BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030H03

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   182   1e-53   Nicotiana sylvestris
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   180   4e-53   Nicotiana tomentosiformis
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 180   4e-53   Nicotiana tabacum [American tobacco]
ref|NP_001275065.1|  major intrinsic protein 2                          178   2e-52   Solanum tuberosum [potatoes]
gb|AFQ23186.1|  aquaporin PIP2;1                                        178   3e-52   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AAB18227.1|  MipC                                                    177   5e-52   Mesembryanthemum crystallinum
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   175   4e-51   Cicer arietinum [garbanzo]
ref|NP_001289846.1|  probable aquaporin PIP2-1                          175   5e-51   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   174   1e-50   Nicotiana sylvestris
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     171   1e-50   Eucalyptus grandis [rose gum]
ref|XP_003606384.1|  Aquaporin PIP2-7                                   171   2e-50   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   173   3e-50   Nicotiana tomentosiformis
gb|ABB13430.2|  plasma membrane intrinsic protein                       172   5e-50   Olea europaea
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          171   2e-49   Solanum tuberosum [potatoes]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   170   2e-49   Medicago truncatula
gb|KJB62460.1|  hypothetical protein B456_009G418100                    167   3e-49   Gossypium raimondii
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   169   5e-49   Eucalyptus grandis [rose gum]
emb|CAB45651.1|  putative plasma membrane intrinsic protein             169   6e-49   Pisum sativum [garden pea]
gb|KJB56129.1|  hypothetical protein B456_009G107200                    167   6e-49   Gossypium raimondii
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   169   9e-49   Tarenaya hassleriana [spider flower]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   168   1e-48   Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             168   1e-48   
emb|CDP07111.1|  unnamed protein product                                169   1e-48   Coffea canephora [robusta coffee]
gb|KHG00060.1|  putative aquaporin PIP2-2                               168   2e-48   Gossypium arboreum [tree cotton]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             168   2e-48   Citrus clementina [clementine]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         167   3e-48   Ricinus communis
gb|KJB56128.1|  hypothetical protein B456_009G107200                    167   3e-48   Gossypium raimondii
gb|KJB16797.1|  hypothetical protein B456_002G2484002                   162   4e-48   Gossypium raimondii
gb|ADK25057.1|  plasma membrane intrinsic protein                       167   4e-48   Glycine max [soybeans]
ref|NP_001240223.1|  prolactin-inducible protein                        167   4e-48   Glycine max [soybeans]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    167   6e-48   Gossypium raimondii
gb|ABK60196.1|  PIP2 protein                                            167   6e-48   Gossypium hirsutum [American cotton]
gb|AFK47400.1|  unknown                                                 166   8e-48   Lotus japonicus
gb|ACU23034.1|  unknown                                                 162   8e-48   Glycine max [soybeans]
gb|KJB36606.1|  hypothetical protein B456_006G166800                    164   1e-47   Gossypium raimondii
gb|AIA83106.1|  putative aquaporin PIP2                                 166   2e-47   Citrus trifoliata [hardy orange]
ref|NP_001105026.1|  aquaporin PIP2-4                                   166   2e-47   Zea mays [maize]
gb|KHG29841.1|  putative aquaporin PIP2-2                               166   2e-47   Gossypium arboreum [tree cotton]
gb|KHN05685.1|  Aquaporin PIP2-7                                        166   2e-47   Glycine soja [wild soybean]
gb|AFK35635.1|  unknown                                                 162   2e-47   Medicago truncatula
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        165   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        165   2e-47   Glycine max [soybeans]
gb|KHN38765.1|  Aquaporin PIP2-7                                        165   2e-47   Glycine soja [wild soybean]
gb|ACG33001.1|  aquaporin PIP2.2                                        165   2e-47   Zea mays [maize]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   165   3e-47   Setaria italica
gb|AHG32324.1|  PIP2-3                                                  165   3e-47   Pisum sativum [garden pea]
gb|AEC45513.1|  plasma membrane intrinsic protein                       165   3e-47   Hevea brasiliensis [jebe]
ref|NP_001105025.1|  aquaporin PIP2-3                                   165   3e-47   Zea mays [maize]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         164   4e-47   Jatropha curcas
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   164   4e-47   Gossypium raimondii
gb|AAO39007.1|  plasma intrinsic protein 2,1                            164   5e-47   Juglans regia
gb|ABK60195.2|  PIP2 protein                                            164   6e-47   Gossypium hirsutum [American cotton]
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 164   6e-47   Gossypium hirsutum [American cotton]
gb|AGD98714.1|  aquaporin protein 11                                    164   7e-47   Camellia sinensis [black tea]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            164   7e-47   Juglans regia
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               164   1e-46   Beta vulgaris [beet]
dbj|BAE02729.1|  PIP aquaporin                                          163   1e-46   Hordeum vulgare [barley]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          163   1e-46   Sorghum bicolor [broomcorn]
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           162   1e-46   Triticum aestivum [Canadian hard winter wheat]
gb|AAC17529.1|  aquaporin 2                                             163   2e-46   Samanea saman [cow-tamarind]
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             163   2e-46   Eutrema salsugineum [saltwater cress]
gb|AEO13898.1|  aquaporin 7                                             163   2e-46   Triticum aestivum [Canadian hard winter wheat]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          162   2e-46   Gossypium arboreum [tree cotton]
gb|AFK47442.1|  unknown                                                 162   2e-46   Medicago truncatula
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        162   3e-46   Phoenix dactylifera
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   162   3e-46   Phoenix dactylifera
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         162   3e-46   Ricinus communis
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   162   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               162   3e-46   Nicotiana tomentosiformis
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             162   3e-46   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             162   3e-46   Phaseolus vulgaris [French bean]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          162   3e-46   Gossypium arboreum [tree cotton]
gb|EMT09900.1|  Putative aquaporin PIP2-2                               163   4e-46   
gb|KJB20285.1|  hypothetical protein B456_003G141600                    162   5e-46   Gossypium raimondii
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    161   6e-46   Nicotiana sylvestris
emb|CDY56697.1|  BnaCnng31040D                                          162   6e-46   Brassica napus [oilseed rape]
gb|AFH36337.1|  aquaporin PIP2;2                                        161   6e-46   Quercus petraea [durmast oak]
ref|NP_001289999.1|  aquaporin PIP2-1                                   161   7e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         161   7e-46   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         161   8e-46   Jatropha curcas
dbj|BAA23744.1|  HvPIP2;1                                               161   8e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001105639.1|  aquaporin PIP2-7                                   161   8e-46   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        161   8e-46   
gb|ACU19125.1|  unknown                                                 161   8e-46   Glycine max [soybeans]
ref|NP_001237286.1|  PIP2,2                                             161   8e-46   
gb|EAY86778.1|  hypothetical protein OsI_08158                          161   1e-45   Oryza sativa Indica Group [Indian rice]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  161   1e-45   Pyrus communis
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          161   1e-45   Gossypium arboreum [tree cotton]
gb|AIA83104.1|  putative aquaporin PIP2                                 161   1e-45   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|NP_001047491.1|  Os02g0629200                                       161   1e-45   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             161   1e-45   Capsella rubella
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               161   1e-45   
gb|ADJ67992.1|  aquaporin                                               160   1e-45   Fragaria x ananassa
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               160   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             159   1e-45   Elaeis guineensis
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        160   2e-45   Brassica rapa
gb|ACJ85173.1|  unknown                                                 160   2e-45   Medicago truncatula
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                160   2e-45   Populus trichocarpa x Populus deltoides
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                160   2e-45   Erythranthe guttata [common monkey flower]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       160   2e-45   Raphanus sativus
ref|XP_002322877.1|  major intrinsic protein 1                          160   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        160   3e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             160   3e-45   Phaseolus vulgaris [French bean]
ref|NP_190910.1|  aquaporin PIP2-1                                      160   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               160   3e-45   Phaseolus vulgaris [French bean]
gb|ABU94630.1|  putative aquaporin PIP2;2                               160   3e-45   Phaseolus vulgaris [French bean]
ref|NP_001234625.1|  aquaporin                                          159   3e-45   Solanum lycopersicum
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   159   4e-45   Glycine max [soybeans]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   159   4e-45   Elaeis guineensis
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    159   4e-45   Camelina sativa [gold-of-pleasure]
emb|CDY13298.1|  BnaC06g14590D                                          159   4e-45   Brassica napus [oilseed rape]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               159   4e-45   Glycine max [soybeans]
gb|KHN00691.1|  Aquaporin PIP2-2                                        159   5e-45   Glycine soja [wild soybean]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               159   5e-45   Elaeis guineensis
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   159   5e-45   Populus euphratica
ref|NP_181254.1|  aquaporin PIP2-2                                      159   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235204.1|  Pip1 protein                                       159   6e-45   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   159   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             159   6e-45   Phaseolus vulgaris [French bean]
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             159   8e-45   Elaeis guineensis
gb|AHA84284.1|  prolactin-inducible protein                             159   8e-45   Phaseolus vulgaris [French bean]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             159   8e-45   Phaseolus vulgaris [French bean]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             159   8e-45   Phaseolus vulgaris [French bean]
gb|AAY22203.1|  putative aquaporin                                      159   8e-45   Phaseolus vulgaris [French bean]
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     158   8e-45   Eucalyptus grandis [rose gum]
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        159   9e-45   Cucumis melo [Oriental melon]
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   159   9e-45   Tarenaya hassleriana [spider flower]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   159   9e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   159   9e-45   Setaria italica
gb|ACU21481.1|  unknown                                                 158   1e-44   Glycine max [soybeans]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   158   1e-44   Glycine max [soybeans]
gb|AIG92831.1|  aquaporin PIP2                                          158   1e-44   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEY75242.1|  plasma membrane intrinsic protein                       158   1e-44   Malus hupehensis
gb|ACX37450.1|  plasma membrane intrinsic protein                       158   1e-44   Hevea brasiliensis [jebe]
gb|ABU94631.1|  putative aquaporin PIP2;3                               158   2e-44   Phaseolus vulgaris [French bean]
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               157   2e-44   Prunus mume [ume]
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   157   2e-44   Cicer arietinum [garbanzo]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              158   2e-44   
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        157   2e-44   Medicago truncatula
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             157   2e-44   Prunus persica
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   157   2e-44   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            157   2e-44   Cucumis sativus [cucumbers]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               157   2e-44   Eucalyptus grandis [rose gum]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             157   2e-44   Capsella rubella
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   157   2e-44   Nelumbo nucifera [Indian lotus]
gb|ACU20229.1|  unknown                                                 157   2e-44   Glycine max [soybeans]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                157   3e-44   Hevea brasiliensis [jebe]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   157   3e-44   Phoenix dactylifera
gb|KHG08488.1|  putative aquaporin PIP2-2                               157   3e-44   Gossypium arboreum [tree cotton]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         157   3e-44   Jatropha curcas
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                157   3e-44   Erythranthe guttata [common monkey flower]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   157   3e-44   Populus euphratica
ref|NP_181255.1|  aquaporin PIP2-3                                      157   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   157   4e-44   Fragaria vesca subsp. vesca
emb|CDX74983.1|  BnaA05g07290D                                          154   4e-44   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   157   4e-44   Medicago truncatula
emb|CDP06739.1|  unnamed protein product                                157   5e-44   Coffea canephora [robusta coffee]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    156   5e-44   Gossypium raimondii
gb|ACM50914.1|  aquaporin                                               156   6e-44   Medicago falcata [sickle alfalfa]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        156   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             156   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                156   7e-44   Theobroma cacao [chocolate]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   156   7e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             156   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   156   9e-44   Populus euphratica
gb|EMS56715.1|  putative aquaporin PIP2-2                               157   9e-44   Triticum urartu
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             156   1e-43   Arabidopsis lyrata subsp. lyrata
emb|CAH60724.1|  putative plasma membrane intrinsic protein             155   1e-43   Populus tremula x Populus tremuloides
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               155   1e-43   Camelina sativa [gold-of-pleasure]
gb|AIK66515.1|  putative aquaporin                                      155   1e-43   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               155   1e-43   Vitis vinifera
gb|ABH09326.1|  putative aquaporin                                      155   2e-43   Vitis vinifera
emb|CAN75442.1|  hypothetical protein VITISV_019657                     155   2e-43   Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                     155   2e-43   Vitis vinifera
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     155   2e-43   Vitis cinerea var. helleri x Vitis rupestris
gb|AGG39693.1|  aquaporin protein AQU15                                 155   2e-43   Camellia sinensis [black tea]
gb|AGD98708.1|  aquaporin protein 5                                     155   2e-43   Camellia sinensis [black tea]
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               155   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  155   2e-43   Mimosa pudica [sensitive-plant]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             155   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          155   2e-43   Sorghum bicolor [broomcorn]
gb|AGD98707.1|  aquaporin protein 4                                     155   2e-43   Camellia sinensis [black tea]
gb|ABC69040.1|  aquaporin PIP2-1                                        155   2e-43   Rhododendron catawbiense [Catawba rosebay]
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               155   2e-43   Brassica rapa
gb|AAL32127.1|  aquaporin                                               155   2e-43   Medicago truncatula
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               155   3e-43   Eucalyptus grandis [rose gum]
emb|CAB46351.1|  major intrinsic protein 2                              155   3e-43   Solanum tuberosum [potatoes]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             155   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   154   3e-43   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        154   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               154   3e-43   Brassica rapa
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   154   3e-43   Fragaria vesca subsp. vesca
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                   151   4e-43   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        159   4e-43   Cloning vector pBullet-pm-n
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             154   4e-43   Eutrema salsugineum [saltwater cress]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    154   4e-43   Mesembryanthemum crystallinum
ref|NP_001105616.1|  aquaporin PIP2-5                                   154   5e-43   Zea mays [maize]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                154   7e-43   Populus trichocarpa x Populus deltoides
gb|AFH36338.1|  aquaporin PIP2;3                                        154   7e-43   Quercus petraea [durmast oak]
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        154   7e-43   Fragaria vesca subsp. vesca
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   154   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010100853.1|  Aquaporin PIP2-1                                   154   8e-43   Morus notabilis
gb|ACU24483.1|  unknown                                                 153   9e-43   Glycine max [soybeans]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               153   9e-43   Pyrus x bretschneideri [bai li]
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   153   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   153   1e-42   Glycine max [soybeans]
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               153   1e-42   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               153   1e-42   Malus domestica [apple tree]
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    153   1e-42   Ziziphus jujuba [Chinese jujube]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               153   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        153   1e-42   Brassica rapa
emb|CDX91341.1|  BnaC04g08090D                                          153   1e-42   
dbj|BAE06148.1|  PIP aquaporin isoform                                  153   1e-42   Hordeum vulgare [barley]
gb|ABI96813.1|  plasma membrane intrinsic protein                       153   1e-42   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             153   2e-42   
emb|CDX10333.1|  aquaporin                                              152   2e-42   Coffea arabica [arabica coffee]
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        152   2e-42   Fragaria vesca subsp. vesca
gb|ACZ06859.1|  plasma membrane intrinsic protein                       152   2e-42   Glycine soja [wild soybean]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               152   2e-42   Camelina sativa [gold-of-pleasure]
gb|ABB88840.1|  aquaporin                                               152   2e-42   Stevia rebaudiana
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   152   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   152   2e-42   Nicotiana tomentosiformis
ref|NP_001268056.1|  aquaporin PIP2                                     152   2e-42   Vitis vinifera
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   152   2e-42   Camelina sativa [gold-of-pleasure]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         152   2e-42   Helianthemum almeriense
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               152   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   152   2e-42   Nicotiana tomentosiformis
gb|ABN11917.1|  aquaporin                                               152   2e-42   Cucurbita ficifolia [chilacayote]
dbj|BAF33069.1|  aquaporin                                              152   2e-42   Hordeum vulgare [barley]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    152   2e-42   Brassica rapa
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   152   3e-42   Brassica rapa
ref|XP_010098191.1|  Aquaporin PIP2-7                                   152   3e-42   Morus notabilis
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               152   3e-42   Populus euphratica
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        152   3e-42   
ref|XP_002316367.1|  putative aquaporin family protein                  152   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   152   4e-42   Nicotiana sylvestris
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   152   4e-42   Setaria italica
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        152   4e-42   Cucumis melo [Oriental melon]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   151   4e-42   Nicotiana sylvestris
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  151   4e-42   Nicotiana tabacum [American tobacco]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  151   4e-42   Pyrus communis
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           151   5e-42   Raphanus sativus
gb|AHG32323.1|  PIP2-2                                                  151   5e-42   Pisum sativum [garden pea]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               151   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   150   6e-42   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   151   6e-42   Cicer arietinum [garbanzo]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   151   6e-42   Brassica rapa
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  151   6e-42   Nicotiana tabacum [American tobacco]
ref|NP_001268058.1|  aquaporin-like                                     151   6e-42   Vitis vinifera
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          151   6e-42   Sorghum bicolor [broomcorn]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   150   8e-42   Nicotiana tomentosiformis
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              150   9e-42   Populus trichocarpa [western balsam poplar]
ref|NP_001274386.1|  aquaporin PIP2-1-like                              150   9e-42   Cucumis sativus [cucumbers]
emb|CAC82712.1|  major intrinsic protein 1                              150   9e-42   Populus tremula x Populus tremuloides
ref|NP_001105027.1|  aquaporin PIP2-6                                   150   1e-41   Zea mays [maize]
gb|ABO69705.2|  aquaporin PIP2                                          150   1e-41   Prunus humilis
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         150   1e-41   Ricinus communis
gb|AEQ20672.1|  PIP2;1                                                  150   1e-41   Karelinia caspia
ref|NP_001280185.1|  aquaporin PIP2-2                                   150   1e-41   Prunus mume [ume]
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   150   1e-41   Setaria italica
ref|NP_001274397.1|  aquaporin PIP2-1-like                              150   1e-41   Cucumis sativus [cucumbers]
emb|CDX91340.1|  BnaC04g08100D                                          150   1e-41   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   150   1e-41   Cucumis melo [Oriental melon]
gb|AAV80229.1|  aquaporin 2                                             150   2e-41   Aegiceras corniculatum
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             148   2e-41   
gb|ABI96814.1|  plasma membrane intrinsic protein                       150   2e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    150   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          150   2e-41   Sorghum bicolor [broomcorn]
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  150   2e-41   Mimosa pudica [sensitive-plant]
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               150   2e-41   Populus euphratica
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   150   2e-41   Setaria italica
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           150   2e-41   Raphanus sativus
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        150   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   150   2e-41   Fragaria vesca subsp. vesca
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               149   2e-41   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             149   2e-41   Populus trichocarpa [western balsam poplar]
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                149   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             149   3e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    149   3e-41   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  148   3e-41   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     149   3e-41   
ref|NP_001053335.1|  Os04g0521100                                       149   3e-41   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          149   3e-41   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          149   3e-41   
emb|CDX74984.1|  BnaA05g07300D                                          150   4e-41   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               149   4e-41   
gb|ABK93567.1|  unknown                                                 149   4e-41   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               149   4e-41   
gb|EMT03221.1|  hypothetical protein F775_43871                         149   4e-41   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               149   4e-41   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    149   5e-41   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             149   5e-41   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               149   5e-41   
emb|CDX67611.1|  BnaA07g16510D                                          149   5e-41   
gb|KDO44718.1|  hypothetical protein CISIN_1g0196812mg                  147   5e-41   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   149   6e-41   
gb|AFK33316.1|  unknown                                                 148   7e-41   
gb|ACJ85211.1|  unknown                                                 147   7e-41   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    148   7e-41   
gb|EMS51072.1|  Aquaporin PIP2-5                                        148   8e-41   
gb|ACU87558.1|  PIP protein                                             148   9e-41   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   146   9e-41   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          148   1e-40   
emb|CDX73446.1|  BnaC08g25570D                                          148   1e-40   
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    147   1e-40   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            148   1e-40   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               148   1e-40   
gb|KJB16798.1|  hypothetical protein B456_002G2484002                   142   1e-40   
gb|KJB26182.1|  hypothetical protein B456_004G229000                    147   2e-40   
emb|CDY07519.1|  BnaC06g15450D                                          147   2e-40   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             147   2e-40   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  147   2e-40   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             147   2e-40   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           147   2e-40   
gb|AEQ29857.1|  aquaporin PIP2                                          147   2e-40   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        147   2e-40   
gb|AJF34896.1|  plasma membrane intrinsic protein 2-2                   142   2e-40   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        147   2e-40   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      147   2e-40   
ref|NP_200874.1|  putative aquaporin PIP2-4                             147   2e-40   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               147   2e-40   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               147   2e-40   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   147   3e-40   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             147   3e-40   
gb|ADG03686.1|  aquaporin                                               147   3e-40   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        147   3e-40   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               147   3e-40   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     148   3e-40   
emb|CDY46759.1|  BnaA03g17030D                                          146   4e-40   
gb|ABX83874.1|  plasma membrane intrinsic protein                       146   4e-40   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             146   5e-40   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          146   5e-40   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          146   5e-40   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        146   6e-40   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  147   6e-40   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               146   6e-40   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  145   6e-40   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             146   6e-40   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        145   8e-40   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               145   9e-40   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              145   1e-39   
gb|AEY75244.1|  plasma membrane intrinsic protein                       145   1e-39   
ref|NP_191042.1|  putative aquaporin PIP2-5                             145   1e-39   
ref|NP_001059542.1|  Os07g0448100                                       145   1e-39   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          145   1e-39   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     147   2e-39   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             144   2e-39   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               145   2e-39   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                145   2e-39   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    145   2e-39   
gb|AGD98712.1|  aquaporin protein 9                                     144   2e-39   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             144   2e-39   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          145   2e-39   
gb|AGD98705.1|  aquaporin                                               144   2e-39   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               144   3e-39   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   144   3e-39   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        144   3e-39   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   144   3e-39   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              144   3e-39   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               144   3e-39   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               144   4e-39   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   144   4e-39   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             143   6e-39   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     144   6e-39   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     145   7e-39   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               144   8e-39   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             143   8e-39   
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          140   9e-39   
gb|ACV70050.1|  aquaporin PIP2;1                                        141   1e-38   
gb|AFQ23567.1|  aquaporin PIP2;2                                        143   1e-38   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               142   1e-38   
gb|AFQ23181.1|  aquaporin PIP2;2                                        142   1e-38   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               142   1e-38   
gb|ACV70048.1|  aquaporin PIP2;1                                        140   2e-38   
gb|ABH09328.1|  putative aquaporin                                      142   2e-38   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   142   2e-38   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              142   2e-38   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          142   2e-38   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             140   3e-38   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               141   3e-38   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   139   4e-38   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         141   4e-38   
gb|ACV70049.1|  aquaporin PIP2;1                                        139   5e-38   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       141   5e-38   
gb|ACR38689.1|  unknown                                                 139   6e-38   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                141   6e-38   
gb|ABM54183.1|  aquaporin                                               140   6e-38   
gb|ACV70051.1|  aquaporin PIP2;1                                        139   6e-38   
gb|EPS68613.1|  hypothetical protein M569_06155                         140   6e-38   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   140   7e-38   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   140   7e-38   
gb|ACV70053.1|  aquaporin PIP2;2                                        139   7e-38   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                139   8e-38   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   140   1e-37   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   140   1e-37   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              140   1e-37   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        140   1e-37   
gb|ACE60220.1|  plasma membrane aquaporin                               140   1e-37   
gb|ACB87734.1|  aquaporin                                               139   2e-37   
ref|NP_001059545.1|  Os07g0448800                                       140   2e-37   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          140   2e-37   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                139   2e-37   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               139   3e-37   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  139   3e-37   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       139   3e-37   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   139   4e-37   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        139   4e-37   
gb|ACV70052.1|  aquaporin PIP2;1                                        137   4e-37   
ref|NP_001267957.1|  aquaporin PIP2;2                                   138   5e-37   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               138   5e-37   
ref|NP_001105024.1|  aquaporin PIP2-1                                   138   5e-37   
gb|AAC16545.1|  aquaporin                                               138   5e-37   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        138   6e-37   
gb|AAO86707.1|  aquaporin                                               138   6e-37   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 138   7e-37   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        138   7e-37   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   138   7e-37   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   138   7e-37   
gb|ACV70057.1|  aquaporin PIP2;3                                        136   8e-37   
gb|ABH09327.1|  putative aquaporin                                      138   8e-37   
gb|ACV70056.1|  aquaporin PIP2;3                                        136   8e-37   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                138   9e-37   
gb|EMS55627.1|  Aquaporin PIP2-3                                        134   9e-37   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    137   1e-36   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          137   1e-36   
ref|NP_001105638.1|  aquaporin PIP2-2                                   137   1e-36   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     137   1e-36   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               137   1e-36   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   137   1e-36   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   137   1e-36   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          137   2e-36   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             135   2e-36   
gb|ACF79873.1|  unknown                                                 137   2e-36   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               136   3e-36   
gb|AFO63679.1|  plasma intrinsic protein 2                              136   3e-36   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               136   3e-36   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               136   3e-36   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   136   4e-36   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        136   4e-36   
gb|AAG44947.1|AF290620_1  putative PIP2                                 136   5e-36   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        135   5e-36   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    135   5e-36   
gb|ABI96815.1|  plasma membrane intrinsic protein                       135   5e-36   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               135   6e-36   
gb|ACV70054.1|  aquaporin PIP2;3                                        134   6e-36   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      135   7e-36   
ref|NP_001052292.1|  Os04g0233400                                       135   7e-36   
gb|KJB73581.1|  hypothetical protein B456_011G239500                    134   7e-36   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      133   7e-36   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   135   8e-36   
gb|AEF32110.1|  aquaporin PIP2                                          135   9e-36   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    135   1e-35   
gb|ACV70047.1|  aquaporin PIP2;1                                        133   1e-35   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             135   1e-35   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               134   1e-35   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   134   1e-35   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          134   1e-35   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      134   1e-35   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             134   2e-35   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             132   2e-35   
dbj|BAG06230.1|  plasma membrane intrinsic protein                      134   2e-35   
gb|ACG39551.1|  aquaporin PIP2.1                                        134   2e-35   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        134   2e-35   
gb|AFN53630.1|  putative aquaporin PIP2-8                               139   3e-35   
gb|AEC45512.1|  plasma membrane intrinsic protein                       133   3e-35   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        134   3e-35   
gb|AFH36336.1|  aquaporin PIP2;1                                        133   3e-35   
gb|AFN53685.1|  putative aquaporin PIP2-8                               138   3e-35   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    133   4e-35   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     133   4e-35   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 133   4e-35   
ref|NP_179277.1|  putative aquaporin PIP2-8                             133   4e-35   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             133   4e-35   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     133   5e-35   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     133   5e-35   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             133   5e-35   
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       133   6e-35   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   132   6e-35   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               132   6e-35   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   133   7e-35   
emb|CDY14415.1|  BnaC03g21800D                                          132   8e-35   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          132   8e-35   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          132   9e-35   
ref|XP_008442677.1|  PREDICTED: probable aquaporin PIP2-4               132   9e-35   
gb|ACB71281.1|  plasma membrane intrinsic protein                       132   1e-34   
gb|ACV66986.1|  plasma membrane aquaporin 2                             132   1e-34   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   132   1e-34   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  132   1e-34   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   132   1e-34   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             132   1e-34   
gb|AAB65787.1|  plasma membrane intrinsic protein                       132   1e-34   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   132   1e-34   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               132   1e-34   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             132   1e-34   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    132   1e-34   
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like          132   1e-34   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               132   1e-34   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                132   1e-34   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               132   2e-34   
ref|XP_008359252.1|  PREDICTED: aquaporin PIP2-2-like                   127   2e-34   



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQ AE+SAKDY DPPP+PLIDF+ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ D  AGG  CGGVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQADVDAGGDVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE V EQP E+SAKDYHDPPP+   D DELTKWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQP-EYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTDP AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQTDPDAGGADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE   +Q  EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 102/114 (89%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  EFSAKDY DPPP+PLIDFDELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEA  EQ  E+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIATLLFLYITILT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ D KAGG  CGGVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQADVKAGGDICGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE   EQP EFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   173 bits (438),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE   EQ AEFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   172 bits (436),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE+  E   E+SAKDYHDPPP+PLIDFDEL+ WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  GG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  61   VIGYKSQIDPAHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  114



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VE+V E+  EFSAKDY DPPP+PL+DF+ELT+WSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVESVTER-GEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY+HQ D  AGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYQHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   ++  E+SAKDY DPPP+PLID DELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY HQTD  AGG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYSHQTDANAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   167 bits (424),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQ--DCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E   EF+AKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKVQSDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
 emb|CDX10334.1| aquaporin [Coffea arabica]
Length=288

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  59   MTKDVE-AVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            M KDVE  V  +  EFSAKDYHDPPP+   D DELTKWSF+RA+IAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            TVIGYKHQTD  AGG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   TVIGYKHQTDATAGGDDCNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   ++  EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQ--DCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EFSAKDYHDPPP+PLID DEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKSQTDPDKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  239  vIGYKHQTDPKAGGQ--DCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score =   162 bits (411),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+P +D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   166 bits (421),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS+KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K GG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKVQSDVKNGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score =   162 bits (411),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 97/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-----EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllfly  223
            M KDVE   +Q       EFSAKDYHD PP+PLIDFDEL KWSFYRAVIAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  224  vtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VTVLTVIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VTVLTVIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            MTKD+E   EQ   AEFSAKDYHDPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQTDTTVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score =   162 bits (409),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+L YC AGISGGHINP VTF
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTF  112



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+P++DF+ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  61   VIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  116



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PL+D +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  QTD KAGG +CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYSIQTDVKAGGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E P EFSAKDYHDPPP+PLID +EL KWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVE-VAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  60   VIGYKSQTDPLKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  113



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  65   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvI  244
            +D+EA   +  EFSAKDY DPPP+PLID DELTKWS YRAVIAEFIATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  245  GYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            GYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  64   GYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  117



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V E   EFS KDYHDPPP+PLID DEL +WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKSQTDPNKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIA LLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  232
            MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  233  ltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            LTVIGYK QTDP     D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   LTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE       EFSAKDYHDPPP+PL+D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYKSQTDPIKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            TVIG+    D + GG++C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID  ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  116



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSDTKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D   GG D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+PLID +ELT WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V     EF AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKSQTDPAKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE+   + ++FSAKDYHDPPP+ LID DEL+KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVES--SEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G DCGGVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKRQTDSSHNGTDCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTVLT
Sbjct  1    MGKDVEA----ATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_002877918.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54177.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DYHDPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYHDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP  G QDC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQVDPDKGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +2

Query  14   HSRKYPFSSLISLAAMTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAV  187
            HS    F SL     MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA 
Sbjct  17   HSLNEHFHSLKH--NMTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAA  74

Query  188  IAEFIAtllflyvtvltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTA  361
            IAEFIATLLFLYVTVLTVIGYK QTDP     D  CGGVGILGIAWAFGGMIFIL YCTA
Sbjct  75   IAEFIATLLFLYVTVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTA  134

Query  362  GISGGHINPXVTF  400
            GISGGHINP VTF
Sbjct  135  GISGGHINPAVTF  147



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTV T
Sbjct  1    MGKDVEA----ATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  E+SAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPLKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVT  397
            TVIG+    D + GG++C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VT
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  114



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   161 bits (408),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDV     +   FSAKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVA----EQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVG LGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +2

Query  86   EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  265
            E   EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATL FLY+TVLTVIGYK QTD
Sbjct  6    EVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGYKTQTD  65

Query  266  PKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
               GG+DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  66   LAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAE---FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  229
            M KDVE   +Q      FSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  230  vltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VLT IGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VLTAIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  117



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>ref|XP_006291609.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
 gb|EOA24507.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
Length=287

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE VP +   F  +DY DPPP+P  D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKLQSDLKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D   GG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQIDADLGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 97/116 (84%), Gaps = 6/116 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+L YC AGISGGHINP VTF
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTF  112



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   + PA FSAKDYHDPPP+PL D  ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEC-ADPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKVQSDAVHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK +TD  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIETDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010426989.1| PREDICTED: aquaporin PIP2-1 [Camelina sativa]
Length=287

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  114



>ref|NP_190910.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 ref|NP_001030851.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 sp|P43286.1|PIP21_ARATH RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; Short=AtPIP2;1; AltName: Full=Plasma 
membrane intrinsic protein 2a; Short=PIP2a; Contains: RecName: 
Full=Aquaporin PIP2-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16195.1|AF428426_1 AT3g53420/F4P12_120 [Arabidopsis thaliana]
 emb|CAA53477.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 emb|CAB67649.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAK62634.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAK73268.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAL06973.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAL62366.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAM65406.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AEE79083.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 gb|AEE79084.1| aquaporin PIP2-1 [Arabidopsis thaliana]
Length=287

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  114



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  114



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 97/114 (85%), Gaps = 7/114 (6%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+V        +FSAKDY DPPP+PL+DF+EL +WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MTKEVT-------DFSAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLYVTILT  53

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ D  AGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  54   VIGYKHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  107



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  98   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  277
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  278  GQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 96/116 (83%), Gaps = 8/116 (7%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      EF+AKDY DPPP+PLID +EL KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEA------EFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVAT  54

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  55   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AEH76326.1| plasma membrane intrinsic protein 2A [Camelina sativa]
Length=287

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDVKAGGFDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAV  +   F ++DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVAGE--GFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VI YK QTD  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VICYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA  E   EF+AKDY DPPP+ LID +E+ KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEG-GEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDVNKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   159 bits (402),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDA  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 97/116 (84%), Gaps = 6/116 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D K+GGQ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  56   VIGYSSQSDTKSGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F A+DY DPPP+ L+D +ELT+WSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGGVAGEG-FPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKSQTDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>ref|XP_010504105.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
 ref|XP_010515832.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
Length=287

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE VP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  59   MTKDVEAVPE-QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            M KD+EA    +  E++AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA  60

Query  236  tvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            TVIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAG+SGGHINP VT 
Sbjct  61   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTL  117



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDYHDPPP+PLI  DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  98   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  277
             F+AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDVKAG  69

Query  278  GQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV   PEQ   FSAKDYHDPPP+PLID  EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDV---PEQ-GSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  TDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSTTDPALNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDY DPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--GERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V  Q  EF AKDY+DPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VT 
Sbjct  60   VIGYKSQTDPAKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTL  113



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFIL Y TAGISGGHINP VTF
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTF  112



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDTAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE    +   FS KDYHDPPP+P ID  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKNVEV--AERGSFSNKDYHDPPPAPFIDAAELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYSIQTDIKAGGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE   +   EFSAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  239  vIGYKHQTD--PKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD        DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  116



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 93/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDTTVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY+ QTD    G DC GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYRSQTDQAHNGGDCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +2

Query  89   QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDP  268
            +   FSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLTVIGYK Q+D 
Sbjct  7    EGGSFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKSQSDV  66

Query  269  KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            KAGG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  67   KAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDV     +   F AKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVT----EQGSFPAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 96/116 (83%), Gaps = 5/116 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     A F+AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MGKDMEA---GAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVAT  57

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  58   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 97/116 (84%), Gaps = 5/116 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQ---VSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP     D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       +F AKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEG-----GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP      CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  56   VIGYKSQTDPSKNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  109



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+VE   E  AEF+AKDYHDPPP+PLID+DELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEC-AEPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q++       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  60   VIGYKSQSEY----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|NP_181255.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 sp|P30302.1|PIP23_ARATH RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; Short=AtPIP2;3; AltName: Full=Plasma 
membrane intrinsic protein 2c; Short=PIP2c; AltName: Full=RD28-PIP; 
AltName: Full=TMP2C; AltName: Full=Water stress-induced 
tonoplast intrinsic protein; Short=WSI-TIP; Contains: RecName: 
Full=Aquaporin PIP2-3, N-terminally processed [Arabidopsis 
thaliana]
 dbj|BAA02520.1| transmembrane channel protein [Arabidopsis thaliana]
 gb|AAD18141.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
 gb|AAL36385.1| putative aquaporin, plasma membrane intrinsic protein 2C [Arabidopsis 
thaliana]
 gb|AAM20335.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|AEC09363.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 prf||1905411A transmembrane channel
Length=285

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E  P+    FSAKDY+DPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEVGPQ--GGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        + AKDY DPPP+PL+D +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  61   VIGYKSQSDTKANGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 97/116 (84%), Gaps = 5/116 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQG---SGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP     D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ AEF+AKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGAEFTAKDYQDPPPAPLFDTDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYSRQSDTSIEGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 96/114 (84%), Gaps = 6/114 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       +F AKDYHDPPP+PL+D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDK--GGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  108



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  59   VIGYKAQTDASAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  112



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF+AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>gb|EMS56715.1| putative aquaporin PIP2-2 [Triticum urartu]
Length=341

 Score =   157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P Q  EFS K Y  PPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKSYAAPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  115



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDKTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD++ V E  A  +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VT 
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTM  113



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTF  109



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E V EQ  E++AKDY DPPP+PL+D +ELTKWS YRA IAEFIAT+LFLYVTVLT
Sbjct  1    MAKDIE-VAEQ-GEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD   A G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  113



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG-----EGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  56   VIGYKIQSDTAAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  109



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 97/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPA---EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  229
            M KD+EA         E++AKDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+T
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYIT  60

Query  230  vltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            V TVIGYKHQTD  + G D  CGGVGILGIAWAFGGMIFIL YCTAG+SGGHINP VTF
Sbjct  61   VATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTF  119



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 99/116 (85%), Gaps = 10/116 (9%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KDVE V EQPA +SAKDYHDPPP+ LID +EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MSKDVE-VAEQPA-YSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQT--DPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QT  DP      CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQTTTDP------CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  108



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   ++    +A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVT  397
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VT
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  111



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE   EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEG-QEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 3/114 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    QP   +A+DY DPPP+PL+D +EL KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDLEG--AQP-PLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP   G DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  58   VIGYKSQTDPTMNGSDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  111



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTK+VEAV EQ AE+S KDY DPPP+PLIDF+ELTKWS YRAVIA+FIATLLFLY+TVL 
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIATLLFLYITVLI  60

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  +   K     CGGVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  61   VIGYNIKPMLKP-ASVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  113



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV----RGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+L YCTAGISG HINP VTF
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTF  109



>gb|AAM61438.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
Length=285

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----SDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 95/114 (83%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E V E  A   A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLE-VQEGRA---ARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKAQTDASAGGADCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        F+AKDYHDPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV-----GGFAAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  56   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>ref|XP_008345040.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=166

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E     PA    KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDIEVGSGNPA----KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVGI GIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKQQTDTTLNGNQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>gb|AHW81492.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-n]
 gb|AHW81510.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-c]
Length=531

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE     PA    +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEGFPA----RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E    +  +  AKDY DPPPSPL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDFETGGGEVRDV-AKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP   G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 94/116 (81%), Gaps = 6/116 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA     A    KDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEA----AAAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVAT  56

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVG+LGIAWAFGGMIFIL YCTAG+SGGHINP VTF
Sbjct  57   VIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTF  112



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDV     +   F AKDYHDPPP+PL D  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVA----EHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP   G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDPALKGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_004307390.1| PREDICTED: aquaporin PIP2-1 [Fragaria vesca subsp. vesca]
Length=285

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FSAKDY DPPP+PL D  ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYQDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D   GG  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQID--LGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        + A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----YQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010100853.1| Aquaporin PIP2-1 [Morus notabilis]
 gb|EXB85110.1| Aquaporin PIP2-1 [Morus notabilis]
Length=287

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 94/113 (83%), Gaps = 2/113 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKD+E    +   F+AKDYHDPPP+PL+D  EL KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDLEV--TERGSFTAKDYHDPPPAPLLDSAELGKWSFYRALIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVT  397
            VIGYK Q+D    G  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VT
Sbjct  59   VIGYKSQSDVNHNGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT  111



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD       CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  109



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        +SAKDY DPPP PLID +EL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDAALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  59   MTKDVEAVP-EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            MTKDVEAV  +Q  EF   DYHDPPP+PLID +EL KW FYRA+IAEF+ATLLFLYVT+L
Sbjct  1    MTKDVEAVSVQQQPEFLDIDYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLYVTIL  60

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            TVIG+   +D  AGG+ CGGVGILGIAW FGGMIFIL YCTA ISGGHINP VTF
Sbjct  61   TVIGHSRNSDLGAGGKSCGGVGILGIAWTFGGMIFILVYCTAPISGGHINPAVTF  115



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD       CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  109



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        +SAKDY DPPP PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E        +SAKDY DPPP PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQTDTALNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>dbj|BAK20223.1| plasma membrane intrinsic protein 2 [Ziziphus jujuba]
Length=281

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 89/105 (85%), Gaps = 0/105 (0%)
 Frame = +2

Query  86   EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  265
            + P  F  KDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVT+ TVIGYK Q+D
Sbjct  3    KDPEAFPGKDYHDPPPAPLFDTVELTKWSFYRALIAEFIATLLFLYVTIATVIGYKIQSD  62

Query  266  PKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
             K  G+ CGGVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  63   TKMNGEVCGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  107



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD++ V E  A   ++DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VT 
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTM  113



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTF  110



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTF  110



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  116



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  116



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +2

Query  56   AMTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  235
            AM KD++   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VL
Sbjct  12   AMAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVL  69

Query  236  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVT  397
            TVIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VT
Sbjct  70   TVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVT  123



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+  V E    F+ KDYHDPPP+PLID +ELTKWSF+RA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDM-GVAEH-GSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQIDVAHQGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 6/114 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+PL D DELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+        CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSAT----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  108



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 94/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD       CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  109



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD++   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLDV--QEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VT 
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTM  112



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  110  KDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQDC  289
            KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYK QTDP      C
Sbjct  12   KDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLNTDQC  71

Query  290  GGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            GGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  72   GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  108



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  9    MAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  64

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTDP   G+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  65   VIGYKSQTDPDHKGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  118



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 95/114 (83%), Gaps = 7/114 (6%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            MTKDVE   +   EFS KDYHDPPP+PLID DELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVETSGQ---EFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLT  57

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D       CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  58   VIGYKSQSDT----DPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  107



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 92/114 (81%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 7/114 (6%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+ EA      EF AKDYHDPPP+PL D +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEAEA----AGEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQID---GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  107



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVEA      E++ KDY DPPP+PL D++ELTKWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGH-GEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  115



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>gb|ABN11917.1| aquaporin [Cucurbita ficifolia]
Length=284

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 93/114 (82%), Gaps = 5/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD EA       F+AKDYHDPPP+PLID +E T+WSFYRA+IAEFI TLLFLYVTVLT
Sbjct  1    MAKDSEA-----GGFAAKDYHDPPPAPLIDVEEFTQWSFYRAIIAEFITTLLFLYVTVLT  55

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGY  Q+D   GG  CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  56   VIGYSSQSDVDNGGHICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  109



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 93/117 (79%), Gaps = 4/117 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA P    E+ AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  239  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  116



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   ++    +A+DY DPPP+PL+D +E  KWS YRAVIAEF+ TLLFLYV+VLT
Sbjct  1    MAKDLEV--QEGGATAARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+L YCTAG+SGGHINP VTF
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTF  112



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D KAGG DCGGVGILGI+WAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTKAGGDDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTF  110



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 96/114 (84%), Gaps = 6/114 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V  +  EF AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MAKDVEVV--EGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+       +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSAT----DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  108



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQIDGNA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_008449251.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Cucumis melo]
Length=287

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA       FS KDY DPPP+PLID  E  KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEA--GGHGGFSGKDYEDPPPAPLIDAHEFAKWSFYRAIIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K GG+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKVQSDVKNGGEICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA++AEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +2

Query  98   EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  277
            EF+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TVLTVIGYKHQTDP   
Sbjct  15   EFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPNVA  74

Query  278  GQD-CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            G D CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  75   GTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  116



>ref|XP_008449252.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Cucumis melo]
Length=284

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA       FS KDY DPPP+PLID  E  KWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEA--GGHGGFSGKDYEDPPPAPLIDAHEFAKWSFYRAIIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K GG+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKVQSDVKNGGEICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  110



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 6/114 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q++       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  108



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D KAGG +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ AEFSAKDY DPPP+PL D  E  KWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGAEFSAKDYQDPPPAPLFDSAEFKKWSLYRAVIAEFVATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGYK Q+D    G  +C GVG+LGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  60   IIGYKRQSDTDIKGNTECDGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 95/114 (83%), Gaps = 6/114 (5%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q++       CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  108



>ref|XP_004143248.1| PREDICTED: aquaporin PIP2-1-like [Cucumis sativus]
Length=251

 Score =   150 bits (379),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+EA       FS KDY DPPP+PLID  E  +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MPKDIEAGAH--GGFSGKDYEDPPPAPLIDPHEFAQWSFYRAIIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q+D K GG+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  59   VIGYKVQSDVKNGGETCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  112



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE V EQ  E+SAKDY DPPP+PL D  ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEYSAKDYQDPPPAPLFDPAELTKWSLYRAVIAEFIATLLFLYITVLT  59

Query  239  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            +IGY  QTD    G  +C GVG+LGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  60   IIGYSRQTDTTITGNTECDGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  114



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KDVE        F+A+DY DPPP+P  D +ELT+WS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLT  56

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK  +D  AGG +CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  57   VIGYKISSDTTAGGVECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  110



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 4/114 (4%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  9    MAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  64

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+L YCTAGISGGHINP VTF
Sbjct  65   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTF  118



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   151 bits (382),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M KD+E       + + KDYHDPPP+PL+D +EL  WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEVAGH--GDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLT  58

Query  239  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYK+QTDP   G +C GVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKNQTDPYHHGNECNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  112



>ref|XP_002461932.1| hypothetical protein SORBIDRAFT_02g010790 [Sorghum bicolor]
 gb|EER98453.1| hypothetical protein SORBIDRAFT_02g010790 [Sorghum bicolor]
Length=286

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +2

Query  59   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  238
            M K+V+    +     A+DY DPPP+PL+D DEL KWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKEVDVSTLEAG--GARDYIDPPPAPLVDIDELGKWSLYRAVIAEFVATLLFLYITVAT  58

Query  239  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILXYCTAGISGGHINPXVTF  400
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFIL YCTAGISGGHINP VTF
Sbjct  59   VIGYKHQTDATASGADAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552667832160