                               118   2e-29   
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               119   3e-29   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               118   3e-29   
ref|XP_003592173.1|  Reticulon family protein                           118   3e-29   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    117   3e-29   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          119   4e-29   
gb|KHG09260.1|  Reticulon-like protein B3                               118   4e-29   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    118   4e-29   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          118   4e-29   
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             118   4e-29   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               118   4e-29   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    117   5e-29   
emb|CDP05124.1|  unnamed protein product                                116   2e-28   
gb|EPS73616.1|  hypothetical protein M569_01145                         116   2e-28   
gb|AFW78798.1|  hypothetical protein ZEAMMB73_677867                    112   2e-28   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               115   3e-28   
gb|KHN12926.1|  Reticulon-like protein B1                               115   3e-28   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          115   4e-28   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               115   4e-28   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               114   5e-28   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               115   5e-28   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          115   5e-28   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                     114   5e-28   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               115   5e-28   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               115   5e-28   
gb|KHN29299.1|  Reticulon-like protein B5                               114   8e-28   
gb|ACG32549.1|  seed maturation protein                                 114   9e-28   
emb|CDX90792.1|  BnaA03g24720D                                          115   9e-28   
ref|XP_002521590.1|  conserved hypothetical protein                     114   9e-28   
ref|NP_001130268.1|  uncharacterized protein LOC100191362               114   9e-28   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               114   1e-27   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    114   1e-27   
gb|EPS67049.1|  hypothetical protein M569_07727                         113   1e-27   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               114   2e-27   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    114   2e-27   
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               112   2e-27   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     114   2e-27   
ref|XP_002302126.2|  reticulon family protein                           113   2e-27   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                113   2e-27   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               113   3e-27   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               113   3e-27   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    113   4e-27   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    113   4e-27   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   112   4e-27   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             112   5e-27   
emb|CDP18758.1|  unnamed protein product                                112   5e-27   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    112   5e-27   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like          112   5e-27   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               112   8e-27   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          112   9e-27   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2    110   1e-26   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          112   1e-26   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               111   1e-26   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1    110   1e-26   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    111   1e-26   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          111   1e-26   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             111   1e-26   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               111   2e-26   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          111   2e-26   
ref|XP_007048924.1|  Reticulon family protein                           111   2e-26   
ref|XP_002306759.1|  reticulon family protein                           110   2e-26   
ref|NP_001057713.1|  Os06g0503400                                       111   2e-26   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    111   3e-26   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               110   3e-26   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               111   3e-26   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          110   3e-26   
gb|EAY97489.1|  hypothetical protein OsI_19418                          110   3e-26   
emb|CDY41331.1|  BnaA01g31880D                                          110   3e-26   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               110   3e-26   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          110   3e-26   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               110   3e-26   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    110   4e-26   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               110   4e-26   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               110   4e-26   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               110   4e-26   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               109   4e-26   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             110   4e-26   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      110   4e-26   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    110   4e-26   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    110   5e-26   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      110   6e-26   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      110   6e-26   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               109   6e-26   
emb|CDY56712.1|  BnaC01g38700D                                          111   6e-26   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               109   6e-26   
ref|NP_001055164.1|  Os05g0312500                                       109   7e-26   
ref|NP_566371.1|  reticulon-like protein B8                             109   8e-26   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               109   8e-26   
gb|EEC80692.1|  hypothetical protein OsI_23118                          114   8e-26   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    110   9e-26   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    110   1e-25   
ref|NP_850552.1|  reticulon-like protein B8                             109   1e-25   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    108   1e-25   
gb|EEE63204.1|  hypothetical protein OsJ_18014                          110   1e-25   
gb|ACG36034.1|  reticulon                                               108   1e-25   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             108   1e-25   
gb|EPS64109.1|  hypothetical protein M569_10676                         108   1e-25   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          108   1e-25   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    108   1e-25   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    108   2e-25   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               108   2e-25   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               108   2e-25   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               108   2e-25   
gb|AFW82132.1|  hypothetical protein ZEAMMB73_565764                    107   3e-25   
dbj|BAK05980.1|  predicted protein                                      107   3e-25   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          108   3e-25   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          107   3e-25   
gb|EMT10142.1|  Reticulon-like protein B1                               108   4e-25   
gb|KHG28741.1|  Reticulon-like protein B8                               107   4e-25   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               107   4e-25   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               107   5e-25   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    107   5e-25   
ref|NP_001150935.1|  seed maturation protein                            107   6e-25   
gb|KHN28537.1|  Reticulon-like protein B8                               107   6e-25   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    107   6e-25   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         107   6e-25   
dbj|BAK06264.1|  predicted protein                                      107   6e-25   
gb|EAY85291.1|  hypothetical protein OsI_06662                          106   8e-25   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               106   8e-25   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    106   1e-24   
emb|CDY00916.1|  BnaC05g42840D                                          106   1e-24   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...    106   1e-24   
dbj|BAJ94514.1|  predicted protein                                      106   1e-24   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               106   1e-24   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    106   1e-24   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    105   2e-24   
gb|ABK22748.1|  unknown                                                 105   2e-24   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               105   2e-24   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    105   2e-24   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    105   2e-24   
ref|NP_001046501.1|  Os02g0265900                                       105   2e-24   
gb|ABK26525.1|  unknown                                                 105   3e-24   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               105   3e-24   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          104   4e-24   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               104   4e-24   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          104   4e-24   
gb|EMS52545.1|  Reticulon-like protein B1                               105   4e-24   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               104   5e-24   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8               104   6e-24   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    104   6e-24   
gb|KJB71178.1|  hypothetical protein B456_011G126300                    103   6e-24   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               104   6e-24   
gb|KJB71177.1|  hypothetical protein B456_011G126300                    102   6e-24   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 104   6e-24   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               104   7e-24   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               104   7e-24   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          104   8e-24   
ref|NP_001149072.1|  LOC100282693                                       103   8e-24   
gb|KJB71176.1|  hypothetical protein B456_011G126300                    102   8e-24   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               103   8e-24   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2    102   9e-24   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             103   9e-24   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          103   1e-23   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             103   1e-23   
gb|EMT18983.1|  Reticulon-like protein B1                               103   1e-23   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    103   1e-23   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    103   1e-23   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    103   1e-23   
ref|XP_011461529.1|  PREDICTED: reticulon-like protein B4               103   1e-23   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               103   1e-23   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               103   1e-23   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               103   2e-23   
gb|EAY98925.1|  hypothetical protein OsI_20880                          102   2e-23   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    102   2e-23   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    102   2e-23   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          102   3e-23   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    102   4e-23   
ref|NP_001051461.1|  Os03g0781700                                       102   4e-23   
gb|EMT22798.1|  Reticulon-like protein B8                             98.2    4e-23   
gb|KEH33647.1|  reticulon-like protein B2                               102   5e-23   
gb|ABB51093.1|  reticulon                                               100   5e-23   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    102   5e-23   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    101   6e-23   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    101   6e-23   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    101   6e-23   
gb|EAY92056.1|  hypothetical protein OsI_13754                          102   6e-23   
gb|KHG24796.1|  Reticulon-like protein B5                               100   8e-23   
ref|XP_006491908.1|  PREDICTED: reticulon-like protein B5-like is...    101   1e-22   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               100   2e-22   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               100   2e-22   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          100   2e-22   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             100   2e-22   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    100   3e-22   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    100   3e-22   
ref|XP_006643730.1|  PREDICTED: reticulon-like protein B9-like        99.4    3e-22   
gb|EMT22797.1|  Reticulon-like protein B9                             99.4    3e-22   
gb|ACG31942.1|  seed maturation protein                               99.8    4e-22   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like        99.4    4e-22   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220        99.4    4e-22   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8             99.4    5e-22   
ref|XP_008809164.1|  PREDICTED: reticulon-like protein B4             99.0    5e-22   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9             98.6    6e-22   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4             98.2    7e-22   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg           98.2    1e-21   
gb|ACG26944.1|  seed maturation protein                               98.2    1e-21   
ref|NP_001137021.1|  seed maturation protein isoform 1                98.2    1e-21   
tpg|DAA51729.1|  TPA: seed maturation protein                         98.2    1e-21   
emb|CDM80956.1|  unnamed protein product                              97.8    1e-21   
ref|XP_008363374.1|  PREDICTED: reticulon-like protein B4             98.2    1e-21   
gb|ACU15028.1|  unknown                                               95.5    1e-21   
ref|XP_007152723.1|  hypothetical protein PHAVU_004G154000g           97.8    1e-21   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9             97.4    1e-21   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2             97.4    2e-21   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1             96.3    2e-21   
gb|EMT25698.1|  Reticulon-like protein B2                             97.4    3e-21   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g           97.4    3e-21   



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   160 bits (404),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MA+E + EE   ES++EKI +KIH HDSSSSS S   +++KK +TSS+   V RLFGR++
Sbjct  1    MADEHKHEEPAGESVMEKITEKIHGHDSSSSSSSSDTDDDKKSSTSSLKTKVFRLFGREK  60

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLF  120

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  121  LWSNASTFINKSP  133



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 3/133 (2%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MA+E + EE   ES+ EKI +KIH HDSSSSS S   +++KK + SS+   V RLFGR++
Sbjct  1    MADEHKHEEPAGESVKEKITEKIHGHDSSSSSSSSDSDDDKKSSASSLKTKVFRLFGREK  60

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLF
Sbjct  61   PVHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLF  120

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  121  LWSNASTFINKSP  133



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            +EE   +  SL+EKI DK+H HD SSS    ++ E    +   + A + RLFGR++PVHK
Sbjct  5    SEESSSKPVSLMEKIVDKLHGHDDSSSDSDNEKSEPSASS---IKANIYRLFGRERPVHK  61

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  62   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSN  121

Query  468  ASSFIKKSA  494
            AS FI K+ 
Sbjct  122  ASIFINKAP  130



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 3/133 (2%)
 Frame = +3

Query  105  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAXVRRLFGRQQ  275
            MAE  ++E   ES++EKI++KIH HDSSSSSDS+  E+ +   + SSM + + R+FGR++
Sbjct  1    MAEHHKEESVIESVMEKISEKIHGHDSSSSSDSDNDEKSKSSSSPSSMKSKIYRIFGREK  60

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLF  120

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  121  LWSNASTFINKSP  133



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE   KEEESLVE + DKI          S    +   + T+ + A + RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  465  NASSFIKKSA  494
            NAS+FI KS 
Sbjct  119  NASTFINKSP  128



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE   KEEESLVE + DKI          S    +   + T+ + A + RLFGR++PVH
Sbjct  1    MAE--HKEEESLVESVMDKISDKLHGRGGSSSSSSDSDGERTADLKAKIYRLFGREKPVH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  59   SVLGGGKPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWS  118

Query  465  NASSFIKKSA  494
            NAS+FI KS 
Sbjct  119  NASTFINKSP  128



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 98/128 (77%), Gaps = 6/128 (5%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            EED K E SL+EK  DK+H      + DS     + +  TSS+ A V RLFGR++PVHK+
Sbjct  7    EEDAKAE-SLIEKTRDKVH-----GADDSSSSSSDDEGKTSSLKAKVFRLFGREKPVHKL  60

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNA
Sbjct  61   LGGGKPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNA  120

Query  471  SSFIKKSA  494
            S+FI KS 
Sbjct  121  STFINKSP  128



>gb|ABC69764.1| unknown [Vitis pseudoreticulata]
Length=211

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            AE      ESL+EKI DK+  HDSSSS      ++    +   + A V RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSDSDSDSDKAASPSP--IKAKVFRLFGREKPVHT  62

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSN  122

Query  468  ASSFIKKSA  494
            A++FI KS 
Sbjct  123  ATTFINKSP  131



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekee----eekkkttssMDAXVRRLFGRQ  272
            MAE +    ESL+EKI +K H  DSSSS    ++              + A + RLFGR+
Sbjct  1    MAEHEESVAESLLEKITEKFHGGDSSSSDSDGEKSSVVDSSAPSAAEVVKAKIYRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++
Sbjct  61   KPVHKVLGGGKPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIM  120

Query  453  FLWSNASSFIKKSA  494
            FLWSNAS+FI KS 
Sbjct  121  FLWSNASTFINKSP  134



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            AE      ESL+EKI DK+  HDSSSS      ++    +   + A V RLFGR++PVH 
Sbjct  5    AEGSGAASESLLEKITDKLQGHDSSSSGSDSDSDKPASPSP--IKAKVFRLFGREKPVHT  62

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSN
Sbjct  63   VLGGGKHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSN  122

Query  468  ASSFIKKSA  494
            A++FI KS 
Sbjct  123  ATTFINKSP  131



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE      ES++EKI++KIH HDSSSSSDSE + E+K  + SS+ A + RLFGR++PVH
Sbjct  1    MAEHPESPIESVMEKISEKIHAHDSSSSSDSESDSEKKPTSPSSVKAKIFRLFGRERPVH  60

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWS
Sbjct  61   HVLGGGKPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWS  120

Query  465  NASSFIKKSA  494
            NA +FI K+ 
Sbjct  121  NAHTFINKTP  130



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            +EE   + ESL+EKIA+K+H     SSS S+ + E+ + + SS+ A + RLFGR++PVHK
Sbjct  5    SEEASSKPESLMEKIAEKLH--GDDSSSSSDSDNEKSESSASSVKAKIYRLFGREEPVHK  62

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSN
Sbjct  63   VLGGGKPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSN  122

Query  468  ASSFIKK  488
            AS+FI K
Sbjct  123  ASTFINK  129



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE   KEEES+++ I+DK+H         S    +   + T+++ A + RLFGR++PVH
Sbjct  1    MAE--HKEEESVMDTISDKLHG----RGGSSSSSLDSDGERTAAVKAKIYRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWS  114

Query  465  NASSFIKKSA  494
            NAS+FI KS 
Sbjct  115  NASTFINKSP  124



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  121  ASTFINKSP  129



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ES++EKI++KIH HDSSSS    ++            A V R+FGR++PVHKVLGGGK A
Sbjct  13   ESMMEKISEKIHGHDSSSSDSDNEKSSPSA-----FKAKVYRIFGREKPVHKVLGGGKPA  67

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA++FI K+
Sbjct  68   DVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFINKA  127

Query  492  A  494
             
Sbjct  128  P  128



>gb|KJB24635.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=179

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI KS 
Sbjct  120  LWSNAHTFIHKSP  132



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  121  ASTFINKSP  129



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 98/129 (76%), Gaps = 3/129 (2%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            D KEE+S+++KI++K H      SS S D +K+       T +M A + RLFGR++PVH 
Sbjct  3    DHKEEQSVMDKISEKFHGGDSSSSSDSDDEKKKGSSSASATEAMKAKIYRLFGRERPVHS  62

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSN
Sbjct  63   VLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSN  122

Query  468  ASSFIKKSA  494
            ASSFI KS 
Sbjct  123  ASSFINKSP  131



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   147 bits (371),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESSDKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  121  ASTFINKSP  129



>gb|KJB24636.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=130

 Score =   142 bits (359),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  456  LWSNASSFIKK  488
            LWSNA +FI K
Sbjct  120  LWSNAHTFIHK  130



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 101/140 (72%), Gaps = 7/140 (5%)
 Frame = +3

Query  96   ESAMAEEDRKEEESLVEKIADKIH-------RHdsssssdsekeeeekkkttssMDAXVR  254
            E    E+  + EES++EKI + +H          SSS SD +K+       TSS  + VR
Sbjct  5    EERKVEKSDEHEESVMEKITETLHLSNNNHHSSSSSSDSDDDKKTTSSPPVTSSFKSKVR  64

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CHGLI
Sbjct  65   RLFGRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLI  124

Query  435  LALAVLFLWSNASSFIKKSA  494
            +ALA LFLWSNAS+FI KSA
Sbjct  125  VALAGLFLWSNASAFIHKSA  144



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   146 bits (369),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 10/137 (7%)
 Frame = +3

Query  114  EDRKEEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAXVRRLF  263
            E  + +ESL++KI++K+H             SS S D +K+       TSS  + VRRLF
Sbjct  10   EKEEHDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPATSSFGSKVRRLF  69

Query  264  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  443
            GR++PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++AL
Sbjct  70   GRERPVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIAL  129

Query  444  AVLFLWSNASSFIKKSA  494
            A LFLWSNAS+FI KSA
Sbjct  130  AGLFLWSNASTFIHKSA  146



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 95/129 (74%), Gaps = 4/129 (3%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E    ++SLVEKI DKIH HDSSSS   + +            + V RLFGR++P+H 
Sbjct  5    APEHESADKSLVEKITDKIHGHDSSSSDSDDDKPSSIDA----FKSKVFRLFGREKPIHH  60

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLG GK AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSN
Sbjct  61   VLGAGKPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSN  120

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  121  ASTFINKSP  129



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 108/136 (79%), Gaps = 6/136 (4%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsek---eeeekkkttssMDAXVRRLFG  266
            MA+E   EE   ESL++KI++KIH HDSSSSSDS+     + +   + SS+ + + RLFG
Sbjct  1    MADEHHHEESKGESLMDKISEKIHGHDSSSSSDSDNDEKLKPKSPSSPSSIKSKIYRLFG  60

Query  267  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  446
            R++PVH VLGGGK AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA
Sbjct  61   REKPVHHVLGGGKPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALA  120

Query  447  VLFLWSNASSFIKKSA  494
            +LFLWSNAS+FI KS 
Sbjct  121  ILFLWSNASTFINKSP  136



>ref|XP_006374287.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52084.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=193

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  96   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  453  FLWSNASSFIKKSA  494
            FLWSNAS+F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 100/119 (84%), Gaps = 2/119 (2%)
 Frame = +3

Query  138  LVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQADV  317
            L+EKIADK+H HDSSSSSDS+ E+ E   ++  + A + RLFGR++PVHKVLGGGK ADV
Sbjct  15   LMEKIADKLHGHDSSSSSDSDNEKSEPSASS--VKAKIYRLFGREKPVHKVLGGGKPADV  72

Query  318  FLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSA  494
             LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNAS+FI K+ 
Sbjct  73   LLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFISKTP  131



>ref|XP_006374288.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52085.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=199

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  96   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  453  FLWSNASSFIKKSA  494
            FLWSNAS+F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAXVRRLFGRQQPVHKV  290
            + KEE+S++EK+++K+H   SSSSSDS+ +++    +   ++M A + RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSSAAAMKAKIYRLFGRERPVHSV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  471  SSFIKKSA  494
            S+FI KS 
Sbjct  123  STFIHKSP  130



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MAEESESKQSAVESMMEKISQKIHGHDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLF  119

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI KS 
Sbjct  120  LWSNAHTFIHKSP  132



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 10/133 (8%)
 Frame = +3

Query  126  EEESLVEKIADKIH----------RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            ++ESL++KI++K+H             SS S D +K+       TSS  + VRRLFGR++
Sbjct  14   QDESLMDKISEKLHFSNHSSSPAPASSSSDSDDEKKKPTSPAPETSSFGSKVRRLFGRER  73

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKV GGGK ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LF
Sbjct  74   PVHKVFGGGKPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLF  133

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KSA
Sbjct  134  LWSNASTFIHKSA  146



>gb|KJB06452.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=186

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAXVRRLFGRQ  272
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  453  FLWSNASSFIKKSA  494
            FLWSN  +FI K+ 
Sbjct  121  FLWSNVHTFIHKTP  134



>ref|XP_009626481.1| PREDICTED: reticulon-like protein B5 isoform X2 [Nicotiana tomentosiformis]
Length=192

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E     ES+++KI DK+H     SSS   ++E+EK     ++ A + RLFGR++PVHK
Sbjct  5    AGEHESVVESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHK  61

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSN
Sbjct  62   VLGGGKPADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSN  121

Query  468  ASSFIKK  488
            AS+FI K
Sbjct  122  ASTFINK  128



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 101/133 (76%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE + EE   ES++EKIA+KI R     SS S   ++EKK + SS+ A + RLFGR+ 
Sbjct  1    MAEEHKHEESAAESIIEKIAEKI-RGYDDGSSSSSDSDDEKKASLSSLKAKIYRLFGREN  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLF
Sbjct  60   PVHNVLGGGKPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLF  119

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI K+ 
Sbjct  120  LWSNASTFIHKTP  132



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ES+++KI DK+H     SSS   ++E+EK     ++ A + RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGREKPVHKVLGGGKPA  69

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+FI KS
Sbjct  70   DVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  492  A  494
             
Sbjct  130  P  130



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  105  MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+     ++      + RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSLPSSSSVQSK--IYRLFGREKPV  58

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  462  SNASSFIKKSA  494
            SNA++FI KS 
Sbjct  119  SNATTFINKSP  129



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE + EE   ES++EKIA+KI  HD  SSS S+ ++E+K   +S + A + RLFGR++
Sbjct  1    MAEEHKHEESTAESIMEKIAEKIRGHDDGSSSSSDSDDEKKSSPSS-LKAKIYRLFGREK  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLF
Sbjct  60   PVHSVLGGGKPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLF  119

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI K+ 
Sbjct  120  LWSNASTFIHKTP  132



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   144 bits (364),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFG  266
            ESA+A E   +  E ESL++KI++KIH H S SSS S+ E+E+K  + SS+ A V RLFG
Sbjct  9    ESALATEPAVEVVERESLLDKISEKIH-HGSDSSSSSDDEDEKKASSPSSLKAKVYRLFG  67

Query  267  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  446
            R++PVHKVLGGGK AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +A
Sbjct  68   REKPVHKVLGGGKPADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIA  127

Query  447  VLFLWSNASSFIKKSA  494
            VLFLWSNAS FI KS 
Sbjct  128  VLFLWSNASMFIHKSP  143



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   144 bits (363),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 2/134 (1%)
 Frame = +3

Query  96   ESAMAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            E  MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR+
Sbjct  7    EREMAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGRE  65

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVL
Sbjct  66   KPVHKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVL  125

Query  453  FLWSNASSFIKKSA  494
            FLWSNAS+F+ KS 
Sbjct  126  FLWSNASNFLNKSP  139



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   144 bits (362),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ES+++KI DK+H     SSS   ++E+EK     ++ A + RLFGR++PVHKVLGGGK A
Sbjct  13   ESVMDKINDKLHH---DSSSSDSEDEKEKISPVEAVKAKIYRLFGRERPVHKVLGGGKPA  69

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            D+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+FI KS
Sbjct  70   DIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINKS  129

Query  492  A  494
             
Sbjct  130  P  130



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 106/133 (80%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MA+E   ++   ES++EKI++KIH +DSSSSSDS+ + E+    +S + A + RLFGR++
Sbjct  1    MADESESKQSAVESMMEKISEKIHGNDSSSSSDSDSDHEKPASPSS-VKAKIYRLFGRER  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LF
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLF  119

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI KS 
Sbjct  120  LWSNAHTFIHKSP  132



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE   ++   ES++EKI+ KIH HDSSSSSDS+ + E+    +  + A + RLFGR++
Sbjct  1    MAEESESKQSTVESVMEKISGKIHGHDSSSSSDSDSDHEKPASPSP-VKAKIYRLFGRER  59

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++F
Sbjct  60   PVHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMF  119

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI KS 
Sbjct  120  LWSNAHTFIHKSP  132



>gb|KJB37517.1| hypothetical protein B456_006G208500 [Gossypium raimondii]
Length=210

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 94/130 (72%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M E + K EESL+ K+A+KIH HDSSS SD +K  E        + A V RLFGR++ VH
Sbjct  1    MGEHEEKHEESLMVKLAEKIHGHDSSSDSDIDKPSESS------IKAKVFRLFGRERSVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWS
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  465  NASSFIKKSA  494
            NA +FI KS 
Sbjct  115  NAYAFINKSP  124



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 15/144 (10%)
 Frame = +3

Query  105  MAEEDRKEE--------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMD  242
            MAEE + EE              ESL++KI++KIH H   SSS S+ E+E+K  + SS+ 
Sbjct  1    MAEEQKHEETAAAPEPAVEVLERESLLDKISEKIH-HGGDSSSSSDDEDEKKASSLSSLQ  59

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            A V RLFGR++PVHKVLGGGK AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  C
Sbjct  60   AKVYRLFGREKPVHKVLGGGKPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFC  119

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LI+ LAVLFLWSNAS FI KS 
Sbjct  120  HILIVVLAVLFLWSNASIFINKSP  143



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E  +E E +VE +ADKI    +     S    +     + ++ + + RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMADKI-TEKTHDHDSSSSSSDSDDDKSDAVKSKIFRLFGREKPV  59

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLW  119

Query  462  SNASSFIKKSA  494
            SNAS+F+ KS 
Sbjct  120  SNASNFLNKSP  130



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAXVRRLFGRQ  272
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  453  FLWSNASSFIKKSA  494
            FLWSN  +FI K+ 
Sbjct  121  FLWSNVHTFIHKTP  134



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +3

Query  105  MAEEDRKE-EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE++ +   ESL+EKI +K H  DSSSSSDS+ E+ +   ++      + RLFGR++PV
Sbjct  1    MAEKNEESVGESLMEKITEKFHHEDSSSSSDSDNEKSQPSSSSVQSK--IYRLFGREKPV  58

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H VLGGGK AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLW
Sbjct  59   HTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLW  118

Query  462  SNASSFIKKSA  494
            SNA++FI KS 
Sbjct  119  SNATTFINKSP  129



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            A E     ES++EKI +K+H H+SSSS   +++E+        + A + RLFGR++PVHK
Sbjct  5    AGEHEPVVESVMEKINEKLHDHNSSSSDSEDEKEKISSVDA--VKAKIYRLFGRERPVHK  62

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSN
Sbjct  63   VLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSN  122

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  123  ASTFINKSP  131



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +3

Query  117  DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  462  SNASSFIKK  488
            SNA++FI K
Sbjct  129  SNATTFINK  137



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A + RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT 
Sbjct  44   VKAKIYRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTL  103

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VCH LIL+LA+LFLWSNAS+FI KS+
Sbjct  104  VCHCLILSLAILFLWSNASTFINKSS  129



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 5/129 (4%)
 Frame = +3

Query  117  DRKEEESLVEKIADKI-----HRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            + KEEESL+EKI DKI         S S ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYKEEESLIEKIEDKIHFDHSSFSSSDSDTEKKPASAPEAASPSSVKATIWRLFGREKPV  68

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H+V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  462  SNASSFIKK  488
            SNA++FI K
Sbjct  129  SNATTFINK  137



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 107/134 (80%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAXVRRLFGRQ  272
            MAEE    +   ES++EKI++KIH HDSSSSSDS+ + + EK  + SS+ A + RLFGR+
Sbjct  1    MAEETESMQSAVESVMEKISEKIHGHDSSSSSDSDSDSDHEKPASPSSVKAKIYRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +P+H VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVL
Sbjct  61   RPLHHVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVL  120

Query  453  FLWSNASSFIKKSA  494
            FLWSN  +FI K+ 
Sbjct  121  FLWSNVHTFIHKTP  134



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MA+  ++EE   ESL++K+ DK+H HDSSSSS S    +      + +   V RLFGR++
Sbjct  1    MADHHKEEENKGESLIDKVTDKMHAHDSSSSSSSSSSSDSDDDRKARLKTKVYRLFGREK  60

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHK+LGGG+ ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +F
Sbjct  61   PVHKILGGGQGADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMF  120

Query  456  LWSNASSFIKKSA  494
            L SNAS+F+KK+ 
Sbjct  121  LLSNASTFVKKAP  133



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIH-RHdsssssdsekeeee-kkkttssMDAXVRRLFGRQQP  278
            MAE     EESL+EKI +K H RH SS     +++          ++ A + RLFGR++P
Sbjct  1    MAEH---REESLLEKITEKFHGRHSSSVVDSDDEKSSRGPSAAAEAVKAKIYRLFGREKP  57

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VHKVLGGGK ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FL
Sbjct  58   VHKVLGGGKPADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFL  117

Query  459  WSNASSFIKKS  491
            W NA++FI KS
Sbjct  118  WCNATTFISKS  128



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 95/130 (73%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M E + K E SL+EK+A+KIH HDSSS SD++K  E        + A V RLFGR++ VH
Sbjct  1    MGEHEEKHEGSLMEKLAEKIHGHDSSSDSDNDKPSESS------IKAKVFRLFGRERSVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGK AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWS
Sbjct  55   HVFGGGKSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWS  114

Query  465  NASSFIKKSA  494
            NA +FI KS 
Sbjct  115  NAYAFINKSP  124



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  126  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            +EESL++KI +K H   SSSSS  ++       ++SS+ A + RLFGR++PVH VLGGGK
Sbjct  11   KEESLMDKITEKFHGSSSSSSSSDDEAGRAAGSSSSSVKAKIYRLFGREKPVHSVLGGGK  70

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ 
Sbjct  71   PADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  130

Query  486  KSA  494
            K  
Sbjct  131  KCP  133



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = +3

Query  117  DRKEE---ESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQP  278
            D KEE   ES+++KI +K H      SSS SD EK+         +M A + RLFGR++P
Sbjct  3    DHKEEPVPESVMDKITEKFHGGDSSSSSSDSDDEKKGSSLASAAEAMKAKIYRLFGRERP  62

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VH VLGGGK AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFL
Sbjct  63   VHSVLGGGKPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFL  122

Query  459  WSNASSFIKKSA  494
            WSNAS+FI KS 
Sbjct  123  WSNASTFINKSP  134



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            E    +EESL+EKIADKIH     SSS   + +       SS+ A + RLFGR++PVH V
Sbjct  6    EHSEHKEESLMEKIADKIH--FDRSSSSDSEVKPAAAPEASSVKAKIWRLFGREKPVHHV  63

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
             GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA
Sbjct  64   FGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNA  123

Query  471  SSFIKK  488
            ++FI K
Sbjct  124  TTFINK  129



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   141 bits (355),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  308
            EE+LVEK+A++I    SSSSSDS+ ++         + + V RLFGR++P+H VLG GK 
Sbjct  5    EETLVEKVAEEIQGDASSSSSDSDDDKPFHADA---LKSKVYRLFGREKPIHHVLGAGKP  61

Query  309  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  488
            ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNAS+FI K
Sbjct  62   ADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTFINK  121

Query  489  SA  494
            S 
Sbjct  122  SP  123



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 3/128 (2%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            +E+ K  ES +EKIA+KIH H SSSSS S   ++EK  +   + + V RLFGR++PVHKV
Sbjct  6    KEEEKHGESFMEKIAEKIHGHGSSSSSSSSDSDDEKTAS---LKSKVYRLFGREKPVHKV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGG+ AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNA
Sbjct  63   LGGGQPADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNA  122

Query  471  SSFIKKSA  494
            S+FIKKS 
Sbjct  123  STFIKKSP  130



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            + KEE+S++EK+++K+H     SSS SD EK+      + +++ A + RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDEKKGSSSSSSAAAVKAKIYRLFGRERPVHSV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  471  SSFIKKSA  494
            S+FI KS 
Sbjct  123  STFINKSP  130



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  308
            EE+L+E+I +KIH    SSSSDS+ E+ +      ++ + +  LFGR++PVH++LGGGK 
Sbjct  6    EETLIEQINEKIHGDGDSSSSDSDDEKSKASVVAEAVKSKIYHLFGREKPVHQILGGGKP  65

Query  309  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  488
            ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWSNA++ I K
Sbjct  66   ADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTLINK  125

Query  489  SA  494
            S 
Sbjct  126  SP  127



>gb|AFW80460.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=154

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  429  LILALAVLFLWSNASSFIKK  488
            LI +L VLFLWSNASSFI K
Sbjct  135  LIFSLGVLFLWSNASSFIHK  154



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 1/131 (1%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeee-ekkkttssMDAXVRRLFGRQQPV  281
            MAE      ES++EKI++ IH HDSSSSS     +  +K  + SS+ A + RLFGR++PV
Sbjct  1    MAEHHENPIESVMEKISETIHAHDSSSSSSDSDSDSEKKPTSPSSVKAKIFRLFGRERPV  60

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H VLGGGK ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLW
Sbjct  61   HHVLGGGKPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLW  120

Query  462  SNASSFIKKSA  494
            SNA +FI K+ 
Sbjct  121  SNAHTFINKTP  131



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE   ++EES+++KI +K H     SSS S  ++E +  ++SS+ A + RLFGR++PVH
Sbjct  1    MAE---RKEESVMDKITEKFH---GGSSSSSSSDDEGRSGSSSSVKAKIYRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWS
Sbjct  55   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWS  114

Query  465  NASSFIKKSA  494
            NAS+F+ K  
Sbjct  115  NASAFVNKCP  124



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI K+ 
Sbjct  118  LWSNAHTFINKTP  130



>ref|XP_010462752.1| PREDICTED: reticulon-like protein B5 isoform X2 [Camelina sativa]
Length=130

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 7/132 (5%)
 Frame = +3

Query  105  MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  453  FLWSNASSFIKK  488
            FLWSNA +FI K
Sbjct  118  FLWSNAHTFINK  129



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 94/137 (69%), Gaps = 8/137 (6%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIH--------RHdsssssdsekeeeekkkttssMDAXVRRLF  263
            AE    + ESL+EKIADK H          D+ +     K E E +    ++   V RLF
Sbjct  5    AENSDPKGESLMEKIADKFHGDDSSSSSESDTETKKPVVKSEVEAEPEPETLKNKVWRLF  64

Query  264  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  443
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ L
Sbjct  65   GREKPVHKVFGGGKPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITL  124

Query  444  AVLFLWSNASSFIKKSA  494
            AVLFLWSNA++FI K  
Sbjct  125  AVLFLWSNATTFINKKP  141



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + A + RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  456  LWSNASSFIKKSA  494
            LWSNA +FIKKS 
Sbjct  116  LWSNAHTFIKKSP  128



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 8/133 (6%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    E+SL++KI++KIH HDSSS S+ EK +         + A + RLFGR++
Sbjct  1    MAEEIEKSMPAEQSLMDKISEKIHHHDSSSDSEYEKPDSPSA-----VKAKIYRLFGREK  55

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  56   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLF  115

Query  456  LWSNASSFIKKSA  494
            LWSNA +FIKKS 
Sbjct  116  LWSNAHTFIKKSP  128



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 6/129 (5%)
 Frame = +3

Query  117  DRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHK  287
            + KEE   ES++EKI +K H      SS S+ + E+ K ++S + + + RLFGR++PVH 
Sbjct  3    ENKEESVGESVMEKIMEKFHD---DDSSSSDSDNEKSKPSSSPVKSQIYRLFGREKPVHT  59

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGG  ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSN
Sbjct  60   VLGGGTPADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSN  119

Query  468  ASSFIKKSA  494
            AS+FI KS 
Sbjct  120  ASTFIHKSP  128



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 95/133 (71%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE    EE   ESL+EKI+ KI       SS S   + EK   + S+ + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNEKTSASDSLKSKVFRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  118  LWSNASTFINKSP  130



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 95/129 (74%), Gaps = 5/129 (4%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIHRHdssss-----sdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            +  EEESL+EKI DKIH    SSS     ++ +     +  + SS+ A + RLFGR++PV
Sbjct  9    EYNEEESLIEKIEDKIHFDHFSSSSSDSDTEKKPASAPEAASPSSVKAAIWRLFGREKPV  68

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H+V GGGK ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLW
Sbjct  69   HQVFGGGKPADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLW  128

Query  462  SNASSFIKK  488
            SNA++FI K
Sbjct  129  SNATTFINK  137



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +3

Query  105  MAEEDR---KEEESLVEKIADKIHR-HdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            MAE++       +SLV++I++KIH   D+SSSSDS+ + +E     +S+ A + RLFGR+
Sbjct  1    MAEQEEISDPRTDSLVDRISEKIHGGDDTSSSSDSDSQVKEAASPPASVKAKIYRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKV GGGK AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++L
Sbjct  61   KPVHKVFGGGKPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLL  120

Query  453  FLWSNASSFIKK  488
            FLWSNA++FI K
Sbjct  121  FLWSNATTFINK  132



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            E    + ESL+EKIADK H        +S + +     + E +  T ++   V RLFGR+
Sbjct  6    ENSDPKGESLLEKIADKFHGDDSSSSSESDTETKKPAVKSEVEPETETLKNKVWRLFGRE  65

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKV GGGK ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVL
Sbjct  66   KPVHKVFGGGKPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVL  125

Query  453  FLWSNASSFIKKSA  494
            FLWSNA++FI K  
Sbjct  126  FLWSNATTFINKKP  139



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            A V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VC
Sbjct  43   ARVFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVC  102

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            HGLI +L +LFLWSNASSFI KS+
Sbjct  103  HGLIFSLGLLFLWSNASSFINKSS  126



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE    +EES+++KI++K+H         S   ++E     +++ A + RLFGR++PVH
Sbjct  1    MAEH---KEESVMDKISEKLHG------GSSSGSDDESSSAAAAVKAKIYRLFGREKPVH  51

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWS
Sbjct  52   SVLGGGKPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWS  111

Query  465  NASSFIKKSA  494
            NAS+FI KS 
Sbjct  112  NASAFINKSP  121



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            + KEE+S++EK+++K+H     SSS SD +K+        ++M A + RLFGR++PVH V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVHSV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  471  SSFIKKSA  494
            S+FI KS 
Sbjct  123  STFIHKSP  130



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            M A + RLFGR++PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT 
Sbjct  1    MKAKIYRLFGRERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTL  60

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VCH LI++LA+LFLWSNASSFI KS 
Sbjct  61   VCHCLIVSLAILFLWSNASSFINKSP  86



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHG  138

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI AL VLFLWSNASSFI K+ 
Sbjct  139  LIFALGVLFLWSNASSFIHKAP  160



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI K+ 
Sbjct  118  LWSNAHTFINKTP  130



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  + ++S VE + +KIH HDSSSSSDS+ + E+     S + A + RLFGR++P+H
Sbjct  1    MAEET-ESKQSAVESVMEKIHGHDSSSSSDSDSDHEKPASPIS-VKAKIYRLFGRERPLH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             VLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWS
Sbjct  59   HVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWS  118

Query  465  NASSFIKKSA  494
            N  +FI K+ 
Sbjct  119  NVHTFIHKTP  128



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E  +E E +VE + DKI          S    +       ++ + + RLFGR++PV
Sbjct  1    MAEHEGEREREPVVESMVDKI-TEKIHDHHSSSSSSDSDDDKLDAVKSKIFRLFGREKPV  59

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            HKVLGGGK ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLW
Sbjct  60   HKVLGGGKPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLW  119

Query  462  SNASSFIKKSA  494
            SNAS+F+ KS 
Sbjct  120  SNASNFLNKSP  130



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 95/137 (69%), Gaps = 9/137 (7%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIH---------RHdsssssdsekeeeekkkttssMDAXVRRLF  263
            E    + ESL+EKIADK H           D+ +   + KEE       SS+   V RLF
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEPSSVKDKVWRLF  65

Query  264  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  443
            GR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++L
Sbjct  66   GREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISL  125

Query  444  AVLFLWSNASSFIKKSA  494
            AVLFLWSNA++FI K  
Sbjct  126  AVLFLWSNATTFINKKP  142



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QP+HK LGGGK ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHG
Sbjct  79   VFRLFGREQPIHKALGGGKPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHG  138

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI AL VLFLWSNASSFI K+ 
Sbjct  139  LIFALGVLFLWSNASSFIHKAP  160



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   139 bits (349),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++PVH VLGGGK AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT 
Sbjct  41   IKAKVFRLFGREKPVHHVLGGGKPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTL  100

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VCH LILALAVLFLWSNA++FI KS 
Sbjct  101  VCHLLILALAVLFLWSNAATFINKSP  126



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI +L VLFLWSNASSFI KS 
Sbjct  135  LIFSLGVLFLWSNASSFIHKSP  156



>ref|XP_010439153.1| PREDICTED: reticulon-like protein B1 isoform X2 [Camelina sativa]
Length=199

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 11/144 (8%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  242
            ES +A E   +  E ESL++KI++KIH           S    D +K++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSP  152



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            E+L+EKI +KIH    SSSSDS+ E+ +  +   ++ + + RLFGR++PVH++LGGGK A
Sbjct  8    ETLIEKIKEKIH-GGDSSSSDSDDEKSKASEVAEAVKSKIFRLFGREKPVHRILGGGKPA  66

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA++FI KS
Sbjct  67   DVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINKS  126

Query  492  A  494
             
Sbjct  127  P  127



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 92/155 (59%), Gaps = 25/155 (16%)
 Frame = +3

Query  105  MAEEDRKE------EESLVEKIADKIH-------------------RHdsssssdsekee  209
            MAE+   E       E+L+EK+ADK+H                   R  + ++       
Sbjct  1    MAEQPHAEGGASPKHETLMEKLADKLHAGGGKGDSSSSDSDNDERPRPSAPAAEVKPSFS  60

Query  210  eekkkttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFE  389
                   +   A V RLFGR+QP+HK LGGGK ADVFLWRN+ IS GVLGG TAIWILFE
Sbjct  61   VSAAAAAAEARAKVFRLFGREQPIHKALGGGKPADVFLWRNRNISAGVLGGVTAIWILFE  120

Query  390  VLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSA  494
             L YHLLT VCHGLI +L VLFLWSNASSFI KS 
Sbjct  121  CLGYHLLTFVCHGLIFSLGVLFLWSNASSFINKSP  155



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   138 bits (348),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + RLFGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSN  +FI K++
Sbjct  118  LWSNVHTFINKAS  130



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   138 bits (348),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI K+ 
Sbjct  118  LWSNAHTFINKTP  130



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   138 bits (348),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A + RLFGR++ VH VLGGGK ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ 
Sbjct  45   IKAKIYRLFGRERSVHNVLGGGKPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSL  104

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VCH LIL+LA+LFLWSNAS+FI K+ 
Sbjct  105  VCHCLILSLAILFLWSNASTFINKAP  130



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   138 bits (348),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 7/134 (5%)
 Frame = +3

Query  105  MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPAEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  453  FLWSNASSFIKKSA  494
            FLWSNA +FI K+ 
Sbjct  118  FLWSNAHTFINKTP  131



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   139 bits (349),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI +L +LFLWSNASSFI KS 
Sbjct  135  LIFSLGLLFLWSNASSFINKSP  156



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            A + RLFGR++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VC
Sbjct  48   AKIYRLFGRERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVC  107

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LILALAVLFLWSNAS+FI KS 
Sbjct  108  HILILALAVLFLWSNASTFINKSP  131



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  126  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            E ESL++KI++K+H    SSSSD ++++++  ++ SSM + V RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDEKKKKSSESPSSMKSKVYRLFGREKPVHKVLGGGK  81

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI 
Sbjct  82   PADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIN  141

Query  486  KSA  494
            KS 
Sbjct  142  KSP  144



>gb|AFK39432.1| unknown [Lotus japonicus]
Length=150

 Score =   135 bits (340),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAX---VRRLFGRQQP  278
            +E D  + E L+EKIA+KIH HDSSSSSDS+ E+E++K ++S        V RLFGR++P
Sbjct  5    SEHDEPKAEPLMEKIAEKIHGHDSSSSSDSDNEKEKEKSSSSPSSDFKSKVSRLFGREKP  64

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            +H VLGGGKQADVFLWRNKKIS  VLG AT +WILFE+L YHLLT +CH  ILAL +LFL
Sbjct  65   IHHVLGGGKQADVFLWRNKKISGTVLGVATVVWILFELLGYHLLTLICHLAILALTLLFL  124

Query  459  WSNASSFIKKSA  494
            WSN SS I KS 
Sbjct  125  WSNGSSLINKSP  136



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR++P+HKVLGGGK ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHG
Sbjct  75   VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG  134

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI +L +LFLWSNASSFI KS 
Sbjct  135  LIFSLGLLFLWSNASSFINKSP  156



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKIA+KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPAEESLMEKIAEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA +FI K++
Sbjct  118  LWSNAHTFINKTS  130



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 94/133 (71%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE    EE   ESL+EKI+ KI       SS S   + +K   T S  + V RLFGR++
Sbjct  1    MAEHHEHEEVKGESLLEKISGKI---HDHDSSSSSDSDNDKTSATDSFKSNVFRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LF
Sbjct  58   PIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  118  LWSNASTFINKSP  130



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D  + RLFGR++PVH
Sbjct  1    MAEQSENPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  465  NASSFIKKSA  494
            NA SFI KS 
Sbjct  119  NAHSFINKSP  128



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (68%), Gaps = 11/139 (8%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIH-----------RHdsssssdsekeeeekkkttssMDAXVRR  257
            E    + ESL+EKIADK H             ++   +  E+     +   SS+   V R
Sbjct  6    ENSDPKGESLMEKIADKFHGGDDSSSSSDSDTETKKPAAKEEVVAAAEAEPSSVKDKVWR  65

Query  258  LFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  437
            LFGR++PVHKV GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+
Sbjct  66   LFGREKPVHKVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILII  125

Query  438  ALAVLFLWSNASSFIKKSA  494
            +LAVLFLWSNA++FI K  
Sbjct  126  SLAVLFLWSNATTFINKKP  144



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 4/132 (3%)
 Frame = +3

Query  108  AEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQP  278
            A E  K E   ESL++KI +K H  DSSSS   + ++  K   +S+  A + RLFGR+QP
Sbjct  5    ASEHEKHESAAESLIDKITEKFHGSDSSSSDSDDDDKGIKSAASSAK-AKIYRLFGREQP  63

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VHKVLGGGK AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FL
Sbjct  64   VHKVLGGGKPADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFL  123

Query  459  WSNASSFIKKSA  494
            WSNASSFI KS 
Sbjct  124  WSNASSFINKSP  135



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  245
            ES +A E   +  E ESL++KI++KIH          SS   D +K++ +K  + SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKTKKPSSPSSMQS  68

Query  246  XVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  425
             V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH
Sbjct  69   KVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICH  128

Query  426  GLILALAVLFLWSNASSFIKKSA  494
             +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  VMIVVLAVLFLWSNATMFINKSP  151



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE+     ES++ KI++KIH H+SSSS      E++   + S  D  + RLFGR++PVH
Sbjct  1    MAEQSEDPIESVMGKISEKIH-HESSSSDSESDSEKKSYPSESVKD-KIWRLFGREKPVH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            +VLGGGK ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWS
Sbjct  59   RVLGGGKPADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWS  118

Query  465  NASSFIKKSA  494
            NA SFI KS 
Sbjct  119  NAHSFINKSP  128



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ A + RLFGR++
Sbjct  1    MAEESEKPVHAEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESPSALKAKIYRLFGREK  58

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMF  118

Query  456  LWSNASSFIKKSA  494
            LWSNA +F+KKS 
Sbjct  119  LWSNAHAFMKKSP  131



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LI
Sbjct  49   RLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLI  108

Query  435  LALAVLFLWSNASSFIKKSA  494
            L+LA+LFLWSNA++FI KS 
Sbjct  109  LSLAILFLWSNATTFINKSP  128



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 11/144 (8%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  242
            ES +A E   +  E ESL++KI++KIH           S    D +K++++K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKKKKPSSPSSMQ  68

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSP  152



>ref|XP_010462746.1| PREDICTED: reticulon-like protein B5 isoform X1 [Camelina sativa]
Length=160

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 7/132 (5%)
 Frame = +3

Query  105  MAEEDRK----EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQ  272
            MAEE  K    EE SL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR+
Sbjct  1    MAEEIEKSVPVEEPSLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGRE  57

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  L
Sbjct  58   KPVHKVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGL  117

Query  453  FLWSNASSFIKK  488
            FLWSNA +FI  
Sbjct  118  FLWSNAHTFINN  129



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 104/144 (72%), Gaps = 11/144 (8%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMD  242
            ES +A E   +  E ESL++KI++KIH           S    D +K++ +K  + SSM 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDDKKKKKTKKPSSPSSMQ  68

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +C
Sbjct  69   SKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLIC  128

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  HVMIVVLAVLFLWSNATMFINKSP  152



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLI  143

Query  435  LALAVLFLWSNASSFIKKSA  494
             +L VLFLWSNASSFI KS 
Sbjct  144  FSLGVLFLWSNASSFINKSP  163



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeek---kkttssMDAXVRRLFGRQQ  275
            MAE     EESL+EKI DKIH HDSSSSS S   +++K    +++SS+ + + RLFGR++
Sbjct  1    MAETQHHHEESLLEKITDKIHGHDSSSSSSSSDSDDDKKSEAQSSSSLKSKIYRLFGREK  60

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LF
Sbjct  61   PVHKVLGGGKPADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLF  120

Query  456  LWSNASSFIKKSA  494
            LWSNAS+FI KS 
Sbjct  121  LWSNASTFINKSP  133



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 97/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  105  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQP  278
            MAE   +E   ES+++KI+DK H    SSSS S   +++KK + + + A + RLFGR+QP
Sbjct  1    MAEHKEEEPVAESMMDKISDKFHGGGGSSSSSSSDSDDDKKGSAAGVKAKIYRLFGREQP  60

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFL
Sbjct  61   VHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFL  120

Query  459  WSNASSFIKKSA  494
            WSN   FI KS 
Sbjct  121  WSNVCIFIHKSP  132



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            + KEE+S++EK+++K+H     SSS SD +K+        ++M A + RLFGR++PV  V
Sbjct  3    EHKEEQSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGRERPVQSV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNA
Sbjct  63   LGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNA  122

Query  471  SSFIKKSA  494
            S+FI KS 
Sbjct  123  STFIHKSP  130



>ref|NP_001118533.1| reticulon-like protein B5 [Arabidopsis thaliana]
 gb|AEC10652.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=187

 Score =   135 bits (339),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA + I K++
Sbjct  118  LWSNAHTLINKTS  130



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +3

Query  96   ESAMAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFG  266
            E  MA+   + E   ES++EKI DK+H     SSS   ++++EK  +  ++ A + RLFG
Sbjct  146  EYTMADHAGEHESVVESVMEKINDKLHD--HDSSSSDSEDDKEKISSVDAVKAKIYRLFG  203

Query  267  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  446
            R++PVHKVLGGGK AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALA
Sbjct  204  RERPVHKVLGGGKPADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALA  263

Query  447  VLFLWSNASSFIKKSA  494
            VLFLWSNAS+FI KS 
Sbjct  264  VLFLWSNASTFINKSP  279



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGRQ+PVHKV GGGK ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT 
Sbjct  45   VTAAVYRLFGRQKPVHKVFGGGKPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTL  104

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VCH LI++LAVLFL+SNA +F+ K+ 
Sbjct  105  VCHCLIVSLAVLFLYSNAIAFMHKTP  130



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 94/137 (69%), Gaps = 9/137 (7%)
 Frame = +3

Query  105  MAEE----DRKEEESLVEKIADKIH-----RHdsssssdsekeeeekkkttssMDAXVRR  257
            MAE+       +EES +EKIADKIH        SS S    K     + + SS+ A + R
Sbjct  1    MAEQVEQHSEHKEESFMEKIADKIHFDRSSSSSSSDSDSEVKPAAAPEASPSSVKAKIWR  60

Query  258  LFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLIL  437
            LFGR++PVH V GGGK ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI 
Sbjct  61   LFGREKPVHHVFGGGKPADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIF  120

Query  438  ALAVLFLWSNASSFIKK  488
             LAVLFLWSNA++FI K
Sbjct  121  TLAVLFLWSNATTFINK  137



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  114  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  471  SSFIKKSA  494
             +FI KS 
Sbjct  123  CTFIHKST  130



>ref|XP_007218267.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19466.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=280

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = +3

Query  78   FEFG*VESAMAEEDR------KEEESLVEKIADKIHRHdsssssdsekeeeekkkttssM  239
            F FG V   MA++        + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S  
Sbjct  75   FVFG-VSEIMADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-  132

Query  240  DAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAV  419
               V R+FGR++PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V
Sbjct  133  KPKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLV  192

Query  420  CHGLILALAVLFLWSNASSFIKKSA  494
             H LI  LAVLFLWSNA SFI K+ 
Sbjct  193  GHILIGTLAVLFLWSNAHSFIHKTP  217



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A + RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT 
Sbjct  76   VQAKIYRLFGREKPVHKVLGGGKPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTL  135

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            +CH LI +LAVLFLW+NAS+FI KS 
Sbjct  136  ICHSLIFSLAVLFLWANASTFINKSP  161



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +3

Query  96   ESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            +S  A    + ++SL+EKI++KIH H+SSSSS S+ + E+ +   S     V R+FGR++
Sbjct  4    QSESAGSTVEHDKSLMEKISEKIHDHESSSSSSSDSDNEKPESPKSE-KPKVFRIFGREK  62

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLF
Sbjct  63   PVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLF  122

Query  456  LWSNASSFIKKSA  494
            LWSNA SFI K+ 
Sbjct  123  LWSNAHSFIHKTP  135



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 99/130 (76%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH H  SSSS S   +++KK ++  +   V RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTKVYRLFGREQPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  117

Query  465  NASSFIKKSA  494
            +AS+FI K+ 
Sbjct  118  SASTFIHKTT  127



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH H  SSSS S  + ++ KK++S +   V RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHGDSSSSSSSSDSDDDKKSSS-LKTKVYRLFGREQPVH  58

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  59   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  118

Query  465  NASSFIKKSA  494
            +AS+FI K+ 
Sbjct  119  SASTFIHKTT  128



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   136 bits (343),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            E D  + ESL++KI+ KIH     SSS S+ + E+K  + S++ + V RLFGR++P+H V
Sbjct  6    EHDESKGESLLDKISGKIHD--HDSSSSSDSDNEKKNPSPSTLKSKVFRLFGREKPLHNV  63

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNA
Sbjct  64   LGGGKPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNA  123

Query  471  SSFIKKSA  494
            S+FI K+ 
Sbjct  124  STFINKAP  131



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MA+E  K    EESL+EKIA+KI       SS S   + EK ++  ++   + RLFGR++
Sbjct  1    MADEMEKSAPAEESLLEKIAEKI---HDHDSSSSSDSDNEKMESPMAVKDKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKV GGGK ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLF
Sbjct  58   PVHKVFGGGKPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA SFI KS 
Sbjct  118  LWSNAHSFINKSP  130



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            + RLFGR++PVH VLGGGK AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH 
Sbjct  47   ICRLFGREKPVHTVLGGGKPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHC  106

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LIL+LA+LFLWSNA++FI KS 
Sbjct  107  LILSLAILFLWSNATTFINKSP  128



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKIA+KIH      SS S   + EK ++ S++ A + RLFGR++
Sbjct  1    MAEESEKPVHTEESLMEKIAEKIHD--HHDSSSSSDSDHEKPESQSALKAKIYRLFGREK  58

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +F
Sbjct  59   PVHKVLGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMF  118

Query  456  LWSNASSFIKKSA  494
            LWSNA +F+KKS 
Sbjct  119  LWSNAHAFMKKSP  131



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 7/130 (5%)
 Frame = +3

Query  126  EEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            E ESL++KI++KIH          SS   + ++++ +K ++ SSM + V RLFGR++PVH
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEYKEKKTKKPESPSSMKSKVYRLFGREKPVH  81

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KVLGGGK AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWS
Sbjct  82   KVLGGGKPADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWS  141

Query  465  NASSFIKKSA  494
            NA+ FI KS 
Sbjct  142  NATMFINKSP  151



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  96   ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGR  269
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ A V R+FGR
Sbjct  4    EKEHAGSSVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  450  LFLWSNASSFIKKSA  494
            LFLWSNA +FI K+ 
Sbjct  124  LFLWSNAHAFIHKTP  138



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +3

Query  126  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGG  302
            E ESL+EK+++KIH + DSSSS D  +++     +  S+ + V RLFGR++PVHKVLGGG
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVLGGG  77

Query  303  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFI  482
            K AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI
Sbjct  78   KPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFI  137

Query  483  KKSA  494
             KS 
Sbjct  138  HKSP  141



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = +3

Query  78   FEFG*VESAMAEEDR------KEEESLVEKIADKIHRHdsssssdsekeeeekkkttssM  239
            F FG V   MA++        + E+SL+EKI++KIH H+SSSSS S+ + E+ +   S  
Sbjct  75   FVFG-VSEIMADQSESAGSTVEHEKSLMEKISEKIHDHNSSSSSSSDSDNEKPESPKSE-  132

Query  240  DAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAV  419
               V R+FGR++PVH V GGGK ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V
Sbjct  133  KPKVFRIFGREKPVHHVFGGGKPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLV  192

Query  420  CHGLILALAVLFLWSNASSFIKKSA  494
             H LI  LAVLFLWSNA SFI K+ 
Sbjct  193  GHILIGTLAVLFLWSNAHSFIHKTP  217



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKI++KIH HD SSSS S+ ++++   +   +   + RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKISEKIHGHDDSSSSSSDSDDDKNSAS---LKTKIYRLFGREQPLH  56

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  57   KLFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  116

Query  465  NASSFIKKSA  494
            +AS+FI KS 
Sbjct  117  SASTFIHKSP  126



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  114  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVL  293
            E+ K EES++EKIA+KIH HD SSSS S+ ++E+K  + SSM   + RLFGR++PVHKV 
Sbjct  3    EEHKHEESIMEKIAEKIHGHDGSSSSSSDSDDEKKSASPSSMKKKIYRLFGREKPVHKVF  62

Query  294  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  473
            GGGK AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A 
Sbjct  63   GGGKPADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAI  122

Query  474  SFIKKSA  494
            +FI K+ 
Sbjct  123  TFIHKTP  129



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 105/142 (74%), Gaps = 9/142 (6%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAX  248
            ES +A E   +  E ESL++KI++KIH         SS   D +K++++K  + SSM + 
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHGGDSSSSSSSSDDDDDKKKKKKKPSSPSSMQSK  68

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH 
Sbjct  69   VYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHV  128

Query  429  LILALAVLFLWSNASSFIKKSA  494
            +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  MIVVLAVLFLWSNATMFINKSP  150



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKE---EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K    EESL+EKI++KIH HDSSSSS+SE E+ +       + A + R+FGR++
Sbjct  1    MAEEIEKSVPTEESLMEKISEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRMFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LF
Sbjct  58   PVHKVLGGGKPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLF  117

Query  456  LWSNASSFIKKSA  494
            LWSNA + I K++
Sbjct  118  LWSNAHTLINKTS  130



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 96/130 (74%), Gaps = 5/130 (4%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH HD SSSS    ++++       +   + RLFGR+QPVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDDSSSSSDSDDDKKSST----LKTKIYRLFGREQPVH  55

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            K+ GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS
Sbjct  56   KIFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWS  115

Query  465  NASSFIKKSA  494
            +A++FI K+ 
Sbjct  116  SATTFIHKTP  125



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE +  + ES++EKIADKIH HDSSS SD +K           + + + RLFGR +PVH
Sbjct  1    MAEHEAPKAESIMEKIADKIHHHDSSSDSDDDKPAPSS------LKSKIYRLFGRDKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KVLGGGK AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWS
Sbjct  55   KVLGGGKPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWS  114

Query  465  NASSFIKKSA  494
            NAS+FI K+ 
Sbjct  115  NASTFINKAP  124



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = +3

Query  126  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            E ESL++KI++KIH           S    D ++++ +K ++ SSM + V RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDDDDDKKEKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  142  SNATMFINKSP  152



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE    EE   ESL++KI+ KI       SS S   + EK   + S+ + V RLFGR++
Sbjct  1    MAEHHEHEEAKGESLLDKISGKI---HDHDSSSSSDSDNEKTGPSDSLKSKVFRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            P+H VLGGGKQADVFLWRNKKIS   LG AT IWILFE+LEYHLLT VCH +ILALA LF
Sbjct  58   PIHHVLGGGKQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLF  117

Query  456  LWSNASSFIKK  488
            LWSNAS+FI K
Sbjct  118  LWSNASTFINK  128



>gb|KCW72351.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=224

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 92/132 (70%), Gaps = 6/132 (5%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeee------kkkttssMDAXVRRLFGRQ  272
            EE   + ESL+EK A+KIH H    SS S   ++E                 + RLFGR+
Sbjct  5    EEQPHKAESLLEKFAEKIHGHHHDGSSSSSDSDDERKKPSAPPPPKEEEKPKIFRLFGRE  64

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+L
Sbjct  65   RPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAIL  124

Query  453  FLWSNASSFIKK  488
            FLWSNA++FI K
Sbjct  125  FLWSNATTFIHK  136



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  114  EDRKEEESLVEKIADKIHRH-dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            ED K EES++EKI +KIH H DSSS SDS+ +++    ++SS  + + RLFGR++PVHKV
Sbjct  3    EDHKHEESIMEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA
Sbjct  63   LGGGKPADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNA  122

Query  471  SSFIKKSA  494
             +FI K++
Sbjct  123  CTFIHKAS  130



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  96   ESAMAEEDRKEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGR  269
            E   A    ++E SL+EKI DKIH   HDSSSSS S+ + E+ +K T S+ A V R+FGR
Sbjct  4    EKEHAGSPVEDEPSLLEKIGDKIHVGDHDSSSSSSSDSDNEKSEKKTESVKAKVFRIFGR  63

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVH VLGGGK ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+
Sbjct  64   ERPVHHVLGGGKPADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAI  123

Query  450  LFLWSNASSFIKKSA  494
            LFLWSNA +FI K+ 
Sbjct  124  LFLWSNAHAFIHKTP  138



>ref|XP_006413534.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54987.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=222

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 21/151 (14%)
 Frame = +3

Query  105  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  221
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  222  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEY  401
             + SSM + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  402  HLLTAVCHGLILALAVLFLWSNASSFIKKSA  494
            HLLT +CH +I+ LAVLFLWSNA+ FI KS 
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSP  151



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            + RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH 
Sbjct  57   IFRLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHV  116

Query  429  LILALAVLFLWSNASSFIKK  488
            LIL LA+LFLWSNA++FI K
Sbjct  117  LILGLAILFLWSNATTFIHK  136



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KI +KI  HDSSSSSDS+ ++  K      + + + RLFGR++PVHKVLGGGK A
Sbjct  7    ESLMDKITEKIRGHDSSSSSDSDDDKPSKVDA---VKSKIFRLFGREKPVHKVLGGGKPA  63

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNAS+F+ KS
Sbjct  64   DVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNKS  123

Query  492  A  494
             
Sbjct  124  P  124



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VC
Sbjct  46   SNVFRLFGREKPIHHVLGGGKPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVC  105

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LILALA LFLWSNAS+FI KS 
Sbjct  106  HFLILALAGLFLWSNASTFINKSP  129



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  435  LALAVLFLWSNASSFIKK  488
            L LA+LFLWSNA++FI K
Sbjct  119  LGLAILFLWSNATTFIHK  136



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  435  LALAVLFLWSNASSFIKK  488
            L LA+LFLWSNA++FI K
Sbjct  119  LGLAILFLWSNATTFIHK  136



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +3

Query  117  DRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLG  296
            + ++ ES+ E + DKI      S S S   + + K + S++ A + RLFGR+ PVHKVLG
Sbjct  7    EHEKHESVAESVMDKITEKFHGSDSSSSDSDNDIKSSASAVKAKIYRLFGRETPVHKVLG  66

Query  297  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  476
            GGK AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNAS+
Sbjct  67   GGKPADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNAST  126

Query  477  FIKKS  491
            FI KS
Sbjct  127  FISKS  131



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +3

Query  126  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            E ESL+EKI++K+H       S S     + +    S+ + V RLFGR++PVHKVLGGGK
Sbjct  22   ERESLMEKISEKVHH---KGDSSSSSSSSDDENEKKSLKSKVYRLFGRERPVHKVLGGGK  78

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI 
Sbjct  79   PADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIH  138

Query  486  KSA  494
            KS 
Sbjct  139  KSP  141



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = +3

Query  126  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            E ESL++KI++KIH           S    D +K++ +K ++ SSM + V RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEEDKKKKKTKKPESPSSMKSKVYRLFGREKPV  81

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  142  SNATMFINKSP  152



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EESL+EKI++KIH H  SSSS S+ ++E+K  ++  +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESLMEKISEKIHGHGDSSSSSSDSDDEKKSDSS--LKTKIYRLFGREKPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWS  117

Query  465  NASSFIKKSA  494
            +A++FI K+ 
Sbjct  118  SATTFIHKTP  127



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KIA+KIH HD SSSS     ++++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  73   ESLLDKIAEKIHGHDDSSSSSDSDSDKKESSS---IKEKVFRLFGREKPVHSVLGGGKPA  129

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  130  DVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIHKA  189

Query  492  A  494
             
Sbjct  190  P  190



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 101/125 (81%), Gaps = 2/125 (2%)
 Frame = +3

Query  126  EEESLVEKIADKIHR--HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGG  299
            E ESL++KI++K+H     SSS  D +K++++  ++ SSM + V RLFGR++PVHKVLGG
Sbjct  22   ERESLMDKISEKLHHGGDSSSSDEDDDKKKKKSSESPSSMKSKVYRLFGREKPVHKVLGG  81

Query  300  GKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSF  479
            GK AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ F
Sbjct  82   GKPADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMF  141

Query  480  IKKSA  494
            I KS 
Sbjct  142  INKSP  146



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + + RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  52   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  111

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LIL+LAV FLWSNAS+FI KS 
Sbjct  112  HLLILSLAVFFLWSNASTFINKSP  135



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 106/132 (80%), Gaps = 4/132 (3%)
 Frame = +3

Query  105  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQP  278
            MAE D+ +   ES+ EKI++K H HDSSS SDS+ E+ +    +  + + + RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKTHGHDSSSVSDSDHEKSKSNPDS--LKSKIYRLFGREKP  58

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFL  118

Query  459  WSNASSFIKKSA  494
            WSNAS+FI KS 
Sbjct  119  WSNASTFINKSP  130



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 21/151 (14%)
 Frame = +3

Query  105  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  221
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  222  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEY  401
             + SSM + V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPADIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  402  HLLTAVCHGLILALAVLFLWSNASSFIKKSA  494
            HLLT +CH +I+ LAVLFLWSNA+ FI KS 
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSP  151



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + + RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  58   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  117

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LIL+LAV FLWSNAS+FI KS 
Sbjct  118  HLLILSLAVFFLWSNASTFINKSP  141



>ref|XP_010523772.1| PREDICTED: reticulon-like protein B5 [Tarenaya hassleriana]
Length=253

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            E     EESL+EKIADKIH      SS S   + EK ++ S++   + RLFGR++PVHKV
Sbjct  6    ENSTPAEESLLEKIADKIHD---HDSSSSSDSDNEKMESPSAVKEKIYRLFGREKPVHKV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
             GGGK ADV LWR+KK+S  VLG  TA+W+LFE++EYHLL+ VCH  IL LAVLFLWSNA
Sbjct  63   FGGGKPADVLLWRDKKLSAAVLGTTTAVWVLFELVEYHLLSFVCHISILTLAVLFLWSNA  122

Query  471  SSFIKKSA  494
             SFI KS 
Sbjct  123  HSFINKSP  130



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KI +KIH HDSSSS   + + +        + + + RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDTSAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  126  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLG  296
            E ESL+EKI++KIH      SSSSSD ++ E++   +  S+ + V RLFGR++PVHKVLG
Sbjct  22   ERESLMEKISEKIHHKGDSSSSSSSDDDENEKKSSPSPKSLKSKVYRLFGRERPVHKVLG  81

Query  297  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  476
            GGK AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  477  FIKKSA  494
            FI KS 
Sbjct  142  FIHKSP  147



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWS  114

Query  465  NASSFIKKSA  494
            +A++FI K+ 
Sbjct  115  SATTFIHKTP  124



>gb|KCW46474.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=218

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  308
            E SL+EK  +KIH  D  S+S S   +++K     S  + V RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  309  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  488
            AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++AS+ I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  489  SA  494
            S 
Sbjct  130  SP  131



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KI +KIH HDSSSS   + + +        + + + RLFGR++PVHKV GGGK A
Sbjct  17   ESLLDKITEKIHAHDSSSSDSDDDKGDASAS----IKSKIYRLFGRERPVHKVFGGGKPA  72

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            D+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI KS
Sbjct  73   DIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFINKS  132



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVHKVLGGGK ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LI
Sbjct  59   RLFGRERPVHKVLGGGKPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLI  118

Query  435  LALAVLFLWSNASSFIKK  488
            L LA+LFLWSNA++FI K
Sbjct  119  LGLAILFLWSNATTFIHK  136



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 104/143 (73%), Gaps = 10/143 (7%)
 Frame = +3

Query  96   ESAMAEE---DRKEEESLVEKIADKIHR-------HdsssssdsekeeeekkkttssMDA  245
            ES +A E   +  E ESL++KI++KIH          SS   D +K+ ++    +SSM +
Sbjct  9    ESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKS  68

Query  246  XVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCH  425
             V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH
Sbjct  69   KVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCH  128

Query  426  GLILALAVLFLWSNASSFIKKSA  494
             +I+ LAVLFLWSNA+ FI KS 
Sbjct  129  VMIVVLAVLFLWSNATMFINKSP  151



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KIA+KIH H  SSSS     E+++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  1    ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  57

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  58   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  117

Query  492  A  494
             
Sbjct  118  P  118



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +3

Query  105  MAEEDRKEE--ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQP  278
            MAE D+ +   ES+ EKI++KIH     SSS S+ + E+ K    S+ + + RLFGR++P
Sbjct  1    MAEHDKDDSVVESVTEKISEKIHG--HDSSSGSDSDHEKSKSNPDSLKSKIYRLFGREKP  58

Query  279  VHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFL  458
            VHKVLGGGK ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFL
Sbjct  59   VHKVLGGGKPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFL  118

Query  459  WSNASSFIKKSA  494
            WSNAS+FI KS 
Sbjct  119  WSNASTFINKSP  130



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESL++KIA+KIH H  SSSS     E+++  +   +   V RLFGR++PVH VLGGGK A
Sbjct  15   ESLLDKIAEKIHGHHDSSSSSDSDSEKKETSS---IKEKVFRLFGREKPVHSVLGGGKPA  71

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI K+
Sbjct  72   DVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIHKA  131

Query  492  A  494
             
Sbjct  132  P  132



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 99/126 (79%), Gaps = 3/126 (2%)
 Frame = +3

Query  126  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLG  296
            E ESL+EK+++KIH      SSSSS  ++ E++   +  S+ + V RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGGDSSSSSSSDDENEKKSSSSPRSLKSKVYRLFGRERPVHKVLG  81

Query  297  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  476
            GGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  477  FIKKSA  494
            FI KS 
Sbjct  142  FIHKSP  147



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  465  NASSFIKKSA  494
            +A++FI K+ 
Sbjct  115  SATTFIHKTP  124



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +3

Query  126  EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            E  SL++KI++KIH H   SSS S+ E E+K  + SSM + V RLFGR++PVHKVLGGGK
Sbjct  68   ERGSLMDKISEKIH-HKGDSSSSSDDESEKKPSSPSSMKSKVYRLFGRERPVHKVLGGGK  126

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA+ FI+
Sbjct  127  PADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIR  186

Query  486  KSA  494
            KS 
Sbjct  187  KSP  189



>ref|XP_002317731.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
 gb|EEE95951.1| hypothetical protein POPTR_0012s00980g [Populus trichocarpa]
Length=240

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 9/133 (7%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + + + RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKIFRLFGREK  54

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I +LAVLF
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFSLAVLF  114

Query  456  LWSNASSFIKKSA  494
            LWSN S F+ K  
Sbjct  115  LWSNTSDFLNKPP  127



>ref|XP_006402470.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
 gb|ESQ43923.1| hypothetical protein EUTSA_v10006190mg [Eutrema salsugineum]
Length=253

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            E+    EESL+EKIA+KI       SS S + E EK  + S++ A + RLFGR++PVHKV
Sbjct  6    EKSVPTEESLIEKIAEKI---HDHDSSSSSESEHEKPDSPSALKAKIYRLFGREKPVHKV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALAVLFL SNA
Sbjct  63   LGGGLPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFALAVLFLLSNA  122

Query  471  SSFIKKSA  494
             +F+KKS 
Sbjct  123  HAFMKKSP  130



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = +3

Query  114  EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVL  293
            E   E ESL+EKIADKIH HDSSSSSDS+ ++  K +    + A + RLFGR++P+HKVL
Sbjct  3    EHAGEPESLIEKIADKIHGHDSSSSSDSDDDKPSKVEE---VQAKIFRLFGREKPIHKVL  59

Query  294  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  473
            GGGK ADVFLWRNKK+S GVLGGAT +W+LFE+LEYHL+T VCH LIL+LA+LFLWSNAS
Sbjct  60   GGGKPADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFLWSNAS  119

Query  474  SFIKKSA  494
            + I KS 
Sbjct  120  TLINKSP  126



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeek-kkttssMDAXVRRLFGRQQPVHK  287
            EE     +S+++K++DK+H    SSSS S+ ++E+K   + ++M + + RLFGR++PVH 
Sbjct  6    EESESVVQSMMDKVSDKLHGSGDSSSSSSDSDDEKKGSSSAAAMKSKIYRLFGREKPVHS  65

Query  288  VLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSN  467
            VLGGGK AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSN
Sbjct  66   VLGGGKPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSN  125

Query  468  ASSFIKKSA  494
            A +FI KS 
Sbjct  126  ACTFINKSP  134



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 97/127 (76%), Gaps = 4/127 (3%)
 Frame = +3

Query  126  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVL  293
            E ESL+EK+++KIH       SSSS +  +++     +  S+ + V RLFGR++PVHKVL
Sbjct  18   ERESLMEKLSEKIHHKGDSSSSSSSDEENEKKTSSSSSPRSLKSKVYRLFGRERPVHKVL  77

Query  294  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  473
            GGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+
Sbjct  78   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNAT  137

Query  474  SFIKKSA  494
             FI KS 
Sbjct  138  MFIHKSP  144



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQ  308
            E SL+EK  +KIH  D  S+S S   +++K     S  + V RLFGR++PVHKVLGGGK 
Sbjct  10   EPSLMEKNTEKIHVPDPPSASSSSDSDDDKPSVVDSAKSKVYRLFGREKPVHKVLGGGKP  69

Query  309  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  488
            AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++AS+ I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  489  SA  494
            S 
Sbjct  130  SP  131



>gb|KJB24286.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=152

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  465  NASSFIKKSA  494
            NA++FI KS 
Sbjct  118  NAATFIHKSP  127



>emb|CDY08353.1| BnaC09g12430D [Brassica napus]
Length=250

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIYRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+ +Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELFQYNLLTLFGHISILALAVLFLWS  114

Query  465  NASSFIKKSA  494
            +AS+FI K  
Sbjct  115  SASTFIHKKP  124



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH HD+SSSSDS+ E++        +   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKIHGHDNSSSSDSDDEKKASS-----IKTKIFRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  465  NASSFIKKSA  494
            +A++FI K  
Sbjct  115  SATTFIHKKP  124



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 106/151 (70%), Gaps = 21/151 (14%)
 Frame = +3

Query  105  MAEEDRKEE--------------ESLVEKIADKIHR-------Hdsssssdsekeeeekk  221
            MAEE + EE              ESL++KI++KIH          SSS  + +K++++K 
Sbjct  1    MAEEHKHEESVTALEPAVEVVERESLMDKISEKIHHGGGSSSSSSSSSDDEDDKKKKKKP  60

Query  222  kttssMDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEY  401
             + SSM + V RLFGR++PVHKVLGGGK A++F+W+NKK+S GVLG ATA W+LFE++EY
Sbjct  61   SSPSSMQSKVYRLFGREKPVHKVLGGGKPAEIFMWKNKKMSGGVLGAATAAWVLFELMEY  120

Query  402  HLLTAVCHGLILALAVLFLWSNASSFIKKSA  494
            HLLT +CH +I+ LAVLFLWSNA+ FI KS 
Sbjct  121  HLLTLLCHVMIVVLAVLFLWSNATMFINKSP  151



>ref|XP_011073415.1| PREDICTED: reticulon-like protein B1 isoform X2 [Sesamum indicum]
Length=172

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 9/128 (7%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            +E+ K++ESL+EKIADK+H HDSSSSS S   +++K  +   + A V RLFGR++PVH+V
Sbjct  6    KEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXXXX------GGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  471  SSFIKKSA  494
             +FI KS 
Sbjct  117  MTFINKSP  124



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 100/142 (70%), Gaps = 14/142 (10%)
 Frame = +3

Query  105  MAEEDRKEE------------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAX  248
            MAEE + EE            ES++EKIA+KIH H  SSSS S   +++KK ++  +   
Sbjct  1    MAEEHKHEESIMEKIAEKIHEESIMEKIAEKIHGHGDSSSSSSSDSDDDKKSSS--LKTK  58

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QPVHKV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H 
Sbjct  59   VYRLFGREQPVHKVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHI  118

Query  429  LILALAVLFLWSNASSFIKKSA  494
             IL LAVLFLWS+AS+FI K+ 
Sbjct  119  SILTLAVLFLWSSASTFIHKTT  140



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 9/133 (7%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE + + E   ESLV+KI +KI  HDSSSSSDS+ E+ +       + + V RLFGR++
Sbjct  1    MAEHEGQRESAAESLVDKITEKISGHDSSSSSDSDNEKFDA------VKSKVFRLFGRER  54

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGGK ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLF
Sbjct  55   PVHKVLGGGKPADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLF  114

Query  456  LWSNASSFIKKSA  494
            LWSN S F+ K  
Sbjct  115  LWSNTSDFLNKPP  127



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 89/121 (74%), Gaps = 5/121 (4%)
 Frame = +3

Query  132  ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGGKQA  311
            ESLV+KI +KIH HDSSSSS    ++         + A + RLFGR++ VH +LGGGK A
Sbjct  3    ESLVDKIVEKIHAHDSSSSSSDSDDDRRSS-----LKAKINRLFGRERSVHGLLGGGKAA  57

Query  312  DVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKS  491
            DV LWRNK +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+WSN S+F+KKS
Sbjct  58   DVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNGSTFLKKS  117

Query  492  A  494
             
Sbjct  118  P  118



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QPVHKVLGGGK AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH 
Sbjct  67   VYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHV  126

Query  429  LILALAVLFLWSNASSFIKKSA  494
            +I+ LAVLFLWSNA+ FI KS 
Sbjct  127  MIVVLAVLFLWSNATMFINKSP  148



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR++PVHKVLGGGK AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH 
Sbjct  62   VYRLFGRERPVHKVLGGGKPADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHV  121

Query  429  LILALAVLFLWSNASSFIKKSA  494
            +I+ALAVLFLWSNA+ FI KS 
Sbjct  122  MIVALAVLFLWSNATMFIHKSP  143



>ref|NP_191715.2| reticulon-like protein B6 [Arabidopsis thaliana]
 sp|Q6DBN4.1|RTNLF_ARATH RecName: Full=Reticulon-like protein B6; Short=AtRTNLB6 [Arabidopsis 
thaliana]
 gb|AAT70439.1| At3g61560 [Arabidopsis thaliana]
 gb|AAV85700.1| At3g61560 [Arabidopsis thaliana]
 gb|AEE80222.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=253

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRK---EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ A + RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALA LF
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALF  117

Query  456  LWSNASSFIKKSA  494
            L SNA +F+ K+ 
Sbjct  118  LLSNAHAFMNKTP  130



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +3

Query  126  EEESLVEKIADKIH-RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLGGG  302
            E +S V+ + DK++ +  S   S    +++ KK   +++   + RLFGR++PVHKVLGGG
Sbjct  7    ENDSFVDSVTDKVNDKFHSHDYSSDSDDDKGKKSPVNAVKTKIYRLFGREKPVHKVLGGG  66

Query  303  KQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFI  482
            K ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+FI
Sbjct  67   KPADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFI  126

Query  483  KKSA  494
              + 
Sbjct  127  NTAP  130



>gb|KJB52681.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=129

 Score =   128 bits (321),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            +CH +ILAL+VLFLWSNAS+FI KS 
Sbjct  102  ICHLMILALSVLFLWSNASNFINKSC  127



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 9/138 (7%)
 Frame = +3

Query  105  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAXVRRL  260
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + A V R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  261  FGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  440
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  441  LAVLFLWSNASSFIKKSA  494
            LA+LFLWSNA +FI K+ 
Sbjct  120  LAILFLWSNAHTFIHKTP  137



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            EE+L+E++ +KI     SSSS     E+ +    T ++ + + RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  486  KSA  494
            KS 
Sbjct  126  KSP  128



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 9/138 (7%)
 Frame = +3

Query  105  MAEEDR-----KEEESLVEKIADKIH---RHdsssssdsekeeeekkkttssMDAXVRRL  260
            MA+E       + E SL+EKI +KIH   RH SSSSS    +E+ +KK  S + A V R+
Sbjct  1    MADEKNAGSPVEHEPSLLEKIGEKIHGGDRHSSSSSSSDSDDEKSEKKAES-VKAKVFRI  59

Query  261  FGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILA  440
            FGR++PVH VLGGGK ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  
Sbjct  60   FGREKPVHHVLGGGKSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIAT  119

Query  441  LAVLFLWSNASSFIKKSA  494
            LA+LFLWSNA +FI K+ 
Sbjct  120  LAILFLWSNAHTFIHKTP  137



>gb|AFK42129.1| unknown [Medicago truncatula]
Length=199

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekee---eekkkttssMDAXVRRLFG  266
            MA+ +  EE   ESL++KI+ KIH H  SSSS S+ +    E+K  + +S+   V RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  267  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  446
            R++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  447  VLFLWSNASSFIKKSA  494
            VLFLWSNAS+FI KS 
Sbjct  121  VLFLWSNASTFINKSP  136



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K  E + E + +KIH HDSSSSS+SE E+ +       + A + RLFGR++PVH
Sbjct  1    MAEEIEKSVE-VEESLMEKIHHHDSSSSSESEYEKPDSPSA---VKAKIYRLFGREKPVH  56

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KVLGGGK ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWS
Sbjct  57   KVLGGGKPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWS  116

Query  465  NASSFIKKSA  494
            NA +FIKKS 
Sbjct  117  NAHTFIKKSP  126



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 3/126 (2%)
 Frame = +3

Query  126  EEESLVEKIADKIHRH---dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVLG  296
            E ESL+EK+++KIH      SSSSSD E E++    +  S+ + V RLFGR++PVHKVLG
Sbjct  22   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLG  81

Query  297  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  476
            GGK AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ 
Sbjct  82   GGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATM  141

Query  477  FIKKSA  494
            FI KS 
Sbjct  142  FIHKSP  147



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +3

Query  126  EEESLVEKIADKIHRH----dsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKVL  293
            E ESL+EK+++KIH       SSSS D  +++     +  S+ + V RLFGR++PVHKVL
Sbjct  23   ERESLMEKLSEKIHHKGDSSSSSSSDDENEKKPSSSSSPRSLKSKVYRLFGRERPVHKVL  82

Query  294  GGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNAS  473
            GGGK AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA+
Sbjct  83   GGGKPADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNAT  142

Query  474  SFIKKSA  494
             FI KS 
Sbjct  143  MFIHKSP  149



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 103/128 (80%), Gaps = 5/128 (4%)
 Frame = +3

Query  126  EEESLVEKIADKIHR-----HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            E ESL++KI++KIH        SSSSSD EKE++EK  + SSM + V RLFGR++PVHKV
Sbjct  23   ERESLMDKISEKIHHGGGDSSSSSSSSDDEKEKKEKPSSPSSMKSKVYRLFGREKPVHKV  82

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA
Sbjct  83   LGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNA  142

Query  471  SSFIKKSA  494
            + FI KS 
Sbjct  143  TMFIHKSP  150



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 9/128 (7%)
 Frame = +3

Query  111  EEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVHKV  290
            +E+ K++ESL+EKIADK+H HDSSSSS S   +++K  +   + A V RLFGR++PVH+V
Sbjct  6    KEEEKKDESLIEKIADKVHGHDSSSSSSSSDSDDDKTSS---LKAKVYRLFGREKPVHRV  62

Query  291  LGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNA  470
            LGGGK AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+ 
Sbjct  63   LGGGKPADIFLWXXXX------GGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSI  116

Query  471  SSFIKKSA  494
             +FI KS 
Sbjct  117  MTFINKSP  124



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KIH       S S   + +  K ++S+   + RLFGR+QP+H
Sbjct  1    MAEE-HKHEESIMEKIAEKIHG--HDDGSSSSSSDSDDDKKSASLKTKIYRLFGREQPLH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS
Sbjct  58   KVFGGGKPADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWS  117

Query  465  NASSFIKKSA  494
            +A++FI KS 
Sbjct  118  SATTFIHKSP  127



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + + RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VC
Sbjct  43   SKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVC  102

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            H LIL+LAV FLWS AS+FI KS 
Sbjct  103  HLLILSLAVFFLWSYASTFINKSP  126



>gb|KJB24287.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=208

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  465  NASSFIKKSA  494
            NA++FI KS 
Sbjct  118  NAATFIHKSP  127



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++PVHKVLGGGK ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LI
Sbjct  58   RLFGREKPVHKVLGGGKPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLI  117

Query  435  LALAVLFLWSNASSFIKKSA  494
            L+LAV FLWS AS+FI KS 
Sbjct  118  LSLAVFFLWSYASTFINKSP  137



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  3    RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  62

Query  435  LALAVLFLWSNASSFIKKSA  494
             +L VLFLWSNASSFI KS 
Sbjct  63   FSLGVLFLWSNASSFINKSP  82



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssds---ekeeeekkkttssMDAXVRRLFG  266
            MA+ +  EE   ESL++KI+ KIH H  SSSS S     ++E+K  + +S+   V RLFG
Sbjct  1    MADHNEHEEVKSESLLDKISGKIHDHHDSSSSSSDSDNDKKEKKVSSPTSLKNKVFRLFG  60

Query  267  RQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALA  446
            R++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALA
Sbjct  61   REKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALA  120

Query  447  VLFLWSNASSFIKKSA  494
            VLFLWSNAS+FI KS 
Sbjct  121  VLFLWSNASTFINKSP  136



>gb|KJB19086.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=214

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  118  SNATQFINKST  128



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + + + RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKS  491
            VCH LIL+LAV +LWSNAS+FI KS
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKS  126



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + + + RLFGR++PVHKVLGGGK ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T 
Sbjct  42   VKSKIFRLFGREKPVHKVLGGGKPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKS  491
            VCH LIL+LAV +LWSNAS+FI KS
Sbjct  102  VCHLLILSLAVFYLWSNASNFINKS  126



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            + RLFGR++ VH VLGGGK AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH 
Sbjct  53   IYRLFGRERDVHSVLGGGKTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHC  112

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LIL+LA+LFLWSNAS+FI KS 
Sbjct  113  LILSLAILFLWSNASTFINKSP  134



>ref|NP_001030913.1| reticulon-like protein B6 [Arabidopsis thaliana]
 emb|CAB71086.1| putative protein [Arabidopsis thaliana]
 gb|AEE80223.1| reticulon-like protein B6 [Arabidopsis thaliana]
Length=264

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 6/131 (5%)
 Frame = +3

Query  105  MAEEDRK---EEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAEE  K   +EESL+EKIADKI       SS S   E EK ++ S++ A + RLFGR++
Sbjct  1    MAEELEKSMHKEESLMEKIADKI---HDHDSSSSSDSEHEKPESPSALKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVHKVLGGG  ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI ALA LF
Sbjct  58   PVHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALF  117

Query  456  LWSNASSFIKK  488
            L SNA +F+ K
Sbjct  118  LLSNAHAFMNK  128



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAX--VRRLFGRQ  272
            MAE  ED K E  L+EK+ +KIH H  SSSS S   + EK K  +       V RLFGR+
Sbjct  1    MAEHGEDAKAEHGLMEKMTEKIHDHHDSSSSSSSDSDTEKPKPAAEESPKEKVFRLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVH VLGGGK ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+
Sbjct  61   RPVHHVLGGGKPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVM  120

Query  453  FLWSNASSFIKKSA  494
            FLWSNA +   K+A
Sbjct  121  FLWSNAHTIFHKTA  134



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR+QP+HKVLGGGK ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  84   RLFGREQPIHKVLGGGKPADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALI  143

Query  435  LALAVLFLWSNASSFIKKSA  494
             +L VLFLWSNASSFI KS 
Sbjct  144  FSLGVLFLWSNASSFINKSP  163



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M++ + K EESL+EKI++K+  HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKVKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  465  NASSFIKKSA  494
            NA++FI KS 
Sbjct  118  NAATFIHKSP  127



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE D+  E+S++E + +K+H H++SS SDS+  + + +  +  + + + RLFGR++PVH
Sbjct  1    MAEHDK--EDSVIESVMEKVHDHETSSDSDSDHGKPKSESDS--LKSKIYRLFGREKPVH  56

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KVLGGGK AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWS
Sbjct  57   KVLGGGKPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWS  116

Query  465  NASSFIKKSA  494
            NAS+FI KS 
Sbjct  117  NASTFINKSP  126



>gb|KJB19089.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=212

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  118  SNATQFINKST  128



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            + RLFGR++P+HKVLGGGK AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH 
Sbjct  49   IYRLFGREKPLHKVLGGGKPADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHI  108

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI+A+AVLFLWSNAS+FI  + 
Sbjct  109  LIVAVAVLFLWSNASAFINTAP  130



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            + + RLFGR++PVHKVLGGGK ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T VC
Sbjct  57   SKIFRLFGREKPVHKVLGGGKPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITLVC  116

Query  423  HGLILALAVLFLWSNASSFIKKS  491
            H LI  LAV +LWSNAS+FI KS
Sbjct  117  HLLITFLAVFYLWSNASNFINKS  139



>ref|XP_004980276.1| PREDICTED: uncharacterized protein LOC101782657, partial [Setaria 
italica]
Length=348

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR+QP+HK LGGGK ADV LWRN+ IS GVL G TAIWILFE L YHLLT  CHG
Sbjct  47   VFRLFGREQPIHKALGGGKPADVLLWRNRNISAGVLDGVTAIWILFECLGYHLLTFNCHG  106

Query  429  LILALAVLFLWSNASSFIKKSA  494
            LI +L VLFLWSNASSFI KS 
Sbjct  107  LIFSLGVLFLWSNASSFINKSP  128



>gb|KJB19088.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=254

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  118  SNATQFINKST  128



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = +3

Query  105  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkk---ttssMDAXVRRLFGR  269
            MAE  ++ K  ESL++K+ DKIH HDSSS+    +   +K      ++S+ + V RLFGR
Sbjct  1    MAEHADEVKAAESLLDKVPDKIHGHDSSSALPPSEAVRDKGIGGGYSASLKSKVNRLFGR  60

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVH V GGGK AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +
Sbjct  61   EKPVHHVFGGGKAADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVM  120

Query  450  LFLWSNASSFIKKSA  494
            LFLWSNAS+FI KS 
Sbjct  121  LFLWSNASTFINKSP  135



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  249  VRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHG  428
            V RLFGR++P+H VLGGGK ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H 
Sbjct  32   VFRLFGREKPLHNVLGGGKPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHL  91

Query  429  LILALAVLFLWSNASSFIKKSA  494
             ILALAVLFLWSNAS+FI KS 
Sbjct  92   AILALAVLFLWSNASTFINKSP  113



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  118  SNATQFINKST  128



>gb|KJB52680.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=142

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKK  488
            +CH +ILAL+VLFLWSNAS+FI K
Sbjct  102  ICHLMILALSVLFLWSNASNFINK  125



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR+QP+HKVLGGGK ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H LI
Sbjct  88   RLFGREQPIHKVLGGGKPADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGHALI  147

Query  435  LALAVLFLWSNASSFIKKSA  494
             +L VLFLWSNASSFI KS 
Sbjct  148  FSLGVLFLWSNASSFINKSP  167



>gb|KJB52682.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=183

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            +CH +ILAL+VLFLWSNAS+FI  S 
Sbjct  102  ICHLMILALSVLFLWSNASNFINNSP  127



>gb|KJB19091.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=241

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = +3

Query  105  MAE-EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            MAE E++K+EESL+EKIA+KIH HDSSSSS    +++  + +   +   V RLFGR++PV
Sbjct  1    MAEHEEKKQEESLMEKIAEKIHGHDSSSSSSDSDDDKPSESS---IKDKVFRLFGREKPV  57

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            H V GGGK AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLW
Sbjct  58   HHVFGGGKPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLW  117

Query  462  SNASSFIKKSA  494
            SNA+ FI KS 
Sbjct  118  SNATQFINKST  128



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  243  AXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVC  422
            A V RLFGR++PVH+VLGGGK ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VC
Sbjct  46   AKVYRLFGREKPVHQVLGGGKSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVC  105

Query  423  HGLILALAVLFLWSNASSFIKKSA  494
            HGLIL+L +LFLWS A +FI KS 
Sbjct  106  HGLILSLVILFLWSKACTFINKSP  129



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +3

Query  129  EESLVEKIADKIHRHdsssssdsek-eeeekkkttssMDAXVRRLFGRQQPVHKVLGGGK  305
            EE+L+E++ +KI     SSSS     E+ +    T ++ + + RLFGR++PVH++LGGGK
Sbjct  6    EETLIEQVTEKIRDGVDSSSSSDSDDEKSKASVVTEAVKSKINRLFGREKPVHQILGGGK  65

Query  306  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  485
             ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I 
Sbjct  66   PADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLIN  125

Query  486  KSA  494
              +
Sbjct  126  NRS  128



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 3/130 (2%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            M++ + K EESL+EKI++K   HD SSSS    +++  + +   M A V RLFGR++PVH
Sbjct  1    MSDHEDKHEESLLEKISEKNKGHDLSSSSSDSDDDKPSESS---MKAKVFRLFGRERPVH  57

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
             V GGGKQAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWS
Sbjct  58   DVFGGGKQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWS  117

Query  465  NASSFIKKSA  494
            NA++FI KS 
Sbjct  118  NAATFIHKSP  127



>gb|KJB52679.1| hypothetical protein B456_008G272900 [Gossypium raimondii]
Length=247

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            +CH +ILAL+VLFLWSNAS+FI  S 
Sbjct  102  ICHLMILALSVLFLWSNASNFINNSP  127



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  105  MAEEDR---KEEESLVEKIADKIH--RHdsssssdsekeeeekkkttssMDAXVRRLFGR  269
            MAE++      +ES V+KI DK+H    DSSSSS S   + + KKTT++  + V+   GR
Sbjct  1    MAEQEEITDPGQESFVDKITDKLHGSNDDSSSSSSSSDSDSDAKKTTAAPPSPVKEEIGR  60

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVHKV GGGK AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++
Sbjct  61   EKPVHKVFGGGKPADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSM  120

Query  450  LFLWSNASSFIKK  488
            LFLWSN + FI K
Sbjct  121  LFLWSNVTIFINK  133



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +3

Query  126  EEESLVEKIADKIH-------RHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            E +S VE + DK++        HDSSSSSDSE E ++ K    +  A + RLFGR++PVH
Sbjct  7    EHDSFVETVMDKVNVDKLHVAHHDSSSSSDSEDENKDTKSPVDADKAKIYRLFGRERPVH  66

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KVLGGGK A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VCH LI+A+ VLFLWS
Sbjct  67   KVLGGGKPAEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAITVLFLWS  126

Query  465  NASSFIKKSA  494
            NAS+FI  + 
Sbjct  127  NASAFINTAP  136



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 8/131 (6%)
 Frame = +3

Query  126  EEESLVEKIADKIHR--------HdsssssdsekeeeekkkttssMDAXVRRLFGRQQPV  281
            E ESL++KI++KIH           S    D   +++EK  + SSM + V RLFGR++PV
Sbjct  22   ERESLMDKISEKIHHGGDSSSSSSSSDEEDDKNDKKKEKPSSPSSMKSKVYRLFGREKPV  81

Query  282  HKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLW  461
            HKVLGGGK AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLW
Sbjct  82   HKVLGGGKPADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLW  141

Query  462  SNASSFIKKSA  494
            SN + FI KS 
Sbjct  142  SNVTRFIHKSP  152



>gb|KHF99856.1| Reticulon-like protein B1 [Gossypium arboreum]
Length=174

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A V RLFGR++P+H+VLG GK AD+ LWRNKK+S GVLGG T++W LFE+L+YHL+T 
Sbjct  42   LKAKVYRLFGREKPLHQVLGAGKPADILLWRNKKLSGGVLGGVTSLWFLFEMLDYHLITL  101

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            +CH +ILAL+VLFLWSN S+FI  S 
Sbjct  102  ICHLMILALSVLFLWSNVSNFINNSP  127



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = +3

Query  123  KEEESLVEKIADKIHRHdsssssdseke--eeekkkttssMDAXVRRLFGRQQPVHKVLG  296
            ++E SL+EK+ DKIH  D  SSS S  +   E+ +K T S+ A V R+FGR++PVH VLG
Sbjct  13   EDEPSLLEKMGDKIHGGDHHSSSSSSSDSDNEKSEKKTESVKAKVFRIFGRERPVHHVLG  72

Query  297  GGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASS  476
            GGK ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA +
Sbjct  73   GGKXADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHA  132

Query  477  FIKKSA  494
            FI K+ 
Sbjct  133  FIHKTP  138



>gb|AFK48295.1| unknown [Lotus japonicus]
Length=193

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 95/137 (69%), Gaps = 13/137 (9%)
 Frame = +3

Query  105  MAEEDRKEE-------ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLF  263
            MAEE  +         ESL++KI+DK+H HDSSS SDSEK           +   + RLF
Sbjct  1    MAEESAESTVTTAATGESLLDKISDKLHGHDSSSDSDSEKPSLSS------VKQKIFRLF  54

Query  264  GRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILAL  443
            GR++P+H VLGGGK ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++
Sbjct  55   GREKPLHSVLGGGKPADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSI  114

Query  444  AVLFLWSNASSFIKKSA  494
             +LFLWSNA + + K+ 
Sbjct  115  TLLFLWSNAHTLLHKAP  131



>emb|CAN77759.1| hypothetical protein VITISV_034907 [Vitis vinifera]
Length=245

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++P+HKVLGGGK ADVFLWRNKKIS  VLG ATAIW+LFE+LEY LL  +CH L+
Sbjct  51   RLFGREKPLHKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILM  110

Query  435  LALAVLFLWSNASSFIKKSA  494
            L+LA LFLWSNAS  IKKS 
Sbjct  111  LSLASLFLWSNASIVIKKSP  130



>gb|KDO86332.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=213

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  465  NASSFIKKSA  494
            NA +FIKK+ 
Sbjct  120  NAHTFIKKAP  129



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 6/135 (4%)
 Frame = +3

Query  108  AEEDRKEEESLVEKIADKIH------RHdsssssdsekeeeekkkttssMDAXVRRLFGR  269
            AE+  K+EE+L+EK A+K+H         SS S   +K + +   + +S+   + RLFGR
Sbjct  5    AEDLDKKEETLIEKPAEKVHGDHDSSSSASSESDSEKKVKSKPASSPTSVKDKIFRLFGR  64

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVH+V GGGK ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+
Sbjct  65   EKPVHQVFGGGKPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAI  124

Query  450  LFLWSNASSFIKKSA  494
            LFLWSNA++FI KS 
Sbjct  125  LFLWSNATTFINKSP  139



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  465  NASSFIKKSA  494
            NA +FIKK+ 
Sbjct  120  NAHTFIKKAP  129



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAE +    E  +EK+++KIH    SSSS S   + E+    SS+ A + RLFGR++PVH
Sbjct  1    MAEREENPAEPPMEKVSEKIHD-HDSSSSSSSDSDNEEPAAQSSVKADIYRLFGRERPVH  59

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            +V GGGK ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+
Sbjct  60   QVFGGGKPADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWA  119

Query  465  NASSFIKKSA  494
            NA +FIKK+ 
Sbjct  120  NAHTFIKKAP  129



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  255  RLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLI  434
            RLFGR++P+HKVLGGGK ADVFLWRNKKIS  VLG ATAIW+LFE+LEY LL  +CH L+
Sbjct  51   RLFGREKPLHKVLGGGKPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILM  110

Query  435  LALAVLFLWSNASSFIKKSA  494
            L+LA LFLWSNAS  IKKS 
Sbjct  111  LSLASLFLWSNASIVIKKSP  130



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = +3

Query  105  MAE--EDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkt--tssMDAXVRRLFGRQ  272
            MAE  E+ K  ESL++KIADKIH HDS  S   E   E+   +   +S+ A    LFGR+
Sbjct  1    MAEHTEEVKAAESLMDKIADKIHGHDSPVSPAVESLHEKAVSSGHAASLKAKAYSLFGRE  60

Query  273  QPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVL  452
            +PVH V GGGK ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+L
Sbjct  61   KPVHNVFGGGKAADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAML  120

Query  453  FLWSNASSFIKKSA  494
            FLWSNAS+FI KS 
Sbjct  121  FLWSNASTFINKSP  134



>gb|AFK34557.1| unknown [Medicago truncatula]
 gb|KEH18780.1| seed maturation protein [Medicago truncatula]
Length=267

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 90/135 (67%), Gaps = 2/135 (1%)
 Frame = +3

Query  96   ESAMAEEDRKEEESLVEKIADKIHRHdsssssdsekeeee--kkkttssMDAXVRRLFGR  269
            E +    DR   +SL+EKI +K+H  D SSS        E  KK    S+   V RLFGR
Sbjct  6    EKSTVTVDRDGGDSLLEKITEKLHFEDDSSSDSDSHSHSELDKKPVIESVKEKVFRLFGR  65

Query  270  QQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAV  449
            ++PVH VLGGGK ADVFLW+NKK+S G L  ATAIW+ FE+LEYH LT +CH  IL LA+
Sbjct  66   EKPVHSVLGGGKPADVFLWKNKKLSAGTLATATAIWVFFELLEYHFLTLICHISILVLAL  125

Query  450  LFLWSNASSFIKKSA  494
            LFLWSNA +F+ K+ 
Sbjct  126  LFLWSNAHTFVHKTP  140



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 6/130 (5%)
 Frame = +3

Query  105  MAEEDRKEEESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQPVH  284
            MAEE  K EES++EKIA+KI          S   + + +K  SS+   + RLFGR++PVH
Sbjct  1    MAEE-HKHEESIMEKIAEKI-----HGHDGSSSSDSDDEKKASSIKTKIFRLFGREKPVH  54

Query  285  KVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWS  464
            KV GGGK AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS
Sbjct  55   KVFGGGKPADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWS  114

Query  465  NASSFIKKSA  494
            +A++FI K  
Sbjct  115  SATTFIHKKP  124



>gb|EMT06999.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=248

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 7/133 (5%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE   KEE   ES+++KI+DK H     SSS S   +++KK   + + A + RLFGR++
Sbjct  1    MAE--HKEEPVAESMMDKISDKFH--GGDSSSSSSDSDDDKKGPAAGVKAKIYRLFGREK  56

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK AD+ LWRNKK+S GVL GATAIW+LFEV+EYHLLT V H LIL+LA LF
Sbjct  57   PVHAVLGGGKPADLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLF  116

Query  456  LWSNASSFIKKSA  494
            L+SN   FI KS 
Sbjct  117  LYSNVCIFIHKSP  129



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +3

Query  105  MAEEDRKEE---ESLVEKIADKIHRHdsssssdsekeeeekkkttssMDAXVRRLFGRQQ  275
            MAE   KEE   ES+++KI+DK H     SSS S   ++EKK + + + A + RLFGR++
Sbjct  1    MAE--HKEEPVAESMMDKISDKFHG-GGDSSSSSSDSDDEKKGSAAGVKAKIYRLFGREK  57

Query  276  PVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLF  455
            PVH VLGGGK AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V H LIL+LA LF
Sbjct  58   PVHAVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLF  117

Query  456  LWSNASSFIKKSA  494
            L+SN   F+ KS 
Sbjct  118  LYSNVCIFVHKSP  130



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  237  MDAXVRRLFGRQQPVHKVLGGGKQADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTA  416
            + A + RLFGR++PVH+VLGGGK ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT 
Sbjct  46   VKAKIFRLFGREKPVHQVLGGGKPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTL  105

Query  417  VCHGLILALAVLFLWSNASSFIKKSA  494
            VC+ LI++LA+LFLWSNA +FI KS 
Sbjct  106  VCYTLIVSLAILFLWSNAHTFIHKSP  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190