BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030H04

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001275472.1|  alpha-tubulin-like protein                         254   3e-82   Solanum tuberosum [potatoes]
gb|ACU18775.1|  unknown                                                 251   1e-81   Glycine max [soybeans]
gb|ACN40426.1|  unknown                                                 255   2e-81   Picea sitchensis
gb|ACU24494.1|  unknown                                                 250   2e-81   Glycine max [soybeans]
emb|CBI29424.3|  unnamed protein product                                254   2e-81   Vitis vinifera
ref|XP_001786415.1|  predicted protein                                  248   2e-81   
gb|ABE66388.1|  alpha-tubulin                                           250   3e-81   Striga asiatica [witchweed]
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     254   3e-81   
gb|AAN33000.1|  alpha-tubulin 4                                         253   8e-81   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          256   1e-80   
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               248   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    256   2e-80   Brassica rapa
emb|CBI22190.3|  unnamed protein product                                255   2e-80   Vitis vinifera
ref|WP_039310890.1|  hypothetical protein                               256   2e-80   
gb|ABF13307.1|  alpha-tubulin                                           246   2e-80   Phaseolus vulgaris [French bean]
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     256   3e-80   
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   254   3e-80   Citrus sinensis [apfelsine]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    255   3e-80   
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     255   3e-80   
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            246   5e-80   
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        256   5e-80   Brassica rapa
emb|CBI19330.3|  unnamed protein product                                254   6e-80   Vitis vinifera
tpg|DAA51110.1|  TPA: alpha-tubulin                                     248   6e-80   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    255   6e-80   
emb|CBI25125.3|  unnamed protein product                                253   6e-80   Vitis vinifera
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        255   6e-80   Tarenaya hassleriana [spider flower]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        254   7e-80   
emb|CDY25017.1|  BnaC02g39910D                                          254   8e-80   Brassica napus [oilseed rape]
emb|CDY66630.1|  BnaCnng51680D                                          254   9e-80   Brassica napus [oilseed rape]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    255   1e-79   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             254   1e-79   Populus trichocarpa [western balsam poplar]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         254   1e-79   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           254   1e-79   Betula pendula [white birch]
gb|AGG37287.1|  alpha-tubulin 5                                         254   1e-79   Salix arbutifolia
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             254   1e-79   Citrus clementina [clementine]
gb|ABK92552.1|  unknown                                                 254   1e-79   Populus trichocarpa [western balsam poplar]
gb|AAX21196.1|  putative alpha-tubulin                                  246   1e-79   Solanum betaceum [tamarillo]
gb|AHJ80818.1|  Tua1                                                    249   1e-79   Eragrostis tef [tef]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             254   1e-79   Prunus persica
gb|AGG37285.1|  alpha-tubulin 3                                         254   1e-79   Salix arbutifolia
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     254   1e-79   Eucalyptus grandis [rose gum]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             254   1e-79   Selaginella moellendorffii
ref|XP_002510010.1|  tubulin alpha chain, putative                      254   1e-79   Ricinus communis
gb|AAV92352.1|  alpha tubulin 1                                         254   1e-79   Pseudotsuga menziesii var. menziesii
ref|NP_849388.1|  tubulin alpha-6 chain                                 254   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                254   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              254   1e-79   Theobroma cacao [chocolate]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   254   1e-79   Populus euphratica
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    254   1e-79   Tarenaya hassleriana [spider flower]
gb|ABX57816.1|  alpha tubulin                                           254   1e-79   Picea wilsonii
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                254   1e-79   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          254   1e-79   Tarenaya hassleriana [spider flower]
ref|XP_002522104.1|  tubulin alpha chain, putative                      254   2e-79   Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              254   2e-79   Theobroma cacao [chocolate]
gb|AID52921.1|  tubulin alpha chain                                     254   2e-79   Carthamus tinctorius
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   254   2e-79   Fragaria vesca subsp. vesca
emb|CDY29334.1|  BnaA05g16010D                                          253   2e-79   Brassica napus [oilseed rape]
ref|NP_171974.1|  tubulin alpha-4 chain                                 254   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20487.1|  Tubulin alpha chain                                     254   2e-79   Gossypium arboreum [tree cotton]
gb|ABO47737.1|  alpha-tubulin                                           254   2e-79   Gossypium hirsutum [American cotton]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                254   2e-79   Tarenaya hassleriana [spider flower]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             254   2e-79   Capsella rubella
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     254   2e-79   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     254   2e-79   Pyrus x bretschneideri [bai li]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    254   2e-79   Gossypium raimondii
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             254   2e-79   Eutrema salsugineum [saltwater cress]
gb|ABO47736.1|  alpha-tubulin                                           254   2e-79   Gossypium hirsutum [American cotton]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                254   2e-79   Elaeis guineensis
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          254   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093625.1|  Tubulin alpha chain                                254   2e-79   Morus notabilis
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                254   2e-79   Vitis vinifera
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                254   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG18997.1|  Tubulin alpha chain                                     254   2e-79   Gossypium arboreum [tree cotton]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     253   2e-79   
gb|KJB58757.1|  hypothetical protein B456_009G224800                    252   2e-79   Gossypium raimondii
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    254   2e-79   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     254   2e-79   Cucumis melo [Oriental melon]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    254   2e-79   Brassica rapa
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                254   2e-79   Cucumis sativus [cucumbers]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    254   3e-79   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             254   3e-79   Citrus clementina [clementine]
gb|AGG37283.1|  alpha-tubulin 1                                         254   3e-79   Salix arbutifolia
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          253   3e-79   
gb|ACN40181.1|  unknown                                                 253   3e-79   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     253   3e-79   Vitis vinifera
dbj|BAP59012.1|  alpha tubulin                                          253   3e-79   Taxus cuspidata [ichii]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              253   3e-79   
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              253   3e-79   Fragaria vesca subsp. vesca
gb|ABO47740.1|  alpha-tubulin                                           253   3e-79   Gossypium hirsutum [American cotton]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        254   3e-79   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              254   3e-79   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             253   3e-79   Prunus persica
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              253   3e-79   Camelina sativa [gold-of-pleasure]
gb|AAO73546.1|  alpha-tubulin                                           253   4e-79   Ceratopteris richardii
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                253   4e-79   Populus euphratica
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   253   4e-79   Malus domestica [apple tree]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         253   4e-79   Jatropha curcas
gb|AIX10966.1|  tubulin                                                 253   4e-79   Ornithogalum longebracteatum [sea-onion]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             253   4e-79   Selaginella moellendorffii
gb|ABQ59634.1|  alpha-tubulin 5                                         253   5e-79   Populus tremuloides
gb|AAI59362.1|  Unknown (protein for MGC:185872)                        243   5e-79   Xenopus tropicalis [western clawed frog]
gb|AFV46219.1|  hypothetical protein                                    253   5e-79   Scutellaria baicalensis [Baikal skullcap]
gb|AGE09583.1|  TUA1-like protein                                       252   5e-79   Eucalyptus cladocalyx
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                252   6e-79   Erythranthe guttata [common monkey flower]
ref|XP_005932718.1|  PREDICTED: tubulin alpha chain-like                242   6e-79   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     253   6e-79   Sesamum indicum [beniseed]
gb|ABO47739.1|  alpha-tubulin                                           253   6e-79   Gossypium hirsutum [American cotton]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    253   6e-79   Gossypium hirsutum [American cotton]
ref|NP_001289660.1|  tubulin alpha chain-like                           253   6e-79   Eucalyptus grandis [rose gum]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   253   6e-79   Vitis vinifera
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 253   6e-79   Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 253   6e-79   Populus trichocarpa [western balsam poplar]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    253   7e-79   Gossypium hirsutum [American cotton]
ref|XP_010104543.1|  Tubulin alpha chain                                252   7e-79   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     253   7e-79   Nelumbo nucifera [Indian lotus]
gb|ABQ59633.1|  alpha-tubulin 3                                         253   7e-79   Populus tremuloides
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     253   8e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    252   8e-79   Arabis alpina [alpine rockcress]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                252   8e-79   Prunus dulcis [sweet almond]
gb|ADW66593.1|  alpha tubulin                                           249   8e-79   Hirschfeldia incana [buchanweed]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              252   8e-79   Cucumis sativus [cucumbers]
ref|XP_002609253.1|  hypothetical protein BRAFLDRAFT_86837              241   8e-79   Branchiostoma floridae
ref|XP_003793694.1|  PREDICTED: tubulin alpha chain-like                242   8e-79   Otolemur garnettii
emb|CAD13176.1|  alpha-tubulin                                          252   8e-79   Nicotiana tabacum [American tobacco]
gb|ERE81184.1|  tubulin alpha-1C chain                                  244   9e-79   Cricetulus griseus [Chinese hamsters]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             252   9e-79   Hordeum vulgare [barley]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                252   9e-79   Solanum tuberosum [potatoes]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     252   9e-79   Nicotiana sylvestris
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                252   9e-79   Nelumbo nucifera [Indian lotus]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     252   9e-79   Nicotiana tomentosiformis
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              252   9e-79   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     252   9e-79   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        252   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_001764722.1|  predicted protein                                  252   1e-78   
gb|AAO23139.1|  alpha tubulin                                           252   1e-78   Populus tremuloides
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              251   1e-78   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    252   1e-78   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-78   Solanum lycopersicum
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             252   1e-78   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        252   1e-78   Glycine max [soybeans]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    252   1e-78   
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-78   Oryza brachyantha
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             252   1e-78   Selaginella moellendorffii
emb|CDP02221.1|  unnamed protein product                                252   1e-78   Coffea canephora [robusta coffee]
ref|XP_005466520.1|  PREDICTED: tubulin alpha chain-like                242   1e-78   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                252   1e-78   Daucus carota [carrots]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   252   1e-78   Brassica rapa
gb|ABB02631.1|  unknown                                                 252   1e-78   Solanum tuberosum [potatoes]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              252   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              252   1e-78   Populus euphratica
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     252   1e-78   Vitis vinifera
ref|NP_193232.1|  tubulin alpha-6 chain                                 252   1e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC24800.1|  alpha tubulin                                          252   1e-78   Physcomitrella patens
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     252   1e-78   Phoenix dactylifera
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                252   1e-78   Phoenix dactylifera
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        250   1e-78   
gb|ABP65320.1|  alpha tubulin                                           252   1e-78   Capsicum annuum
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              252   1e-78   Nicotiana tomentosiformis
ref|XP_010096739.1|  Tubulin alpha chain                                252   1e-78   
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     252   1e-78   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                252   1e-78   Eucalyptus grandis [rose gum]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             252   1e-78   Populus trichocarpa [western balsam poplar]
gb|AAW30622.1|  unknown                                                 243   1e-78   Sus scrofa [pigs]
gb|KHN01709.1|  Tubulin alpha chain                                     251   1e-78   Glycine soja [wild soybean]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    251   2e-78   Glycine max [soybeans]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             251   2e-78   Prunus persica
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                251   2e-78   Elaeis guineensis
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   251   2e-78   Nicotiana tomentosiformis
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    251   2e-78   
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         251   2e-78   Jatropha curcas
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                251   2e-78   Phoenix dactylifera
gb|AAW30623.1|  unknown                                                 243   2e-78   Sus scrofa [pigs]
ref|XP_002517492.1|  tubulin alpha chain, putative                      251   2e-78   Ricinus communis
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     243   2e-78   Stegastes partitus
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    251   2e-78   Glycine max [soybeans]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    251   2e-78   
ref|XP_001427644.1|  hypothetical protein                               243   2e-78   Paramecium tetraurelia strain d4-2
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                251   2e-78   Elaeis guineensis
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     251   2e-78   Glycine max [soybeans]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    251   2e-78   Gossypium hirsutum [American cotton]
ref|NP_001291325.1|  tubulin alpha chain-like                           251   2e-78   Sesamum indicum [beniseed]
gb|EPZ32931.1|  Tubulin domain-containing protein                       241   2e-78   Rozella allomycis CSF55
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          251   2e-78   Malus domestica [apple tree]
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             244   3e-78   
emb|CAB66336.1|  alpha-tubulin                                          251   3e-78   Betula pendula [white birch]
gb|ACU19580.1|  unknown                                                 251   3e-78   Glycine max [soybeans]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                251   3e-78   Fragaria vesca subsp. vesca
ref|XP_005466564.1|  PREDICTED: tubulin alpha chain-like                241   3e-78   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             251   3e-78   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                251   3e-78   Cicer arietinum [garbanzo]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             251   3e-78   Phaseolus vulgaris [French bean]
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          251   3e-78   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  244   3e-78   Ochotona princeps [southern American pika]
ref|XP_005906298.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    243   3e-78   Bos mutus
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             251   3e-78   Selaginella moellendorffii
dbj|BAE01779.1|  unnamed protein product                                244   3e-78   Macaca fascicularis [crab eating macaque]
gb|AAG49533.3|  alpha tubulin                                           245   4e-78   Glossina morsitans morsitans
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        251   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             244   4e-78   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   250   4e-78   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          250   4e-78   Citrus sinensis [apfelsine]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              250   4e-78   Medicago truncatula
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                250   5e-78   Cicer arietinum [garbanzo]
ref|XP_006264720.1|  PREDICTED: tubulin alpha-1C chain                  241   5e-78   
ref|XP_008969760.1|  PREDICTED: tubulin alpha chain-like                242   5e-78   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               250   5e-78   Pisum sativum [garden pea]
ref|XP_010726225.1|  PREDICTED: tubulin alpha chain-like                241   5e-78   Meleagris gallopavo [common turkey]
gb|ABO33166.1|  alpha tubulin a2                                        243   6e-78   Mesenchytraeus solifugus
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             250   6e-78   Selaginella moellendorffii
gb|AHZ58482.1|  alpha-tubulin                                           244   6e-78   Syntrichia caninervis
emb|CAJ26346.1|  alpha-tubulin                                          241   6e-78   Platynereis dumerilii
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  244   6e-78   
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              250   6e-78   Nicotiana sylvestris
gb|AFW67748.1|  alpha tubulin4                                          248   6e-78   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             250   6e-78   Selaginella moellendorffii
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              250   6e-78   Selaginella moellendorffii
gb|ABV55999.1|  alpha-tubulin 7                                         250   6e-78   Populus tremuloides
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             250   7e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              250   7e-78   Medicago truncatula
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             250   7e-78   Selaginella moellendorffii
gb|AAB08791.1|  alpha tubulin                                           250   7e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABD92930.1|  alpha tubulin-2A                                        250   7e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             250   7e-78   Selaginella moellendorffii
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     249   7e-78   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             250   7e-78   Hordeum vulgare [barley]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                250   7e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          250   7e-78   
gb|KEH43997.1|  tubulin beta-1 chain                                    250   8e-78   Medicago truncatula
ref|NP_001067613.1|  Os11g0247300                                       250   8e-78   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     250   8e-78   Sesamum indicum [beniseed]
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          250   8e-78   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        250   8e-78   Cucumis melo [Oriental melon]
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    249   9e-78   Citrus sinensis [apfelsine]
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             243   9e-78   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ACH68563.1|  alpha-tubulin                                           249   9e-78   Solanum tuberosum [potatoes]
gb|AIJ27191.1|  alpha-tubulin 1a                                        244   9e-78   Mytilus galloprovincialis
gb|KIY93466.1|  Tubulin alpha-1 chain                                   241   1e-77   Monoraphidium neglectum
gb|AGG37289.1|  alpha-tubulin 7                                         249   1e-77   Salix arbutifolia
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  243   1e-77   Python bivittatus
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             245   1e-77   Pteropus vampyrus
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    245   1e-77   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     249   1e-77   
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     249   1e-77   Populus euphratica
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             243   1e-77   
ref|XP_006264718.1|  PREDICTED: tubulin alpha chain-like                240   1e-77   
dbj|BAB19779.1|  alpha tubulin                                          249   1e-77   Nicotiana tabacum [American tobacco]
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 245   1e-77   Rattus norvegicus [brown rat]
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    249   1e-77   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             249   1e-77   Selaginella moellendorffii
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             249   1e-77   Phaseolus vulgaris [French bean]
gb|ABO47742.1|  alpha-tubulin                                           249   1e-77   Gossypium hirsutum [American cotton]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             249   1e-77   Phaseolus vulgaris [French bean]
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             242   1e-77   Myotis lucifugus
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  244   1e-77   Chrysemys picta bellii
gb|ACK76232.1|  alpha-tubulin                                           249   1e-77   Dimocarpus longan [longan]
ref|XP_003804211.2|  PREDICTED: tubulin alpha-3E chain                  239   1e-77   Pan paniscus [bonobo]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   249   1e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|AIX10773.1|  alpha tubulin                                           249   2e-77   Panax notoginseng [san-qi]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              249   2e-77   Glycine max [soybeans]
dbj|BAJ06362.1|  alpha-tubulin                                          249   2e-77   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   249   2e-77   Brachypodium distachyon [annual false brome]
ref|XP_007663362.1|  PREDICTED: tubulin alpha chain-like                239   2e-77   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              249   2e-77   Setaria italica
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                249   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              249   2e-77   Nicotiana tomentosiformis
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             249   2e-77   Anemia phyllitidis
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             244   2e-77   
gb|AIK29207.1|  putative alpha-tubulin                                  243   2e-77   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KGL81705.1|  Tubulin alpha-1C chain                                  242   2e-77   Tinamus guttatus
ref|XP_003392163.2|  PREDICTED: tubulin alpha chain, testis-speci...    239   2e-77   Amphimedon queenslandica
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    249   2e-77   Glycine max [soybeans]
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  245   2e-77   Camelus dromedarius [camel]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                249   2e-77   Cucumis sativus [cucumbers]
ref|XP_005851144.1|  alpha-tubulin                                      249   2e-77   Chlorella variabilis
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  245   2e-77   
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             242   2e-77   
gb|AII97815.1|  BLTX443                                                 243   2e-77   Nephila pilipes
dbj|BAJ98211.1|  predicted protein                                      248   2e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              244   2e-77   
gb|AHJ80817.1|  Tua1                                                    249   2e-77   
gb|AHJ80822.1|  Tua1                                                    249   2e-77   
ref|NP_001167663.1|  tubulin alpha-3 chain                              248   2e-77   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              248   2e-77   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   248   2e-77   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    248   3e-77   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          248   3e-77   
ref|XP_002763662.3|  PREDICTED: tubulin alpha chain-like                239   3e-77   
gb|AHJ80815.1|  Tua1                                                    248   3e-77   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              248   3e-77   
emb|CAA06619.1|  alpha-tubulin 1                                        248   3e-77   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             248   3e-77   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      248   3e-77   
gb|ABS57456.1|  alpha-tubulin                                           241   3e-77   
ref|XP_002508010.1|  alpha tubulin 2                                    248   3e-77   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   248   3e-77   
gb|AIA82437.1|  alpha-tubulin-like protein 06                           245   3e-77   
gb|AEF59080.1|  alpha tubulin-like protein                              243   3e-77   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              248   3e-77   
gb|AHJ80816.1|  Tua1                                                    248   4e-77   
ref|XP_007068754.1|  PREDICTED: tubulin alpha-1D chain-like             241   4e-77   
ref|XP_005651460.1|  tubulin alpha chain                                248   4e-77   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                248   4e-77   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              243   4e-77   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             248   4e-77   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             248   4e-77   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   248   4e-77   
emb|CAA62917.1|  alfa-tubulin                                           248   4e-77   
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             246   4e-77   
ref|XP_002783368.1|  alpha tubulin, putative                            238   5e-77   
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             241   5e-77   
ref|XP_005643073.1|  tubulin alpha chain                                248   5e-77   
gb|ETE59910.1|  Tubulin alpha-1A chain                                  243   5e-77   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                248   5e-77   
emb|CDO97305.1|  unnamed protein product                                248   5e-77   
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        248   5e-77   
ref|XP_003979912.1|  PREDICTED: tubulin alpha-1D chain-like             237   5e-77   
gb|AAH33064.1|  TUBA1C protein                                          244   5e-77   
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              245   6e-77   
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             242   6e-77   
emb|CAD32379.1|  tubulin alpha                                          236   6e-77   
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 244   6e-77   
ref|XP_004617224.1|  PREDICTED: tubulin alpha-1D chain-like             239   7e-77   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  247   7e-77   
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             246   7e-77   
gb|ABG78593.1|  alpha-tubulin                                           247   7e-77   
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              247   8e-77   
ref|NP_001051132.1|  Os03g0726100                                       247   9e-77   
gb|AAW30624.1|  unknown                                                 239   9e-77   
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             242   9e-77   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                  242   1e-76   
ref|XP_009246735.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    243   1e-76   
gb|KFO33466.1|  Tubulin alpha-1C chain                                  243   1e-76   
gb|EKC22339.1|  Tubulin alpha chain                                     242   1e-76   
ref|XP_002766433.1|  tubulin alpha chain, putative                      238   1e-76   
ref|XP_007073037.1|  PREDICTED: tubulin alpha-1C chain                  243   1e-76   
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like                243   1e-76   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           246   1e-76   
dbj|BAJ07366.1|  alpha-tubulin                                          237   1e-76   
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              243   1e-76   
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                246   1e-76   
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             244   2e-76   
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    246   2e-76   
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   246   2e-76   
gb|AAM73791.1|  alpha-tubulin                                           236   2e-76   
gb|AAB84298.1|  tubulin                                                 246   2e-76   
ref|XP_001782790.1|  predicted protein                                  246   2e-76   
ref|XP_001777081.1|  predicted protein                                  246   2e-76   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              246   2e-76   
ref|XP_006974484.1|  PREDICTED: tubulin alpha-1A chain-like             242   2e-76   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      239   2e-76   
gb|AAZ23863.1|  alpha-tubulin                                           246   2e-76   
ref|XP_003976815.1|  PREDICTED: tubulin alpha-1 chain-like              237   2e-76   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     243   2e-76   
ref|XP_003058621.1|  alpha tubulin                                      246   2e-76   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      238   2e-76   
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    244   2e-76   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                  246   3e-76   
emb|CAA67848.1|  alpha-tubulin                                          246   3e-76   
ref|XP_001454509.1|  hypothetical protein                               246   3e-76   
gb|EHB00536.1|  Tubulin alpha-1C chain                                  245   3e-76   
dbj|BAJ97454.1|  predicted protein                                      243   3e-76   
gb|AAC97930.1|  alpha tubulin                                           236   3e-76   
gb|EJY81124.1|  Alpha tubulin,putative                                  246   3e-76   
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                        244   3e-76   
gb|EFO61055.1|  Alpha-tubulin                                           237   3e-76   
gb|ACY05960.1|  alpha-tubulin                                           244   3e-76   
emb|CDW82295.1|  alpha tubulin                                          246   3e-76   
ref|XP_004863237.1|  PREDICTED: uncharacterized protein LOC101707673    242   3e-76   
gb|AHJ80823.1|  Tua1                                                    246   3e-76   
gb|ETN59126.1|  tubulin alpha chain                                     243   3e-76   
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       241   3e-76   
ref|XP_005354088.1|  PREDICTED: tubulin alpha-1B chain                  243   3e-76   
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  242   3e-76   
ref|XP_006168270.1|  PREDICTED: tubulin alpha-2 chain-like              243   3e-76   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                  244   3e-76   
ref|XP_673091.1|  hypothetical protein                                  239   3e-76   
ref|XP_001101935.1|  PREDICTED: tubulin alpha-3C/D chain-like iso...    244   3e-76   
gb|KFM01620.1|  Tubulin alpha-1C chain                                  241   3e-76   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    245   4e-76   
gb|AAX29832.1|  tubulin alpha 2                                         244   4e-76   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       245   4e-76   
ref|XP_001460309.1|  hypothetical protein                               245   4e-76   
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like             244   4e-76   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      240   4e-76   
ref|NP_001029376.1|  tubulin alpha-1C chain                             245   4e-76   
gb|AFX62859.1|  alpha tubulin 84B                                       244   4e-76   
ref|XP_674476.1|  hypothetical protein                                  237   4e-76   
emb|CAI38956.1|  alpha_tubulin,putative                                 245   4e-76   
ref|XP_009554397.1|  PREDICTED: tubulin alpha-1A chain                  240   5e-76   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  245   5e-76   
gb|AFX62784.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62789.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62788.1|  alpha tubulin 84B                                       244   5e-76   
ref|XP_006884982.1|  PREDICTED: uncharacterized protein LOC102849576    248   5e-76   
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like             244   5e-76   
ref|XP_010641177.1|  PREDICTED: tubulin alpha-3 chain                   245   5e-76   
gb|AFX62786.1|  alpha tubulin 84B                                       244   5e-76   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    245   5e-76   
gb|AFX62804.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62790.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62861.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62862.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62793.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62858.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62791.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62797.1|  alpha tubulin 84B                                       244   5e-76   
gb|ELK23510.1|  Tubulin alpha chain                                     234   5e-76   
gb|AFX62860.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62802.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62787.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62805.1|  alpha tubulin 84B                                       244   5e-76   
gb|AFX62798.1|  alpha tubulin 84B                                       244   6e-76   
gb|AFX62799.1|  alpha tubulin 84B                                       244   6e-76   
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1       245   6e-76   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                245   6e-76   
gb|AFX62864.1|  alpha tubulin 84B                                       244   6e-76   
ref|XP_002110664.1|  alpha tubulin                                      239   6e-76   
ref|XP_004032593.1|  PREDICTED: tubulin alpha-3 chain-like              244   6e-76   
ref|XP_739480.1|  hypothetical protein                                  236   6e-76   
ref|NP_524264.1|  alpha-Tubulin at 84D                                  245   6e-76   
ref|XP_002038709.1|  GM10965                                            245   6e-76   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               244   6e-76   
dbj|BAK03519.1|  predicted protein                                      245   7e-76   
ref|XP_001753986.1|  predicted protein                                  245   7e-76   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       245   7e-76   
ref|XP_008542826.1|  PREDICTED: tubulin alpha-3 chain-like              243   7e-76   
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    242   7e-76   
gb|AAM73790.1|  alpha-tubulin                                           234   7e-76   
ref|XP_001770881.1|  predicted protein                                  244   7e-76   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      241   7e-76   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    244   8e-76   
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              244   8e-76   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             244   8e-76   
ref|XP_004599950.1|  PREDICTED: tubulin alpha-3 chain-like              242   8e-76   
ref|XP_005981039.1|  PREDICTED: tubulin alpha-1B chain-like             244   8e-76   
ref|NP_476772.1|  alpha-Tubulin at 84B                                  244   8e-76   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       244   8e-76   
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                  244   8e-76   
dbj|BAN20459.1|  tubulin alpha chain                                    244   8e-76   
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    244   8e-76   
ref|XP_004470253.1|  PREDICTED: tubulin alpha-1B chain-like             243   9e-76   
ref|XP_005986293.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    245   9e-76   
ref|XP_007235803.1|  PREDICTED: tubulin alpha chain-like isoform X2     244   9e-76   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  244   9e-76   
emb|CDY35861.1|  BnaC09g37930D                                          235   9e-76   
gb|AAH57810.1|  Tubulin, alpha 3d                                       244   9e-76   
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like             244   9e-76   
ref|XP_004274417.1|  PREDICTED: tubulin alpha-1C chain-like             244   9e-76   
gb|AAX29538.1|  tubulin alpha 6                                         244   9e-76   
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                  244   9e-76   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    244   9e-76   
ref|NP_001029267.1|  tubulin alpha-1B chain                             244   9e-76   
dbj|BAF82043.1|  unnamed protein product                                244   9e-76   
ref|XP_004878662.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    244   9e-76   
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like             244   9e-76   
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                  244   9e-76   
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like             244   9e-76   
sp|P36220.1|TBA_TORMA  RecName: Full=Tubulin alpha chain; AltName...    244   9e-76   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           244   1e-75   
ref|XP_008831082.1|  PREDICTED: tubulin alpha-1B chain                  244   1e-75   
ref|XP_005986295.1|  PREDICTED: tubulin alpha-1A chain-like             244   1e-75   
gb|KFQ41598.1|  Tubulin alpha-3 chain                                   243   1e-75   
emb|CDQ72000.1|  unnamed protein product                                244   1e-75   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    244   1e-75   
ref|XP_009001973.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    244   1e-75   
ref|XP_006916875.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
ref|XP_008561381.1|  PREDICTED: tubulin alpha-3 chain                   244   1e-75   
ref|XP_004569650.1|  PREDICTED: tubulin alpha chain-like                244   1e-75   
ref|NP_001098596.2|  tubulin alpha-1B chain                             244   1e-75   
ref|NP_035784.1|  tubulin alpha-1B chain                                244   1e-75   
gb|AAI51892.1|  MGC171407 protein                                       244   1e-75   
gb|AAX63396.1|  alpha-tubulin                                           244   1e-75   
ref|XP_001504231.1|  PREDICTED: tubulin alpha-1C chain isoform 1        244   1e-75   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  244   1e-75   
ref|XP_010348074.1|  PREDICTED: tubulin alpha-1B chain                  244   1e-75   
gb|AAA91576.1|  alpha-tubulin                                           244   1e-75   
emb|CDQ59454.1|  unnamed protein product                                242   1e-75   
ref|XP_005532034.1|  PREDICTED: tubulin alpha-1C chain isoform X1       244   1e-75   
ref|XP_005061430.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    244   1e-75   
dbj|BAE39705.1|  unnamed protein product                                244   1e-75   
ref|XP_010594690.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
ref|XP_010348076.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
ref|NP_989078.1|  tubulin, alpha 1c                                     244   1e-75   
ref|NP_001095253.1|  tubulin alpha chain                                244   1e-75   
ref|NP_001165669.1|  tubulin, alpha 3e                                  244   1e-75   
ref|XP_006131233.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
ref|XP_003223237.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
ref|XP_004880760.1|  PREDICTED: tubulin alpha-1C chain isoform X1       244   1e-75   
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1        244   1e-75   
gb|AEE61427.1|  unknown                                                 244   1e-75   
dbj|BAK63748.1|  tubulin alpha-2 chain                                  244   1e-75   
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              244   1e-75   
gb|AAH42319.1|  Tuba1 protein                                           244   1e-75   
ref|XP_011282203.1|  PREDICTED: tubulin alpha-1C chain                  244   1e-75   
pdb|1SA0|A  Chain A, Tubulin-Colchicine: Stathmin-Like Domain Com...    244   1e-75   
pdb|3J6E|A  Chain A, Energy Minimized Average Structure Of Microt...    244   1e-75   
ref|NP_001033252.1|  tubulin alpha-3 chain                              244   1e-75   
ref|NP_116093.1|  tubulin alpha-1C chain isoform c                      244   1e-75   
pdb|1TUB|A  Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction     244   1e-75   
ref|XP_006811914.1|  PREDICTED: tubulin alpha-1A chain-like             244   1e-75   



>ref|NP_001275472.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABA46784.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=237

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   251 bits (641),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score =   250 bits (638),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_001786415.1| predicted protein [Physcomitrella patens]
 gb|EDQ48774.1| predicted protein, partial [Physcomitrella patens]
Length=127

 Score =   248 bits (633),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   250 bits (639),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   254 bits (650),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   253 bits (646),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  297
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  298  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLC  477
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  478  L  480
            L
Sbjct  123  L  123



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score =   246 bits (627),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/119 (96%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISG EDAANNFARGHYTIGKE+VDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEVVDLCL  119



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006433709.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
 gb|ESR46949.1| hypothetical protein CICLE_v100015521mg, partial [Citrus clementina]
Length=153

 Score =   246 bits (627),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   248 bits (634),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   254 bits (648),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   246 bits (629),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   249 bits (637),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVD+CL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICL  119



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +1

Query  106  NSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFS  285
             S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFS
Sbjct  45   QSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFS  104

Query  286  ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEI  465
            ETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEI
Sbjct  105  ETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI  164

Query  466  VDLCL  480
            VDLCL
Sbjct  165  VDLCL  169



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAI59362.1| Unknown (protein for MGC:185872) [Xenopus (Silurana) tropicalis]
Length=145

 Score =   243 bits (619),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN++RGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYSRGHYTIGKEIIDLVL  119



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   253 bits (645),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  297
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  298  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLC  477
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  478  L  480
            L
Sbjct  156  L  156



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   252 bits (643),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005932718.1| PREDICTED: tubulin alpha chain-like [Haplochromis burtoni]
Length=142

 Score =   242 bits (618),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   249 bits (637),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  130  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  309
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  310  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  117



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002609253.1| hypothetical protein BRAFLDRAFT_86837 [Branchiostoma floridae]
 gb|EEN65263.1| hypothetical protein BRAFLDRAFT_86837, partial [Branchiostoma 
floridae]
Length=125

 Score =   241 bits (616),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>ref|XP_003793694.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=142

 Score =   242 bits (618),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ERE81184.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=197

 Score =   244 bits (623),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  36   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  95

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  96   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  154



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005466520.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   242 bits (617),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/119 (96%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAW30622.1| unknown, partial [Sus scrofa]
Length=189

 Score =   243 bits (620),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+G EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AAW30623.1| unknown [Sus scrofa]
Length=201

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008294350.1| PREDICTED: tubulin alpha chain [Stegastes partitus]
Length=202

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



>ref|XP_001427644.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK60246.1| unnamed protein product [Paramecium tetraurelia]
Length=189

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRE ISIH+GQ GIQVGNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQGGIQVGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|EPZ32931.1| Tubulin domain-containing protein [Rozella allomycis CSF55]
Length=144

 Score =   241 bits (615),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR VFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRTVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005932717.1| PREDICTED: tubulin alpha-1B chain-like [Haplochromis burtoni]
Length=243

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005466564.1| PREDICTED: tubulin alpha chain-like [Oreochromis niloticus]
Length=142

 Score =   241 bits (614),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/119 (98%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004599399.1| PREDICTED: tubulin alpha-1B chain, partial [Ochotona princeps]
Length=231

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_005906298.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1 chain-like [Bos 
mutus]
Length=202

 Score =   243 bits (619),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSE GAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSEMGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   251 bits (640),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>dbj|BAE01779.1| unnamed protein product [Macaca fascicularis]
Length=251

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>gb|AAG49533.3| alpha tubulin [Glossina morsitans morsitans]
Length=278

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKTVGGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005801996.1| PREDICTED: tubulin alpha-1B chain-like, partial [Xiphophorus 
maculatus]
Length=255

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTLGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006264720.1| PREDICTED: tubulin alpha-1C chain [Alligator mississippiensis]
Length=159

 Score =   241 bits (614),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQP GQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPXGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_008969760.1| PREDICTED: tubulin alpha chain-like [Pan paniscus]
Length=194

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_010726225.1| PREDICTED: tubulin alpha chain-like, partial [Meleagris gallopavo]
Length=181

 Score =   241 bits (616),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  94   VCSSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFN  273
            + S   S    RECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FN
Sbjct  3    ISSQTPSLTPQRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFN  62

Query  274  TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTI  453
            TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTI
Sbjct  63   TFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTI  122

Query  454  GKEIVDLCL  480
            GKEI+DL L
Sbjct  123  GKEIIDLVL  131



>gb|ABO33166.1| alpha tubulin a2 [Mesenchytraeus solifugus]
Length=241

 Score =   243 bits (621),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+H+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYT+GKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCL  119



>emb|CAJ26346.1| alpha-tubulin [Platynereis dumerilii]
Length=190

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKE++DL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVL  119



>ref|XP_004778983.1| PREDICTED: tubulin alpha-1C chain [Mustela putorius furo]
Length=249

 Score =   244 bits (622),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIG+EIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCL  119



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002963093.1| hypothetical protein SELMODRAFT_404672 [Selaginella moellendorffii]
 gb|EFJ36556.1| hypothetical protein SELMODRAFT_404672 [Selaginella moellendorffii]
Length=451

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISG E+AANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCL  119



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVD+CL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCL  119



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/119 (96%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYT+GKEIVDLCL
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCL  119



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002980239.1| hypothetical protein SELMODRAFT_233509 [Selaginella moellendorffii]
 gb|EFJ18499.1| hypothetical protein SELMODRAFT_233509 [Selaginella moellendorffii]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   249 bits (637),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   249 bits (635),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_006895063.1| PREDICTED: tubulin alpha-1B chain-like [Elephantulus edwardii]
Length=249

 Score =   243 bits (621),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   249 bits (637),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/118 (98%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +1

Query  127  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  306
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  307  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  118



>gb|AIJ27191.1| alpha-tubulin 1a, partial [Mytilus galloprovincialis]
Length=271

 Score =   244 bits (622),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQL++G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLVTGKEDAANNYARGHYTIGKEIVDLVL  119



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   241 bits (615),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR +F+DLEPTV+DEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDL L
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLAL  119



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007426287.1| PREDICTED: tubulin alpha-1C chain [Python bivittatus]
Length=256

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFIDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_011366648.1| PREDICTED: tubulin alpha-1C chain-like [Pteropus vampyrus]
Length=301

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_008575749.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3E chain [Galeopterus 
variegatus]
Length=308

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTV+DEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEIVDL L
Sbjct  61   HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVL  119



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_005801995.1| PREDICTED: tubulin alpha-1A chain-like, partial [Xiphophorus 
maculatus]
Length=256

 Score =   243 bits (621),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVR+GTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_006264718.1| PREDICTED: tubulin alpha chain-like [Alligator mississippiensis]
Length=158

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYT GKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTXGKEIIDLVL  119



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>gb|EDL87015.1| rCG50513, isoform CRA_a [Rattus norvegicus]
Length=319

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIH+GQAG+Q+GNACWELYCLEHGIQPDGQMPSDKT+GGGDD+FNTFFSETGAGK
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLI+G EDAANN+ARGHYTIGKEI+DL L
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL  119



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISG EDAANNFARGHYTIGKEIVDLCL
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCL  119



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  303
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  304  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGXEDAANNFARGHYTIGKEIVDLCL  480
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISG EDAANNFARGHYTIGKEIV+LCL
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCL  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140