BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030G24

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      267   3e-84   Nicotiana tomentosiformis
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      266   1e-83   Nicotiana tomentosiformis
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      266   1e-83   Nicotiana sylvestris
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      261   5e-82   Nicotiana sylvestris
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      259   3e-81   Solanum tuberosum [potatoes]
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           259   4e-81   Solanum lycopersicum
emb|CDP21869.1|  unnamed protein product                                258   2e-80   Coffea canephora [robusta coffee]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      257   3e-80   Solanum tuberosum [potatoes]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           256   7e-80   Sesamum indicum [beniseed]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           253   3e-78   Malus domestica [apple tree]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      252   4e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              250   4e-78   
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      251   7e-78   Nelumbo nucifera [Indian lotus]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           251   1e-77   Pyrus x bretschneideri [bai li]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         250   1e-77   Jatropha curcas
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      249   2e-77   Solanum lycopersicum
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             249   4e-77   Prunus persica
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           248   1e-76   Vitis vinifera
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      247   3e-76   Cicer arietinum [garbanzo]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             247   4e-76   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      247   4e-76   Citrus sinensis [apfelsine]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      246   6e-76   Populus euphratica
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    246   9e-76   Tarenaya hassleriana [spider flower]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     245   1e-75   Populus trichocarpa [western balsam poplar]
gb|AFK49564.1|  unknown                                                 245   1e-75   Medicago truncatula
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   1e-75   Solanum tuberosum [potatoes]
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  244   2e-75   Medicago truncatula
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   2e-75   Populus euphratica
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      244   5e-75   Morus notabilis
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           243   1e-74   Brassica rapa
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           243   1e-74   Tarenaya hassleriana [spider flower]
emb|CDX77481.1|  BnaA07g06190D                                          243   1e-74   
emb|CDX85133.1|  BnaC07g07730D                                          243   1e-74   
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           242   2e-74   Fragaria vesca subsp. vesca
emb|CAN83418.1|  hypothetical protein VITISV_041351                     242   2e-74   Vitis vinifera
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    241   6e-74   Arabis alpina [alpine rockcress]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       240   1e-73   Gossypium hirsutum [American cotton]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    240   1e-73   Theobroma cacao [chocolate]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      240   2e-73   Cucumis sativus [cucumbers]
dbj|BAE71216.1|  putative NAD dependent epimerase                       239   3e-73   Trifolium pratense [peavine clover]
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           239   3e-73   Cucumis melo [Oriental melon]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    239   4e-73   Gossypium raimondii
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       239   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           239   5e-73   Camelina sativa [gold-of-pleasure]
gb|AAN60250.1|  unknown                                                 238   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             238   6e-73   Capsella rubella
emb|CDX92990.1|  BnaA03g37120D                                          238   6e-73   
emb|CDY53207.1|  BnaC03g74010D                                          238   6e-73   Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           238   6e-73   Brassica rapa
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             238   6e-73   Eutrema salsugineum [saltwater cress]
emb|CDY64583.1|  BnaCnng44170D                                          238   6e-73   Brassica napus [oilseed rape]
emb|CDY18087.1|  BnaA01g23480D                                          238   7e-73   Brassica napus [oilseed rape]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             238   8e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      237   2e-72   Brassica rapa
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       236   4e-72   Gossypium hirsutum [American cotton]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      236   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      236   8e-72   Glycine max [soybeans]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   235   2e-71   Citrus sinensis [apfelsine]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    232   8e-71   Glycine max [soybeans]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           231   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           231   6e-70   Eucalyptus grandis [rose gum]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             227   8e-69   Phaseolus vulgaris [French bean]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      227   3e-68   Glycine max [soybeans]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           226   3e-68   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       226   3e-68   Phaseolus vulgaris [French bean]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             225   8e-68   
gb|KJB28115.1|  hypothetical protein B456_005G028000                    216   6e-65   Gossypium raimondii
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    213   2e-63   
gb|ABK25339.1|  unknown                                                 211   6e-63   Picea sitchensis
gb|EYU31498.1|  hypothetical protein MIMGU_mgv1a008581mg                209   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          211   2e-62   Amborella trichopoda
gb|ABR16292.1|  unknown                                                 209   1e-61   Picea sitchensis
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative              200   1e-61   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           207   4e-61   Brassica rapa
emb|CDY67756.1|  BnaA03g56770D                                          207   4e-61   Brassica napus [oilseed rape]
emb|CDX95646.1|  BnaC03g25270D                                          206   7e-61   
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      206   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      206   3e-60   Phoenix dactylifera
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          204   5e-60   Amborella trichopoda
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             204   7e-60   Populus trichocarpa [western balsam poplar]
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           203   1e-59   Populus euphratica
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      202   1e-59   Nicotiana sylvestris
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      204   2e-59   Elaeis guineensis
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             202   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             203   2e-59   
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              203   2e-59   Selaginella moellendorffii
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             202   3e-59   Capsella rubella
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    202   4e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      202   4e-59   
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           202   4e-59   Camelina sativa [gold-of-pleasure]
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       201   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    202   7e-59   Phoenix dactylifera
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      201   7e-59   Solanum lycopersicum
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      201   8e-59   Populus euphratica
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     201   1e-58   Populus trichocarpa [western balsam poplar]
dbj|BAF00333.1|  putative nucleotide sugar epimerase                    197   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|AFK41785.1|  unknown                                                 192   1e-58   Medicago truncatula
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg                196   1e-58   Erythranthe guttata [common monkey flower]
emb|CDO97699.1|  unnamed protein product                                201   1e-58   Coffea canephora [robusta coffee]
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      200   1e-58   Solanum lycopersicum
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      200   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           200   2e-58   Brassica rapa
emb|CDP09891.1|  unnamed protein product                                201   2e-58   Coffea canephora [robusta coffee]
emb|CAN83831.1|  hypothetical protein VITISV_003974                     191   2e-58   Vitis vinifera
emb|CAN73017.1|  hypothetical protein VITISV_004389                     191   2e-58   Vitis vinifera
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                           195   3e-58   Glycine soja [wild soybean]
ref|XP_001761086.1|  predicted protein                                  199   4e-58   
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      199   4e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           199   5e-58   Elaeis guineensis
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      199   6e-58   Solanum tuberosum [potatoes]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      199   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      199   6e-58   Solanum lycopersicum
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      199   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      198   7e-58   Cicer arietinum [garbanzo]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      199   1e-57   Elaeis guineensis
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      198   1e-57   Glycine max [soybeans]
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           198   1e-57   Tarenaya hassleriana [spider flower]
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           197   2e-57   Medicago truncatula
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             197   2e-57   Eutrema salsugineum [saltwater cress]
emb|CAN73016.1|  hypothetical protein VITISV_004388                     197   2e-57   Vitis vinifera
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           197   2e-57   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      196   2e-57   Solanum tuberosum [potatoes]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      198   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      196   3e-57   Nicotiana tomentosiformis
gb|KGN57287.1|  hypothetical protein Csa_3G176330                       192   3e-57   Cucumis sativus [cucumbers]
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    197   3e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63064.1|  BnaAnng18570D                                          197   3e-57   Brassica napus [oilseed rape]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      197   3e-57   Nicotiana sylvestris
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         197   4e-57   Jatropha curcas
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      196   4e-57   Phoenix dactylifera
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      196   4e-57   Nicotiana tomentosiformis
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    196   4e-57   
gb|EMT26004.1|  UDP-glucuronate 4-epimerase 4                           189   5e-57   
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             196   5e-57   Prunus persica
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       196   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           196   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           196   6e-57   Cucumis melo [Oriental melon]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             196   7e-57   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              196   7e-57   
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       196   8e-57   Gossypium hirsutum [American cotton]
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      196   9e-57   
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    196   1e-56   Arabis alpina [alpine rockcress]
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                           191   1e-56   Glycine soja [wild soybean]
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           196   1e-56   Nicotiana tomentosiformis
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      196   1e-56   
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           195   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    195   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           195   1e-56   Elaeis guineensis
gb|KJB09908.1|  hypothetical protein B456_001G174300                    195   2e-56   Gossypium raimondii
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           195   2e-56   Prunus mume [ume]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             194   2e-56   Capsella rubella
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           195   2e-56   Eucalyptus grandis [rose gum]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      194   2e-56   
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      195   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    194   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      194   3e-56   Morus notabilis
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           194   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      194   3e-56   Glycine max [soybeans]
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      193   3e-56   Tarenaya hassleriana [spider flower]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         194   3e-56   Jatropha curcas
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      194   4e-56   Solanum tuberosum [potatoes]
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           194   4e-56   Prunus mume [ume]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             194   4e-56   Phaseolus vulgaris [French bean]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      194   4e-56   Nicotiana sylvestris
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           194   5e-56   Phoenix dactylifera
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    194   5e-56   Arabis alpina [alpine rockcress]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             194   6e-56   Citrus clementina [clementine]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             193   6e-56   Citrus clementina [clementine]
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      193   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      192   1e-55   
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           192   1e-55   Sesamum indicum [beniseed]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           192   1e-55   Solanum lycopersicum
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              192   1e-55   Ricinus communis
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           190   1e-55   Glycine soja [wild soybean]
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      192   1e-55   Cucumis sativus [cucumbers]
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      192   1e-55   Sesamum indicum [beniseed]
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           190   2e-55   Vitis vinifera
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             192   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      191   2e-55   Vitis vinifera
gb|KJB24820.1|  hypothetical protein B456_004G162700                    192   2e-55   Gossypium raimondii
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             192   2e-55   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           192   3e-55   Medicago truncatula
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           192   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           192   3e-55   
gb|KJB41101.1|  hypothetical protein B456_007G090500                    192   3e-55   Gossypium raimondii
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   3e-55   Populus euphratica
ref|XP_001769370.1|  predicted protein                                  192   3e-55   
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      191   4e-55   Vitis vinifera
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      191   4e-55   Vitis vinifera
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    191   4e-55   
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           191   5e-55   Prunus mume [ume]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             191   5e-55   Prunus persica
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   5e-55   Glycine max [soybeans]
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           191   5e-55   
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           191   5e-55   Pyrus x bretschneideri [bai li]
gb|EPS60141.1|  hypothetical protein M569_14661                         191   6e-55   Genlisea aurea
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   6e-55   Setaria italica
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   6e-55   Glycine max [soybeans]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      191   6e-55   Sesamum indicum [beniseed]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   7e-55   Oryza brachyantha
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           191   7e-55   Nicotiana tomentosiformis
emb|CDP21367.1|  unnamed protein product                                191   7e-55   Coffea canephora [robusta coffee]
gb|EPS72617.1|  hypothetical protein M569_02133                         191   9e-55   Genlisea aurea
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      190   9e-55   Prunus mume [ume]
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           191   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      190   1e-54   Solanum tuberosum [potatoes]
ref|NP_001048359.1|  Os02g0791500                                       190   1e-54   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             189   1e-54   Prunus persica
dbj|BAJ85817.1|  predicted protein                                      190   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      190   1e-54   Cicer arietinum [garbanzo]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           190   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             190   1e-54   Phaseolus vulgaris [French bean]
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     190   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           190   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      190   1e-54   Cicer arietinum [garbanzo]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           190   2e-54   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      190   2e-54   
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           190   2e-54   Nicotiana tomentosiformis
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        190   2e-54   Medicago truncatula
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           189   2e-54   Nicotiana sylvestris
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                189   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           189   2e-54   Populus euphratica
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          189   2e-54   Amborella trichopoda
ref|XP_001759693.1|  predicted protein                                  189   2e-54   
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           189   2e-54   Fragaria vesca subsp. vesca
gb|KJB76605.1|  hypothetical protein B456_012G096800                    189   3e-54   Gossypium raimondii
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   189   3e-54   Citrus sinensis [apfelsine]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         189   3e-54   Jatropha curcas
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           189   3e-54   Fragaria vesca subsp. vesca
ref|XP_001777338.1|  predicted protein                                  189   3e-54   
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           189   4e-54   Medicago truncatula
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           189   4e-54   
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                188   5e-54   Erythranthe guttata [common monkey flower]
emb|CAN60968.1|  hypothetical protein VITISV_008097                     188   5e-54   Vitis vinifera
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           188   5e-54   Cucumis melo [Oriental melon]
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      188   5e-54   Vitis vinifera
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                188   6e-54   Erythranthe guttata [common monkey flower]
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           188   7e-54   Solanum lycopersicum
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      188   7e-54   Solanum tuberosum [potatoes]
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          188   7e-54   Sorghum bicolor [broomcorn]
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       188   8e-54   Gossypium hirsutum [American cotton]
ref|XP_001751991.1|  predicted protein                                  188   8e-54   
ref|XP_001754001.1|  predicted protein                                  188   9e-54   
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      188   1e-53   Phoenix dactylifera
dbj|BAJ88176.1|  predicted protein                                      189   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          188   1e-53   Sorghum bicolor [broomcorn]
ref|NP_001142515.1|  hypothetical protein                               187   1e-53   Zea mays [maize]
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          187   1e-53   Amborella trichopoda
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    187   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      187   1e-53   Cucumis melo [Oriental melon]
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             187   1e-53   Populus trichocarpa [western balsam poplar]
ref|NP_001105911.1|  LOC732831                                          187   1e-53   Zea mays [maize]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    187   2e-53   Zea mays [maize]
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           187   2e-53   Sesamum indicum [beniseed]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      187   2e-53   Solanum tuberosum [potatoes]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           187   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      187   2e-53   Morus notabilis
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           187   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           187   2e-53   Solanum lycopersicum
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           186   3e-53   Malus domestica [apple tree]
ref|XP_001761984.1|  predicted protein                                  186   3e-53   
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           186   4e-53   Eucalyptus grandis [rose gum]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    186   5e-53   Arabis alpina [alpine rockcress]
dbj|BAH20281.1|  AT4G30440                                              181   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      186   6e-53   Zea mays [maize]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           186   6e-53   Brassica rapa
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      186   6e-53   Brachypodium distachyon [annual false brome]
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      185   7e-53   Cucumis melo [Oriental melon]
emb|CDX97356.1|  BnaA02g21470D                                          185   7e-53   
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      185   7e-53   Brassica rapa
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      186   7e-53   Tarenaya hassleriana [spider flower]
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      184   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           185   8e-53   Pyrus x bretschneideri [bai li]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      185   8e-53   
emb|CDY70926.1|  BnaCnng70410D                                          185   8e-53   Brassica napus [oilseed rape]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      185   9e-53   Cucumis sativus [cucumbers]
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      184   9e-53   Populus euphratica
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      184   9e-53   
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      185   1e-52   
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           185   1e-52   
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      185   1e-52   
emb|CDY04398.1|  BnaC02g28500D                                          184   2e-52   
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      185   2e-52   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    185   2e-52   
ref|NP_001049561.1|  Os03g0249500                                       185   3e-52   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           181   3e-52   
gb|KJB23560.1|  hypothetical protein B456_004G105200                    181   3e-52   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      184   3e-52   
dbj|BAK06545.1|  predicted protein                                      184   3e-52   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      183   3e-52   
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      185   4e-52   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       183   5e-52   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    182   5e-52   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             183   5e-52   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      183   6e-52   
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           183   6e-52   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      183   6e-52   
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      183   6e-52   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      183   7e-52   
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   7e-52   
gb|KJB25649.1|  hypothetical protein B456_004G202200                    182   8e-52   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   8e-52   
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      182   1e-51   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      182   1e-51   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                           182   1e-51   
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       182   1e-51   
ref|NP_001057015.1|  Os06g0187200                                       179   2e-51   
gb|EEC83913.1|  hypothetical protein OsI_29968                          177   2e-51   
emb|CDY39205.1|  BnaA03g50170D                                          181   2e-51   
ref|XP_001767292.1|  predicted protein                                  182   2e-51   
emb|CDX72242.1|  BnaC07g42640D                                          181   2e-51   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           181   3e-51   
gb|KJB27035.1|  hypothetical protein B456_004G273500                    181   4e-51   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             181   4e-51   
ref|NP_001147328.1|  protein capI                                       182   5e-51   
dbj|BAJ86203.1|  predicted protein                                      181   6e-51   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    180   7e-51   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    180   9e-51   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          179   1e-50   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    180   1e-50   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      179   1e-50   
gb|EAY99954.1|  hypothetical protein OsI_21957                          180   1e-50   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                179   2e-50   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    179   2e-50   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          180   3e-50   
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           179   4e-50   
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             179   4e-50   
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           178   4e-50   
gb|KJB43946.1|  hypothetical protein B456_007G225300                    178   5e-50   
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           178   5e-50   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           178   5e-50   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           179   6e-50   
ref|NP_001062295.1|  Os08g0526100                                       179   6e-50   
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      173   8e-50   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      178   1e-49   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             176   1e-49   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   176   1e-49   
ref|XP_008776445.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      169   1e-49   
gb|EEC83914.1|  hypothetical protein OsI_29969                          179   1e-49   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   2e-49   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      177   3e-49   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      176   3e-49   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          178   4e-49   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          176   5e-49   
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           175   5e-49   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           175   7e-49   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           176   8e-49   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         174   8e-49   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   1e-48   
ref|XP_001781238.1|  predicted protein                                  174   1e-48   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    174   1e-48   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             174   1e-48   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    174   1e-48   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    174   2e-48   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      174   2e-48   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    174   2e-48   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    173   2e-48   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           174   2e-48   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    173   2e-48   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             173   4e-48   
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                           171   4e-48   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      172   5e-48   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      173   5e-48   
emb|CBI24539.3|  unnamed protein product                                169   7e-48   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      172   1e-47   
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      168   1e-47   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      172   1e-47   
dbj|BAJ99315.1|  predicted protein                                      172   2e-47   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      171   3e-47   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              170   4e-47   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             170   5e-47   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      170   5e-47   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      170   6e-47   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             169   8e-47   
gb|AAK93670.1|  putative nucleotide sugar epimerase                     169   8e-47   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       169   8e-47   
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    169   9e-47   
emb|CDX94504.1|  BnaC09g23320D                                          169   9e-47   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      170   1e-46   
emb|CDX86716.1|  BnaA09g21060D                                          169   1e-46   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          170   1e-46   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      169   1e-46   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    169   1e-46   
gb|EEC84839.1|  hypothetical protein OsI_31939                          170   1e-46   
ref|NP_001063595.1|  Os09g0504000                                       170   2e-46   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    169   2e-46   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      169   2e-46   
gb|EPS64795.1|  hypothetical protein M569_09984                         166   2e-46   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    169   3e-46   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      169   3e-46   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    168   3e-46   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    167   4e-46   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         169   4e-46   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           170   5e-46   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      167   7e-46   
emb|CBI22155.3|  unnamed protein product                                159   9e-45   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        164   9e-45   
emb|CBI18845.3|  unnamed protein product                                158   4e-44   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           161   1e-43   
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                      154   5e-43   
ref|XP_006386474.1|  hypothetical protein POPTR_0002s11750g             151   4e-42   
gb|EMT33438.1|  UDP-glucuronate 4-epimerase 6                           150   5e-41   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              152   1e-40   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              149   2e-39   
ref|XP_001416501.1|  predicted protein                                  148   2e-39   
ref|XP_002504144.1|  predicted protein                                  145   4e-38   
ref|XP_001422311.1|  predicted protein                                  142   2e-37   
emb|CEG01274.1|  Nucleotide sugar epimerase                             143   4e-37   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          143   5e-37   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      142   3e-36   
ref|XP_007512695.1|  predicted protein                                  142   4e-36   
gb|KJB27036.1|  hypothetical protein B456_004G273500                    139   8e-36   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      132   5e-33   
ref|XP_003060215.1|  protein arginine methyltransferase                 130   8e-33   
ref|XP_010113442.1|  UDP-glucuronate 4-epimerase 3                      127   6e-32   
gb|AEW07796.1|  hypothetical protein 0_11781_01                         121   6e-31   
gb|AFG68267.1|  hypothetical protein 0_11781_01                         120   1e-30   
gb|AFG68265.1|  hypothetical protein 0_11781_01                         119   3e-30   
gb|KDD76295.1|  hypothetical protein H632_c279p0                        114   4e-28   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase                117   6e-28   
ref|WP_029408437.1|  hypothetical protein                               114   1e-26   
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                113   2e-26   
ref|WP_027083114.1|  capsular biosynthesis protein CpsI                 112   3e-26   
ref|WP_017366130.1|  NAD dependent epimerase/dehydratase                112   6e-26   
gb|AEW08736.1|  hypothetical protein CL1437Contig1_03                   105   6e-26   
ref|WP_010961674.1|  capsular polysaccharide biosynthesis protein I     111   8e-26   
ref|WP_019572150.1|  hypothetical protein                               108   8e-26   
ref|WP_018867984.1|  hypothetical protein                               108   1e-25   
gb|ERT06558.1|  polysaccharide biosynthesis family protein              110   1e-25   
ref|WP_040484163.1|  capsular biosynthesis protein CpsI                 110   1e-25   
ref|WP_015222004.1|  NAD-dependent epimerase/dehydratase                110   1e-25   
ref|WP_006509051.1|  nucleoside-diphosphate-sugar epimerase             110   2e-25   
ref|WP_012954589.1|  NAD-dependent epimerase                            110   2e-25   
ref|WP_026609545.1|  capsular biosynthesis protein CpsI                 110   2e-25   
gb|AEW08737.1|  hypothetical protein CL1437Contig1_03                   104   2e-25   
ref|WP_037224794.1|  capsular biosynthesis protein CpsI                 110   2e-25   
ref|XP_728710.1|  NAD dependent epimerase/dehydratase                   111   2e-25   
emb|CAJ74935.1|  strongly similar to UDP-glucuronate 5'-epimerase       110   3e-25   
ref|WP_041227251.1|  capsular biosynthesis protein CpsI                 110   3e-25   
ref|WP_019592959.1|  hypothetical protein                               106   3e-25   
ref|WP_015118268.1|  nucleoside-diphosphate-sugar epimerase             109   5e-25   
ref|WP_019571808.1|  hypothetical protein                               105   5e-25   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI                 109   5e-25   
ref|WP_020008823.1|  hypothetical protein                               105   6e-25   
ref|WP_044606580.1|  capsular biosynthesis protein CpsI                 108   6e-25   
ref|WP_009631239.1|  nucleoside-diphosphate-sugar epimerase             108   7e-25   
ref|WP_020879618.1|  NAD-dependent epimerase/dehydratase                108   7e-25   
ref|WP_020008853.1|  NAD dependent epimerase/dehydratase                107   8e-25   
ref|WP_011737215.1|  NAD-dependent epimerase/dehydratase                108   8e-25   
ref|WP_014415759.1|  UDP-glucuronate 5'-epimerase                       108   8e-25   
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase                108   9e-25   
ref|WP_006619621.1|  NAD-dependent epimerase                            108   9e-25   
ref|WP_013250660.1|  UDP-glucuronate 5'-epimerase                       108   9e-25   
ref|WP_022953707.1|  NAD-dependent epimerase                            108   9e-25   
gb|EPS73152.1|  hypothetical protein M569_01604                         108   1e-24   
ref|WP_012489003.1|  NAD dependent epimerase/dehydratase family s...    108   1e-24   
ref|WP_007639465.1|  NAD dependent epimerase/dehydratase family s...    108   1e-24   
ref|WP_002708148.1|  NAD-dependent epimerase                            108   1e-24   
ref|WP_039643797.1|  capsular biosynthesis protein CpsI                 108   1e-24   
ref|WP_028313401.1|  capsular biosynthesis protein CpsI                 108   1e-24   
ref|WP_004513290.1|  NAD-dependent epimerase/dehydratase                108   1e-24   
ref|WP_019571974.1|  hypothetical protein                               104   1e-24   
ref|WP_019563259.1|  hypothetical protein                               104   2e-24   
ref|WP_029681351.1|  capsular biosynthesis protein CpsI                 103   2e-24   
ref|WP_010942881.1|  UDP-galacturonate 4-epimerase                      107   2e-24   
ref|WP_044840054.1|  capsular biosynthesis protein CpsI                 107   2e-24   
ref|WP_027403384.1|  capsular biosynthesis protein CpsI                 107   2e-24   
ref|WP_040054469.1|  capsular biosynthesis protein CpsI                 107   2e-24   
ref|WP_018138740.1|  hypothetical protein                               104   2e-24   
ref|WP_019612090.1|  hypothetical protein                               104   2e-24   
ref|WP_011713745.1|  NAD-dependent epimerase/dehydratase                107   2e-24   
ref|WP_022948290.1|  NAD dependent epimerase/dehydratase                107   2e-24   
ref|WP_019564031.1|  hypothetical protein                               105   2e-24   
ref|WP_029733863.1|  hypothetical protein                               107   2e-24   
ref|WP_018950679.1|  NAD dependent epimerase/dehydratase                107   2e-24   
ref|WP_018865970.1|  hypothetical protein                               105   2e-24   
ref|WP_018864896.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    107   2e-24   
ref|WP_019025240.1|  MULTISPECIES: hypothetical protein                 103   3e-24   
ref|WP_041274008.1|  capsular biosynthesis protein CpsI                 107   3e-24   
ref|WP_012110833.1|  NAD-dependent epimerase/dehydratase                107   3e-24   
gb|ACN16058.1|  CapD1                                                   107   3e-24   
ref|WP_019023983.1|  MULTISPECIES: hypothetical protein                 103   3e-24   
ref|WP_018867265.1|  MULTISPECIES: hypothetical protein                 105   3e-24   
ref|WP_019572185.1|  hypothetical protein                               104   3e-24   
dbj|BAD43886.1|  putative nucleotide sugar epimerase                    101   3e-24   
ref|WP_020160621.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    107   4e-24   
ref|WP_018868756.1|  hypothetical protein                               104   4e-24   
ref|WP_018860473.1|  hypothetical protein                               104   4e-24   
ref|WP_028579847.1|  capsular biosynthesis protein CpsI                 106   4e-24   
ref|WP_019568710.1|  hypothetical protein                               105   4e-24   
ref|WP_020083694.1|  hypothetical protein                               106   4e-24   
ref|WP_012610830.1|  NAD-dependent epimerase/dehydratase                106   4e-24   
ref|WP_009787825.1|  NAD-dependent epimerase                            106   4e-24   
ref|WP_019628636.1|  NAD dependent epimerase/dehydratase                106   4e-24   
ref|WP_020400341.1|  hypothetical protein                               106   4e-24   
ref|WP_022732996.1|  NAD dependent epimerase/dehydratase                106   5e-24   
ref|WP_015335618.1|  Protein CapI                                       106   5e-24   
emb|CCQ61659.1|  dTDP-glucose 4,6-dehydratase                           103   5e-24   



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 3/158 (2%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  296  YFFFTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSVRKLVSILENLLS+KAKKNVVKMPRNGDVPFTHANVSLA +DFGYK
Sbjct  356  QLRVYNLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPRNGDVPFTHANVSLALRDFGYK  415

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  474
            PTTDLS GLRKFVKWYVSYYGIQSRVK E     +SDD
Sbjct  416  PTTDLSIGLRKFVKWYVSYYGIQSRVKKE---NDRSDD  450



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 151/159 (95%), Gaps = 1/159 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  295  YFFFTKDMTQGKPINVYVTQDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  354

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  355  QLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYK  414

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL-HPTHQSDD  474
            PTTDLSSGLRKFVKWY+SYYGIQS+V  EL  P   S+D
Sbjct  415  PTTDLSSGLRKFVKWYLSYYGIQSKVNKELDSPNDHSED  453



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 152/159 (96%), Gaps = 1/159 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM QGKPINVYVTQ++KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  295  YFFFTKDMTQGKPINVYVTQDNKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  354

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  355  QLRVYNLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYK  414

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELH-PTHQSDD  474
            PTTDLSSGLRKFVKWY+SYYGIQS+V  EL+ P   S+D
Sbjct  415  PTTDLSSGLRKFVKWYLSYYGIQSKVNKELNSPNDHSED  453



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 146/158 (92%), Gaps = 3/158 (2%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  296  YFFFTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSVRKLV ILENLL+IKAKKNVVKMPRNGDVPFTHANVSLA +DFGYK
Sbjct  356  QLRVYNLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNGDVPFTHANVSLALRDFGYK  415

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  474
            PTTDLS GLRKFVKWYVSYYGIQ RVK E      SDD
Sbjct  416  PTTDLSIGLRKFVKWYVSYYGIQPRVKKE---NDHSDD  450



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGK INVYVTQ+D+EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  295  YFFFTKDMIQGKSINVYVTQDDREVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  354

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILENLL++KAKKNV+KMPRNGDVPFTHANVSLA +DFGYK
Sbjct  355  QLRVYNLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPRNGDVPFTHANVSLALRDFGYK  414

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTTDLSSGLRKFVKWYVSYYGIQ RVK
Sbjct  415  PTTDLSSGLRKFVKWYVSYYGIQPRVK  441



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/149 (90%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  299  YFFFTKDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  358

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILENLL++KAKK  +KMPRNGDVPFTHANVSLA +DFGYK
Sbjct  359  QLRVYNLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPRNGDVPFTHANVSLALRDFGYK  418

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLSSGLRKFVKWYVSYYGIQSRVK E
Sbjct  419  PTTDLSSGLRKFVKWYVSYYGIQSRVKKE  447



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK IN+YVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+ PA
Sbjct  294  YFFFTKDILQGKGINLYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRAPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV KLVSILE LL++KAKK+V+KMPRNGDVP+THANVSLAYKDFGY+
Sbjct  354  QLRVYNLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYQ  413

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  465
            PTTDLS+GLRKFVKWY+SYYGIQS+VK E+  T++
Sbjct  414  PTTDLSTGLRKFVKWYLSYYGIQSKVKKEIDATNE  448



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPA
Sbjct  299  YFFFTKDMVQGKPINVYVTQDDKEVARDFTYIDDIVKGCIGSLDTAEKSTGSGGKKKGPA  358

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV KLV+ILENLL++KAKKNV+KMPRNGDVPFTHAN++LA KDFGYK
Sbjct  359  QLRVYNLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPRNGDVPFTHANITLAKKDFGYK  418

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDLSSGLRKFVKWYVSYYGIQS+
Sbjct  419  PTTDLSSGLRKFVKWYVSYYGIQSK  443



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 2/160 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK INVYVTQEDKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PA
Sbjct  300  YFFFTKDILQGKGINVYVTQEDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRAPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNT+PV+V KLV ILE+LL++KAKK+V+KMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  360  QLRVYNLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPRNGDVPFTHANVSLAYRDFGYK  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPT--HQSDD  474
            PTTDL++GLRKFVKWYVSYYGI+SR K   H +    SDD
Sbjct  420  PTTDLAAGLRKFVKWYVSYYGIESRAKKGFHSSTNEHSDD  459



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPINV+ T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  302  YFFFTKDILQGKPINVFKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYK
Sbjct  362  QLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL+SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  422  PTTDLASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   252 bits (643),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI +Y TQ+D+EVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  293  YFFFTKDILQGKPITIYQTQDDREVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPVSV KLVSILE LL++ AKKN++KMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  353  QLRIYNLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPRNGDVPFTHANVSLAYRDFGYK  412

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQSR   E
Sbjct  413  PTTDLATGLRKFVKWYVSYYGIQSRANKE  441



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y TQ+ K+VARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  243  YFFFTKDILQGKQIDIYQTQDQKQVARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPA  302

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLVSILENLL+ KAKK+V+KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  303  QLRVYNLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYK  362

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLSSGLRKFVKWYV YYGIQ++VKT+
Sbjct  363  PTTDLSSGLRKFVKWYVGYYGIQTKVKTQ  391



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  294  YFFFTKDILQGKPITIYRTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPVSV KLVSILE  LS+KAKKNVVKMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  354  QLRIYNLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPRNGDVPFTHANVSLAYRDFGYK  413

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLS+GLRKFVKWYV YYGI S+   E
Sbjct  414  PTTDLSTGLRKFVKWYVGYYGIHSKANKE  442



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  302  YFFFTKDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAQKSTGSGGKKKGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYK
Sbjct  362  QLRIYNLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL+SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  422  PTTDLASGLRKFVKWYVSYYGIESRVKKEM  451



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 143/149 (96%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GKPI+VY TQ++K+VARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  299  YFFFTKDILHGKPIDVYQTQDEKQVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  358

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLV+ILE+LL+ KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  359  QLRVYNLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPRNGDVPYTHANVSLAYKDFGYK  418

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLSSGLRKFVKWYVSYYGIQ+RVK E
Sbjct  419  PTTDLSSGLRKFVKWYVSYYGIQTRVKKE  447



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 144/147 (98%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPA
Sbjct  289  YFFFTKDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MPRNGDVPFTHANVSLAY+DFGYK
Sbjct  347  QLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPRNGDVPFTHANVSLAYRDFGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTT+LSSGLRKFVKWY+SYYGIQ+R+K
Sbjct  407  PTTNLSSGLRKFVKWYLSYYGIQARIK  433



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  298  YFFFTKDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILE LL  KAKK+V+KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  358  QLRIYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYK  417

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL+SGLRKFVKWYVSYYGI +RVK E+
Sbjct  418  PTTDLASGLRKFVKWYVSYYGIDTRVKREM  447



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  291  YFFFTKDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  351  QLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            P+TDL++GLR+FVKWYVSYYGIQ+RVK E
Sbjct  411  PSTDLATGLRRFVKWYVSYYGIQTRVKKE  439



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK ++VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  291  YFFFTKDILHGKTVDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV+LAYKDFGYK
Sbjct  351  QLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTLAYKDFGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  453
            PTTDL++GLRKFVKWYV YYGIQSR+K E H
Sbjct  411  PTTDLATGLRKFVKWYVRYYGIQSRLKKENH  441



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGS GKK+GPA
Sbjct  311  YFFFTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSRGKKRGPA  370

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYK
Sbjct  371  QLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYK  430

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  431  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGSGGKK+GPA
Sbjct  311  YFFFTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSGGKKRGPA  370

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYK
Sbjct  371  QLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYK  430

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  431  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  296  YFFFTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYK
Sbjct  356  QLRVYNLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYK  415

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTTDL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  416  PTTDLATGLRKFVKWYVNYYGIQTRVK  442



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   246 bits (627),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  304  YFFFTKDILQGKSIDVYKTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL++GLRKFVKWYV YYGIQ RVK E+
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKREI  453



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  297  YFFFTKDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  356

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYK
Sbjct  357  QLRVYNLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYK  416

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            P+TDL++GLRKFVKWYV+YYGIQ+RVK
Sbjct  417  PSTDLATGLRKFVKWYVNYYGIQTRVK  443



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTKDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YK
Sbjct  351  QLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQSR+K E
Sbjct  411  PTTDLATGLRKFVKWYVRYYGIQSRLKKE  439



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 143/147 (97%), Gaps = 2/147 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDM+QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPA
Sbjct  290  YFFFTKDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPVSV+KLV+ILENLL+IKAKKN+++MP+NGDVPFTHANVSLAY+DFGY+
Sbjct  348  QLRVYNLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPQNGDVPFTHANVSLAYRDFGYR  407

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTT+LSSGLRKFVKWY+SYYG+Q+R K
Sbjct  408  PTTNLSSGLRKFVKWYLSYYGMQARTK  434



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTKDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YK
Sbjct  351  QLRIYNLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQSR+K E
Sbjct  411  PTTDLATGLRKFVKWYVRYYGIQSRLKKE  439



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGS GKKKGPA
Sbjct  296  YFFFTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSSGKKKGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLVSILE LLS KA+K+V+KMPRNGDVP+THANV+LAY+DFGYK
Sbjct  356  QLRVYNLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYK  415

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTTDL++GLRKFVKWYV YYGIQ+RVK
Sbjct  416  PTTDLATGLRKFVKWYVDYYGIQTRVK  442



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  297  YFFFTKDILQGKTIDVYKTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPA  356

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLV ILE+LL+ KAKK+V++MPRNGDVP+THANVSLA +DFGYK
Sbjct  357  QLRIYNLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPRNGDVPYTHANVSLANRDFGYK  416

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLS+GLRKFV+WYVSYYGIQ+RVK E
Sbjct  417  PTTDLSTGLRKFVRWYVSYYGIQTRVKKE  445



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  298  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  358  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  417

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  418  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  446



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  301  YFFFTKDILQGKSIDIYQTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  360

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  361  QLRVYNLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYK  420

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            P TDL++GLRKFVKWYV YYGI  RVK E+
Sbjct  421  PATDLAAGLRKFVKWYVGYYGIHPRVKREI  450



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  297  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  356

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  357  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  416

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  417  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  445



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  300  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  360  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  420  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  448



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY T +DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  300  YFFFTKDILQGKTIDVYKTVDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V +LVSILE LL+ KAKK+V+KMPRNGDVP+THANVSLA  DFGYK
Sbjct  360  QLRIYNLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPRNGDVPYTHANVSLALHDFGYK  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL+SGLRKFVKWYVSYYGI+SRVKTE
Sbjct  420  PTTDLASGLRKFVKWYVSYYGIESRVKTE  448



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  291  YFFFTKDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  351  QLRIYNLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            P+TDL++GLR+FVKWYVSYYGIQ+R+
Sbjct  411  PSTDLATGLRRFVKWYVSYYGIQTRL  436



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y T ++KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  302  YFFFTKDILHGKSIDIYRTADNKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KA+K+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  362  QLRVYNLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPRNGDVPYTHANVSLAYKDFGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  468
            PTTDL++GLRKFVKWYVSYYG+Q RVK E     +S
Sbjct  422  PTTDLAAGLRKFVKWYVSYYGVQPRVKKETSHAEES  457



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSG KKKG A
Sbjct  298  YFFFTKDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGEKKKGAA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYK
Sbjct  358  QLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYK  417

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  468
            PTTDLS+GLRKFVKWY+SYYGIQS+ + E   T +S
Sbjct  418  PTTDLSTGLRKFVKWYISYYGIQSKTRKESQATGES  453



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y TQ+ KEVARDFTYIDDVVKGC+GALDTA KSTGSGGKKKGPA
Sbjct  297  YFFFTKDILQGKSIDIYQTQDQKEVARDFTYIDDVVKGCLGALDTAGKSTGSGGKKKGPA  356

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL+ KAKK+V+ MPRNGDVPFTHANV+LAYKDFGYK
Sbjct  357  QLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPRNGDVPFTHANVTLAYKDFGYK  416

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  468
            PTTDL++GLRKFVKWYVSY+GIQ RVK E     +S
Sbjct  417  PTTDLATGLRKFVKWYVSYFGIQRRVKKETQHADES  452



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  302  YFFFTKDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYK
Sbjct  362  QLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL +GLRKFVKWYV YYGIQSRV+ E
Sbjct  422  PTTDLPTGLRKFVKWYVGYYGIQSRVRKE  450



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I+VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTKDILHGKTIDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLV+ILENLL+ KAKK+V+KMPRNGDVP+THANV+LAY+DFGYK
Sbjct  351  QLRIYNLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPRNGDVPYTHANVTLAYRDFGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            P TDLS+GLRKFVKWYV YYGIQ R+K E
Sbjct  411  PVTDLSTGLRKFVKWYVRYYGIQPRLKKE  439



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  302  YFFFTKDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYK
Sbjct  362  QLRIYNLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL +GLRKFVKWYV YYGIQSRVK ++
Sbjct  422  PTTDLPTGLRKFVKWYVGYYGIQSRVKRKV  451



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKG A
Sbjct  298  YFFFTKDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGAA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYK
Sbjct  358  QLRVYNLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYK  417

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  468
            PTTDLS+GLRKFVKWY+SYYGIQS+   E   T +S
Sbjct  418  PTTDLSTGLRKFVKWYISYYGIQSKTGKESQATGES  453



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  304  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  471
            PTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  306  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  365

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  366  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  425

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  471
            PTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  426  PTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  460



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  304  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  471
            PTTDL++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  306  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  365

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  366  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  425

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  426  PTTDLAAGLRKFVKWYVGYYGIQPRVKKE  454



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  300  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  360  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  420  PTTDLATGLRKFVKWYVGYYGIQPRVKKE  448



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSG KK+GPA
Sbjct  299  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGRKKRGPA  358

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  359  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  418

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  419  PTTDLATGLRKFVKWYVGYYGIQPRVKKE  447



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  304  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  305  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  364

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYK
Sbjct  365  MLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYK  424

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  425  PTTDLAAGLRKFVKWYVGYYGIQPRVKRE  453



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  304  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  304  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  424  PTTDLAAGLRKFVKWYVGYYGIQPRVKRE  452



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  305  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  364

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  365  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  424

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ RVK E
Sbjct  425  PTTDLAAGLRKFVKWYVGYYGIQPRVKKE  453



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  300  YFFFTKAILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVPFTHANVSLAY+DFGYK
Sbjct  360  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPFTHANVSLAYRDFGYK  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYGIQ R K E
Sbjct  420  PTTDLATGLRKFVKWYVGYYGIQPRGKKE  448



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI++Y TQ+ K VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  297  YFFFTKDILQGKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  356

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL+ KAKK+VV +PRNGDVP+THANV+LAYKDFGYK
Sbjct  357  QLRVYNLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYK  416

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDLSSGLRKFVKWYV+Y+GI+S+   E
Sbjct  417  PTTDLSSGLRKFVKWYVNYFGIESKHSKE  445



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  306  YFFFTKDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQA  365

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYK
Sbjct  366  QLRVYNLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYK  425

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTTDL++GLRKFVKWYV YYGIQ RVK
Sbjct  426  PTTDLAAGLRKFVKWYVGYYGIQPRVK  452



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQE K+VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  308  YFFFTKDILQGKTIDVYQTQEGKQVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPA  367

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LLS KAKK+V+KMP NGDVPFTHANVSLAY+DF Y 
Sbjct  368  QLRVYNLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPSNGDVPFTHANVSLAYRDFSYN  427

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  453
            PTTDL++GLRKFVKWY+ YYG+Q R+K E H
Sbjct  428  PTTDLATGLRKFVKWYLGYYGLQQRLKKEYH  458



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 132/149 (89%), Gaps = 7/149 (5%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGA  +        GKK+GPA
Sbjct  311  YFFFTKDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGATGSG-------GKKRGPA  363

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYK
Sbjct  364  QLRVYNLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYK  423

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYGIQ RVK E
Sbjct  424  PTTDLAAGLRKFVKWYVSYYGIQPRVKKE  452



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G A
Sbjct  263  YFFFTKSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAA  322

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYK
Sbjct  323  QLRVYNLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYK  382

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFV+WYV YYG++  V+ E
Sbjct  383  PTTDLATGLRKFVQWYVGYYGVRLGVEKE  411



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI++Y T + +EV RDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA
Sbjct  294  YFFFTKDILQGKPISIYKTHDGEEVQRDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LVSILE LL++KAKK+++ MPRNGDVP+THANV+LA KDF YK
Sbjct  354  QLRVYNLGNTSPVPVARLVSILEGLLNVKAKKHLITMPRNGDVPYTHANVTLARKDFAYK  413

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYV YYG+Q  VK E
Sbjct  414  PTTDLATGLRKFVKWYVGYYGVQPSVKKE  442



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY T +  EVARDFTYIDDVV+GC+GALDTA+KSTGSGG+KK PA
Sbjct  294  YFFFTKDILQGKPIDVYRTHDQHEVARDFTYIDDVVRGCLGALDTAQKSTGSGGRKKAPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V +LV ILE+LL  KAK++V+ MPRNGDVPFTHANV+LA +DFGYK
Sbjct  354  QLRVYNLGNTSPVPVGRLVGILESLLGTKAKRHVITMPRNGDVPFTHANVTLAGRDFGYK  413

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL++GLRKFVKWYVSYYG++ R K +
Sbjct  414  PTTDLATGLRKFVKWYVSYYGVEPRSKKD  442



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  284  YFFFTKDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YK
Sbjct  344  QLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL SGLRKFVKWYV YYG Q R K E
Sbjct  404  PTTDLPSGLRKFVKWYVGYYGPQLRPKKE  432



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-P  177
            YFFFTK +LQ KPI+VY T +++EVARDFTYIDDVVKGC+GALDTAEKSTG    KK  P
Sbjct  338  YFFFTKSILQRKPIDVYQTHDEREVARDFTYIDDVVKGCLGALDTAEKSTGGVVGKKRGP  397

Query  178  AQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGY  357
            AQLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++D GY
Sbjct  398  AQLRVYNLGNTSPVPVGKLVSVLETLLGVKAKKHVIKMPRNGDVPFTHANVSLAWRDLGY  457

Query  358  KPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  453
            KPTTDL++GLRKFV+WYV YYG++  V+ E H
Sbjct  458  KPTTDLAAGLRKFVQWYVGYYGVRLGVEKEKH  489



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  284  YFFFTKDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YK
Sbjct  344  QLRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFFYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL SGLRKFVKWYV YYG Q R K E 
Sbjct  404  PTTDLPSGLRKFVKWYVGYYGPQLRPKKEF  433



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPA
Sbjct  284  YFFFTKDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YK
Sbjct  344  QFRIYNLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTTDL SGLRKFVKWYV YYG Q R K E
Sbjct  404  PTTDLPSGLRKFVKWYVGYYGPQLRPKKE  432



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  296  YFFFTKDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLVSILE LL  KA+K+V+KMPRNGDVP+THANV+LAY+DFGYK
Sbjct  356  QLRVYNLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYK  415

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL++GLRKFVKWY+  +
Sbjct  416  PTTDLATGLRKFVKWYIKLW  435



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  31   GKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNLGNT  210
            GKPI++Y TQ+ K VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVYNLGNT
Sbjct  263  GKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVYNLGNT  322

Query  211  SPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSSGLR  390
            SPV V +LVSILE LL+ KAKK+VV +PRNGDVP+THANV+LAYKDFGYKPTTDLSSGLR
Sbjct  323  SPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYKPTTDLSSGLR  382

Query  391  KFVKWYVSYYGIQSRVKTE  447
            KFVKWYV+Y+GI+S+   E
Sbjct  383  KFVKWYVNYFGIESKHSKE  401



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G A
Sbjct  263  YFFFTKSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAA  322

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYK
Sbjct  323  QLRVYNLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYK  382

Query  361  PTTDLSSGLRKFVK  402
            PTTDL++GLRKFV+
Sbjct  383  PTTDLATGLRKFVQ  396



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I ++      +VARDFTYIDD+VKGCVGALDTAEKSTGSG KKKGPA
Sbjct  282  YFFFTKDILQGKTIPIFQGPNQVDVARDFTYIDDIVKGCVGALDTAEKSTGSGEKKKGPA  341

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPVSV +LV ILE LL +KAKKNV++MP NGDVPFTHANV+LA  + GYK
Sbjct  342  QLRIYNLGNTSPVSVPELVRILEELLKVKAKKNVLRMPSNGDVPFTHANVTLASMELGYK  401

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            PTTDL++GL+KFVKWY+SYYG+  R+
Sbjct  402  PTTDLATGLKKFVKWYLSYYGVPGRI  427



>gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythranthe guttata]
Length=369

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgP-  177
            YFFFTKD+L GK INVYVTQ++KEVARDFTYIDD+VKGCVGAL+   +      ++  P 
Sbjct  209  YFFFTKDILHGKGINVYVTQDEKEVARDFTYIDDIVKGCVGALEHGGEEHRKRREEARPG  268

Query  178  AQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGY  357
            A   +   G   P     LV ILE LL  KAKK VVKMPRNGDVP+THANVSLAYKDFGY
Sbjct  269  AAPGLQPWGTPPPSPSESLVGILETLLGTKAKKRVVKMPRNGDVPYTHANVSLAYKDFGY  328

Query  358  KPTTDLSSGLRKFVKWYVSYYGIQSRVKTELHP  456
            KPTTDL++GLRKFVKWYVSYYGI+SRVK E  P
Sbjct  329  KPTTDLATGLRKFVKWYVSYYGIESRVKKENEP  361



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTKD+LQGK I ++   + ++VARDFTYIDD+V+GC+GALDTA++STGSGG+K+GPA
Sbjct  287  YFSFTKDILQGKAITIFERADGQDVARDFTYIDDIVRGCIGALDTAQRSTGSGGRKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV+V+ LV ILE LL + AKKNVV+MP NGDVPFTHANVS + +DFGY+
Sbjct  347  QLRVYNLGNTSPVTVKGLVGILEGLLGLTAKKNVVRMPGNGDVPFTHANVSSSVRDFGYR  406

Query  361  PTTDLSSGLRKFVKWYVSYYGIQ  429
            PTTDL++GLRKFVKWYV+YYGI+
Sbjct  407  PTTDLATGLRKFVKWYVNYYGIK  429



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I+VY      +VARDFTYIDD+ KGCV ALDTA+KSTGSGGKKKGPA
Sbjct  289  YFFFTKDILQGKSIDVYQGLNKVDVARDFTYIDDIAKGCVAALDTAKKSTGSGGKKKGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPVSV  LV+ILE LL +KAKKN++ MP NGDVPFTHANVSLA+ + GY+
Sbjct  349  QLRIYNLGNTSPVSVPDLVNILERLLKVKAKKNIISMPSNGDVPFTHANVSLAHTELGYQ  408

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            PTTDL +GL+KFVKWY+SYYG+  R+
Sbjct  409  PTTDLQTGLKKFVKWYLSYYGVPGRI  434



>ref|XP_002511693.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50362.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=152

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  3    YFFFTRDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  62

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA  + GYK
Sbjct  63   QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISLAQMELGYK  122

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFV+WY+SYY +  +
Sbjct  123  PTTDLQTGLKKFVRWYLSYYHVGGK  147



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPA
Sbjct  287  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  347  QLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  407  PTTDLQTGLKKFVRWYLSYY  426



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPA
Sbjct  287  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  347  QLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  407  PTTDLQTGLKKFVRWYLSYY  426



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   206 bits (525),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPA
Sbjct  287  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  347  QLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  407  PTTDLQTGLKKFVRWYLSYY  426



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT D++ GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTA+ STGSG KK+GPA
Sbjct  300  YFSFTNDIISGKPITLFRMQDGAAVQRDFTYIDDVVKGCLGALDTAKPSTGSGSKKRGPA  359

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V K+V ILE LL  KAKKNVV +P+NGDVP+THANVSLA KDFGY+
Sbjct  360  QLRVYNLGNTSPVPVAKMVGILEELLGKKAKKNVVTLPQNGDVPYTHANVSLAEKDFGYR  419

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            PTTDL++GL+KFVKWYV YYG+++
Sbjct  420  PTTDLATGLKKFVKWYVEYYGVKT  443



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-P  177
            YFFFTK +L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTA+KSTGS G KK  P
Sbjct  294  YFFFTKSILSGDAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAQKSTGSRGGKKHGP  353

Query  178  AQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGY  357
            AQLRVYNLGNTSPVSV K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY
Sbjct  354  AQLRVYNLGNTSPVSVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGY  413

Query  358  KPTTDLSSGLRKFVKWYVSYYGIQ-SRVK  441
            +PTTDL++GLR+FVKWYV Y G+  SR K
Sbjct  414  RPTTDLATGLRRFVKWYVEYNGVAVSRAK  442



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTG+GGKK+GPA
Sbjct  286  YFFFTKDILQGKTIPIFEGPNHGTVARDFTYIDDIVKGCLGSLDTAEKSTGTGGKKRGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V+ LVSILE LL +KAKK ++KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  346  QLRIFNLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPRNGDVPFTHANISLAQRELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY+ YY
Sbjct  406  PTTDLQTGLKKFVKWYLGYY  425



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPA
Sbjct  288  YFFFTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYK
Sbjct  348  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPA
Sbjct  284  YFFFTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVP+THAN+S A K+FGYK
Sbjct  344  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPRNGDVPYTHANISYAQKEFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  404  PTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG A
Sbjct  259  YFFFTKDILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNA  318

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V KLVSILE LL +KAKKNV+ +PRNGDV FTHAN+S A+K+FGYK
Sbjct  319  QLRVFNLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPRNGDVMFTHANISYAHKEFGYK  378

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKT  444
            PTT+L  GL+KFV WY+ YY +  + K+
Sbjct  379  PTTNLQMGLQKFVNWYLDYYSVSEKKKS  406



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-P  177
            YFFFTK +L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTAEKSTGS G K+   
Sbjct  297  YFFFTKSILSGNAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAEKSTGSRGGKRRGA  356

Query  178  AQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGY  357
            AQLRVYNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY
Sbjct  357  AQLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGY  416

Query  358  KPTTDLSSGLRKFVKWYVSYYGIQS  432
            +PTTDL++GLR+FVKWYV YYG+ +
Sbjct  417  RPTTDLTAGLRRFVKWYVEYYGVTA  441



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPA
Sbjct  287  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA  + GYK
Sbjct  347  QLRVFNLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQHELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  407  PTTDLQTGLKKFVRWYLSYY  426



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTKD+LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPA
Sbjct  288  YFSFTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y 
Sbjct  348  QLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYN  407

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            P+TDL +GL+KFVKWY SYYG+ S
Sbjct  408  PSTDLYTGLKKFVKWYESYYGLTS  431



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTKD+LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPA
Sbjct  293  YFSFTKDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y 
Sbjct  353  QLRVYNLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYN  412

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            P+TDL +GL+KFVKWY SYYG+ S
Sbjct  413  PSTDLYTGLKKFVKWYESYYGLTS  436



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA
Sbjct  288  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE  L +KAKKN++KMPRNGDVP+THAN+SLA ++ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPRNGDVPYTHANISLAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            PTTDL +GL+KFV+WY+SYY  Q + 
Sbjct  408  PTTDLQTGLKKFVRWYLSYYSGQKKA  433



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPA
Sbjct  289  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  349  QLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  409  PTTDLQTGLKKFVRWYLSYY  428



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA
Sbjct  292  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPA  351

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  352  QLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYK  411

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  412  PTTDLQTGLKKFVRWYLSYY  431



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA
Sbjct  294  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  354  QLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYK  413

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  414  PTTDLQTGLKKFVRWYLSYY  433



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPA
Sbjct  289  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  349  QLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  409  PTTDLQTGLKKFVRWYLSYY  428



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L G  I ++ T++  +V RDFTYIDDVV+GC+GALDTA KSTG+GGKK+GPA
Sbjct  296  YFFFTKAILSGNAITLFKTRDGVDVQRDFTYIDDVVQGCLGALDTAGKSTGTGGKKRGPA  355

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANV+LA KDF Y+
Sbjct  356  QLRVYNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVTLAQKDFKYR  415

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            PTTDL++GLR+FVKWYV YYG+ +
Sbjct  416  PTTDLATGLRRFVKWYVEYYGVAA  439



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+DML+GK I+++   +   VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  288  YFFFTRDMLKGKSISIFEGADHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+ V+K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPRNGDVQFTHANISLAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKK PA
Sbjct  288  YFFFTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKRPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYK
Sbjct  348  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
             TTDL +GL+KFV+WY+SYYG
Sbjct  408  ATTDLQTGLKKFVRWYLSYYG  428



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPA
Sbjct  284  YFFFTKDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDVP+THAN+S A K+FGYK
Sbjct  344  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPRNGDVPYTHANISYAQKEFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  404  PTTDLQTGLKKFVRWYLSYYG  424



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  142  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  201

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYK
Sbjct  202  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYK  261

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+ YY
Sbjct  262  PSTDLQTGLKKFVRWYLGYY  281



>gb|AFK41785.1| unknown [Medicago truncatula]
Length=154

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+ + +   VARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKG A
Sbjct  3    YFFFTKDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSA  62

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q RV+NLGNTSPV V KLV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA ++FGYK
Sbjct  63   QFRVFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYK  122

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PT DL +GLRKFVKWY+ +Y
Sbjct  123  PTIDLETGLRKFVKWYLEFY  142



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score =   196 bits (497),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG A
Sbjct  114  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGAA  173

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  174  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPRNGDVQFTHANISLAQRELGYK  233

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFV+WY+SYYG + +
Sbjct  234  PTTDLQTGLKKFVRWYLSYYGNEKK  258



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  290  YFFFTKDILKGKAIQIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  350  QLRVYNLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPRNGDVQFTHANISLAQRELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  410  PTTDLQTGLKKFVRWYLSYYG  430



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK++L+GKPI+V+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKK  A
Sbjct  259  YFFFTKNILKGKPISVFQGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKKNA  318

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V KLVSILE LL +KAK+NV+ +P NGDV FTHAN+S A+K+FGYK
Sbjct  319  QLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPTNGDVMFTHANISYAHKEFGYK  378

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL KFV WY+ YY +  +
Sbjct  379  PTTDLQTGLHKFVNWYLDYYSVSEK  403



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI V+  ++  ++ARDFTYIDDVVKGCV ALDTAE STGSGG+K+ PA
Sbjct  285  YFSFTRNILQGKPITVFRGRDGTDLARDFTYIDDVVKGCVAALDTAEASTGSGGRKRSPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LV ILE  L +KAKKNV +MP NGDVPFTHAN+SLA  + GYK
Sbjct  345  QYRIYNLGNTSPVTVPALVGILERHLKMKAKKNVAEMPGNGDVPFTHANISLARAELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            PTT+L +GL+KFVKWY+SYYG   RV
Sbjct  405  PTTNLETGLKKFVKWYLSYYGYSRRV  430



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  283  YFFFTRDILKGKPISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYK
Sbjct  343  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  403  PTTDLQTGLKKFARWYLGYY  422



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            Y+FFTKD+L+GK I +Y   +   VARDFTYIDDVVKGC+ ALDTA+KSTGSGGKK+G A
Sbjct  307  YYFFTKDILRGKEIKIYEGVDHGTVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKRGAA  366

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNT+PV + +LVSILE LL +KAKK V++MPRNGDVPFTHAN+SLA+K+ GYK
Sbjct  367  QFRIYNLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPRNGDVPFTHANISLAHKELGYK  426

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFVKWYV YYG + +
Sbjct  427  PTTDLEAGLKKFVKWYVGYYGSKKK  451



>emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera]
Length=150

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  3    YFFFTRDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  62

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  63   QLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYK  122

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY++YY
Sbjct  123  PTTDLQTGLKKFVKWYLNYY  142



>emb|CAN73017.1| hypothetical protein VITISV_004389 [Vitis vinifera]
Length=149

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  3    YFFFTRDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  62

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  63   QLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYK  122

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  123  PTTDLQTGLKKFVRWYLKYY  142



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  114  YFFFTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  173

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYK
Sbjct  174  QLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYK  233

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KFV+WY++YY
Sbjct  234  PTTDLQSGLKKFVRWYLNYY  253



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+GK IN+Y     K++ARDFTYIDD+VKGCVGALDTAEKSTGSGGKK GPA
Sbjct  294  YFSFTRDILRGKAINIYTGNGGKDLARDFTYIDDIVKGCVGALDTAEKSTGSGGKKTGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV+V  LV ILE  L  KAK+N++KMPRNGDVPFTHAN+S A   F Y 
Sbjct  354  QLRVFNLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPRNGDVPFTHANISYAQSQFNYH  413

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  465
            PTT+L +GL+KFVKWY+SYYG+ +  K  L    Q
Sbjct  414  PTTNLDTGLKKFVKWYLSYYGVGTDHKLWLGDHEQ  448



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGCV ALDTAE STG G +K+ PA
Sbjct  285  YFSFTRNILQGKPITVYRGRDGTDLARDFTYIDDIVKGCVAALDTAEASTGIGKQKRRPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LV ILE  L +KA+KN+V+MP NGDVPFTHAN+SLA  + GYK
Sbjct  345  QYRIYNLGNTSPVTVPALVRILERYLKVKARKNMVEMPGNGDVPFTHANISLARAELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRV  438
            PTT+L +GL+KFVKWY+SYYG   R 
Sbjct  405  PTTNLETGLKKFVKWYLSYYGYSRRA  430



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PA
Sbjct  283  YFSFTRNILQGKPITIYRGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYK
Sbjct  343  QYRIYNLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPGNGDVPFTHANISLARAELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFVKWY+ YYG + R
Sbjct  403  PTTNLETGLKKFVKWYLHYYGYRPR  427



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgs--ggkkkg  174
            YF FTK +L GKPI ++   +   V RDFTYIDDVVKGC+GAL+TA+KSTG   GGKK+G
Sbjct  299  YFSFTKSILSGKPITLFRMPDGTAVQRDFTYIDDVVKGCLGALNTAKKSTGVPGGGKKRG  358

Query  175  PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFG  354
            PAQLRVYNLGNTSPV V ++VSILE+L+  KAKKNVV +P+NGDVPFTHANVSLA  DFG
Sbjct  359  PAQLRVYNLGNTSPVPVAEMVSILEHLIGKKAKKNVVTLPQNGDVPFTHANVSLAKTDFG  418

Query  355  YKPTTDLSSGLRKFVKWYVSYYGIQS  432
            Y+PTTDL++GLRKFVKWYV YYG+Q+
Sbjct  419  YRPTTDLATGLRKFVKWYVEYYGVQT  444



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA
Sbjct  293  YFFFTKDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRV+NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYK
Sbjct  353  MLRVFNLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYK  412

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PTTDL +GL+KFV+WY+SYY    + K
Sbjct  413  PTTDLQTGLKKFVRWYLSYYSSSGQSK  439



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+G  I+++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  280  YFFFTKDILKGNSISIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  339

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V +LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYK
Sbjct  340  QLRVFNLGNTSPVPVTELVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYK  399

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            PTTDL +GL+ FV+WY++YY + +
Sbjct  400  PTTDLETGLKNFVRWYLNYYSVAA  423



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +L GK I ++ T +   V RDFTYIDDVV+GC+GALDTA KSTGSGGKK+GPA
Sbjct  294  YFFFTKSILSGKAITLFKTHDGVGVRRDFTYIDDVVQGCLGALDTAGKSTGSGGKKRGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGN SPV V K+V+ILE LL  KAKKNVV MP NGDVP+THANVS A KDFGY+
Sbjct  354  QLRVYNLGNKSPVPVSKMVAILEELLGKKAKKNVVTMPMNGDVPYTHANVSSAEKDFGYR  413

Query  361  PTTDLSSGLRKFVKWYVSYYGI  426
            PTTDL++GLR+FVKWYV YYG+
Sbjct  414  PTTDLATGLRRFVKWYVEYYGV  435



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  291  YFFFTRDLLKGKPIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYK
Sbjct  351  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KFV+WY++YY
Sbjct  411  PTTDLQSGLKKFVRWYLNYY  430



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+LQGK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGS GKKKGPA
Sbjct  286  YFFFTRDILQGKTIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSRGKKKGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE LL +KAK+N++KMPRNGDVPFTHAN+S A  + GYK
Sbjct  346  QLRVFNLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPRNGDVPFTHANISSAQHELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WYVSYY
Sbjct  406  PSTDLQTGLKKFVRWYVSYY  425



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+G A
Sbjct  274  YFFFTKDILRGKSITIFEGPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGTA  333

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYK
Sbjct  334  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYK  393

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WYV+YY
Sbjct  394  PTTDLQTGLKKFVRWYVNYY  413



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PA
Sbjct  290  YFFFTRDILKGKPISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRRPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  350  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KF +WY+ YY
Sbjct  410  PTTDLQSGLKKFARWYLGYY  429



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  280  YFFFTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  339

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  340  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYK  399

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  400  PTTDLQTGLKKFVRWYIKYY  419



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  286  YFFFTKDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  346  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  406  PTTDLQTGLKKFVRWYIKYY  425



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK++L+G PI+V+    +K VARDFTYID++VKGC+GALDTAEKSTGSGGKKK  A
Sbjct  259  YFFFTKNILKGNPISVFQGSNNKSVARDFTYIDEIVKGCLGALDTAEKSTGSGGKKKKNA  318

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V KLVSILE LL +KAK+NV+ +PRNGDV FTHAN+S A K+FGYK
Sbjct  319  QLRVFNLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPRNGDVMFTHANISYAQKEFGYK  378

Query  361  PTTDLSSGLRKFVKWYVSYYGI  426
            PTTDL  GL+KFV WY+ YY I
Sbjct  379  PTTDLQMGLQKFVNWYLDYYSI  400



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsgg--kkkg  174
            YF FTK +L GKPI ++   +   V RDFT+I+DVVKGC+GALDTA+KSTG  G  KK+G
Sbjct  299  YFSFTKSILSGKPITLFRMPDGTAVQRDFTFIEDVVKGCLGALDTAKKSTGVAGGGKKRG  358

Query  175  PAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFG  354
            PAQLR+YNLGNTSPV V K+VSILE+LL  KAKKNVV +P+NGDVPFTHANVSLA +DFG
Sbjct  359  PAQLRIYNLGNTSPVPVAKMVSILEDLLRKKAKKNVVTLPQNGDVPFTHANVSLAERDFG  418

Query  355  YKPTTDLSSGLRKFVKWYVSYYGIQ  429
            Y+PTTDL++GL+KFVKWYV YYG++
Sbjct  419  YRPTTDLATGLKKFVKWYVEYYGVE  443



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK++L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG A
Sbjct  259  YFFFTKNILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNA  318

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V KLVS+LE LL +KA+KNV+ +PRNGDV FTHAN+S A K+FGYK
Sbjct  319  QLRVFNLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPRNGDVMFTHANISYAQKEFGYK  378

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKT  444
            P+TDL  G++KF+ WY+ YY I  + K+
Sbjct  379  PSTDLQMGIQKFLNWYLDYYSISEKKKS  406



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG A
Sbjct  114  YFFFTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKA  173

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYK
Sbjct  174  QLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYK  233

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL++FV WY  YY   S+
Sbjct  234  PTTDLKTGLKEFVDWYRLYYSNSSK  258



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  269  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  328

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYK
Sbjct  329  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYK  388

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+ YY
Sbjct  389  PSTDLQTGLKKFVRWYLGYY  408



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  283  YFFFTRDILKGKAISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYK
Sbjct  343  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  403  PTTDLQTGLKKFARWYLGYY  422



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGCVGALDTA+KSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCVGALDTAKKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+ T + + VARDFTYIDD+V GC+ ALDTA+KSTGSGGKK+GPA
Sbjct  287  YFFFTKDILKGKEIGVFETADGRSVARDFTYIDDIVNGCLAALDTAKKSTGSGGKKRGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q RV+NLGNTSPV V +LV ILE+LL +KAKK V+ +PRNGDV FTHAN+SLA KD GYK
Sbjct  347  QFRVFNLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNGDVEFTHANISLAQKDLGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  407  PTTDLETGLKKFVRWYLSYY  426



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYSGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LVSILE  L  KAK+NVV MP NGDVPFTHAN+SLA  + GYK
Sbjct  343  QYRIYNLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPGNGDVPFTHANISLARAELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFVKWY+ YYG   R
Sbjct  403  PTTNLETGLKKFVKWYLHYYGYSPR  427



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  289  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYK
Sbjct  349  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFV+WY+SYYG +++
Sbjct  409  PTTDLHTGLKKFVRWYLSYYGDETK  433



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  290  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  350  QLRVYNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  410  PTTDLQTGLKKFVRWYLSYY  429



>gb|EMT26004.1| UDP-glucuronate 4-epimerase 4 [Aegilops tauschii]
Length=176

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQ----EDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkk  168
            YFFFT+D+L G+PI VY +         ++RDFTYIDD+VKGC+GALDTA +STGSGGKK
Sbjct  3    YFFFTRDILAGRPITVYESSGGGTHQTTISRDFTYIDDIVKGCIGALDTAGRSTGSGGKK  62

Query  169  kgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKD  348
            +GPA  R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNGDVP+THAN+SLA ++
Sbjct  63   RGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNGDVPYTHANISLAQRE  122

Query  349  FGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  453
             GY+P+TDL +GL+KFV+WY+ YY  +  VK + H
Sbjct  123  LGYRPSTDLQTGLKKFVRWYLEYYNPELAVKQKQH  157



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPRNGDVPFTHANISSAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WYVSYY
Sbjct  408  PTTDLQTGLKKFVRWYVSYY  427



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  284  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYK
Sbjct  344  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+ YY
Sbjct  404  PSTDLQTGLKKFVRWYLGYY  423



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFT+IDD+VKGCV +LDTAEKSTGSGG+K  PA
Sbjct  284  YFSFTRNILQGKPITVYRGKNRVDLARDFTFIDDIVKGCVASLDTAEKSTGSGGRKGSPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LV ILE  L +KAKKNVV+MP NGDVPFTHAN+SLA  + GYK
Sbjct  344  QYRIYNLGNTSPVTVPALVGILERHLKVKAKKNVVEMPGNGDVPFTHANISLARAELGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFV+WY+SYYG   R
Sbjct  404  PTTNLETGLKKFVRWYLSYYGYSPR  428



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  285  YFFFTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  345  QLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPRNGDVQFTHANISLAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY++YY
Sbjct  405  PTTDLQTGLKKFVRWYLNYY  424



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPA
Sbjct  298  YFFFTKAILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY 
Sbjct  358  QLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYN  417

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY  YY
Sbjct  418  PTTDLQTGLKKFVKWYQLYY  437



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTK +LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPA
Sbjct  298  YFFFTKAILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY 
Sbjct  358  QLRVYNLGNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYN  417

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY  YY
Sbjct  418  PTTDLQTGLKKFVKWYQLYY  437



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+ KPI ++       VARDFTYIDD+VKGC+ ALDTAEKSTG+GGKKKGPA
Sbjct  288  YFFFTRDILKRKPIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGTGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL +K K+N++K+PRNGDV FTHANVSLA ++ GYK
Sbjct  348  QLRVYNLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPRNGDVQFTHANVSLAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY S+Y
Sbjct  408  PTTDLQTGLKKFVKWYTSFY  427



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  285  YFFFTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  345  QLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY++YY
Sbjct  405  PTTDLQTGLKKFVRWYMNYY  424



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  289  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  349  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  409  PTTDLQTGLKKFVRWYLGYY  428



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  114  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPA  173

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYK
Sbjct  174  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYK  233

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  234  PTTDLQTGLKKFVKWYLSYYG  254



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  408  PTTDLQTGLKKFVRWYLSYYG  428



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTRDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  351  QLRVFNLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY++YY
Sbjct  411  PTTDLQTGLKKFVRWYMNYY  430



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G A
Sbjct  281  YFFFTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAA  340

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  341  QLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYK  400

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  401  PTTDLQTGLKKFARWYLGYY  420



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  284  YFFFTRDILKGKAISIFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V +LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A ++FGYK
Sbjct  344  QLRVFNLGNTSPVPVTELVSILERLLKVKAKRNMMKLPRNGDVAFTHANISWAEREFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            P+TDL +GL+KFV+WY+ YY  Q+
Sbjct  404  PSTDLQTGLKKFVRWYLGYYKQQA  427



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA+KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYSGKNRVDLARDFTYIDDIVKGCLGSLDTAKKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LVSILE  L +KAK+NV++MP NGDVPFTHAN+SLA  + GYK
Sbjct  343  QYRIYNLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPGNGDVPFTHANISLARAELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFVKWY+ YYG   R
Sbjct  403  PTTNLETGLKKFVKWYLQYYGYSRR  427



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  290  YFFFTRDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  350  QLRVFNLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+SYY
Sbjct  410  PSTDLQTGLKKFVRWYLSYY  429



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 121/150 (81%), Gaps = 21/150 (14%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  298  YFFFTKDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR+YNLGNTSPV V KLVSILE LL  KAKK+V+KMPR                     
Sbjct  358  QLRIYNLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPR---------------------  396

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL+SGLRKFVKWYVSYYGI++RVK E+
Sbjct  397  PTTDLASGLRKFVKWYVSYYGIETRVKREM  426



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  279  YFFFTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  338

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N +K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  339  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPRNGDVPFTHANISSAQRELGYK  398

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  399  PTTDLQTGLKKFARWYLGYY  418



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+V+GC+ ALDTAEKSTGSGGKKKGPA
Sbjct  289  YFFFTRDILKGKSISIFEAANHGTVARDFTYIDDIVRGCLAALDTAEKSTGSGGKKKGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL +KAK+N++++PRNGDV +THAN+SLA ++ GYK
Sbjct  349  QLRVYNLGNTSPVPVSDLVSILERLLKLKAKRNILRLPRNGDVQYTHANISLAQRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KFV+WY+ +Y
Sbjct  409  PTTDLQSGLKKFVRWYLRFY  428



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGCV +LDTAEKSTG+GG+K+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCVASLDTAEKSTGTGGRKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LV ILE+ L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYK
Sbjct  343  QYRIYNLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPGNGDVPFTHANISLARAELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL++FV+WY+ YYG  +R
Sbjct  403  PTTNLETGLKRFVRWYLLYYGYNTR  427



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT ++L+GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTAE+STGSGGKK+GPA
Sbjct  298  YFSFTNNILRGKPITLFRVQDGTAVQRDFTYIDDVVKGCLGALDTAERSTGSGGKKRGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V K+V ILE LL  KAKK+VV +P+NGDVP+THANVS+A +D GY+
Sbjct  358  QLRVYNLGNTSPVPVAKMVGILEELLGKKAKKHVVTLPQNGDVPYTHANVSMAERDLGYR  417

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
             TTDL++GL+KFV+WYV YY  +S+
Sbjct  418  ATTDLATGLKKFVRWYVEYYDRKSK  442



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G A
Sbjct  288  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGAA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V +LVSILE  L +KAK+N++K+PRNGDV FTHAN+SLA  + GYK
Sbjct  348  QLRVFNLGNTSPVPVSELVSILERHLKVKAKRNIMKLPRNGDVQFTHANISLAQGELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYGI  426
            PTTDL +GL+KFVKWY+ YY +
Sbjct  408  PTTDLHTGLKKFVKWYLGYYNV  429



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  298  YFFFTRDILKGKAISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  357

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK++++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  358  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPRNGDVQFTHANISWAQRELGYK  417

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  418  PTTDLQTGLKKFVRWYLSYY  437



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDDVVKGC+GALD++ KSTGSGGKK+GPA
Sbjct  286  YFSFTRNILQGKPITIYRGKNKVDLARDFTYIDDVVKGCLGALDSSGKSTGSGGKKRGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R+YNLGNT PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +DFGYK
Sbjct  346  PYRIYNLGNTQPVTVPTLVSILEKSLKVKAKKNVVEMPGNGDVPFTHANISLARRDFGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  406  PTTDLQTGLKKFVRWYLSYYG  426



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  291  YFFFTRDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYK
Sbjct  351  QLRIFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQMELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KFV+WY++YY
Sbjct  411  PTTDLQSGLKKFVRWYLNYY  430



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  246  YFFFTRDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  305

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V +LVSILE  L +KAK+NV+K+PRNGDV FTHAN+S+A ++ GYK
Sbjct  306  QLRVFNLGNTSPVPVSELVSILERHLKVKAKRNVMKLPRNGDVQFTHANISMAQRELGYK  365

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  366  PTTDLQTGLKKFVRWYMGYY  385



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  287  YFFFTRDILKGKSIPIFEAASHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL  KAK+N++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  347  QLRVFNLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNGDVQFTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            P+TDL +GL+KFV+WY+SYY +  +
Sbjct  407  PSTDLQTGLKKFVRWYLSYYRVGGK  431



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG A
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY++YYG
Sbjct  408  PTTDLQTGLKKFVRWYLNYYG  428



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GKPI ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPA
Sbjct  286  YFFFTKDILKGKPITIFEAPDRGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YK
Sbjct  346  QLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELKYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P TDL +GL+KFV+WY+SYY
Sbjct  406  PGTDLETGLKKFVRWYLSYY  425



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  285  YFFFTRDILKGKVIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE LL IKAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  345  QLRVFNLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPRNGDVQFTHANISYAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL+KFV+WY++YY
Sbjct  405  PTTDLHSGLKKFVRWYLNYY  424



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDT EKSTGSGGKKKGPA
Sbjct  289  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTGEKSTGSGGKKKGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYK
Sbjct  349  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  409  PTTDLQTGLKKFVRWYLSYYG  429



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PA
Sbjct  283  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  +  YK
Sbjct  343  QYRIYNLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPGNGDVPFTHANISLARAELRYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFVKWY+ YYG   R
Sbjct  403  PTTNLETGLKKFVKWYLRYYGYSPR  427



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  285  YFFFTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  345  QLRVFNLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  405  PTTDLQTGLKKFARWYLGYY  424



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   194 bits (492),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L  K I ++ + +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+G A
Sbjct  292  YFFFTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRA  351

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+SLA ++ GYK
Sbjct  352  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYK  411

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYY 
Sbjct  412  PTTDLQTGLKKFVRWYLSYYA  432



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+
Sbjct  343  PYRIFNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYR  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  403  PTTDLQTGLKKFVRWYLSYYG  423



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G A
Sbjct  281  YFFFTRDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAA  340

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYK
Sbjct  341  QLRVFNLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYK  400

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PT DL +GL+KF +WY+ YY
Sbjct  401  PTIDLQTGLKKFARWYLGYY  420



>ref|XP_004171294.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG A
Sbjct  260  YFFFTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKA  319

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYK
Sbjct  320  QLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYK  379

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL++FV WY  YY   S+
Sbjct  380  PTTDLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGGKK+GPA
Sbjct  284  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVASLDTAKKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSP++V  +V ILE  L +KAKKNV++MP NGDVPFTHAN+S A ++ GYK
Sbjct  344  QYRIFNLGNTSPITVPMMVGILEKHLKVKAKKNVIEMPGNGDVPFTHANISSARRELGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GLRKFVKWY+SYYG
Sbjct  404  PTTDLQTGLRKFVKWYLSYYG  424



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG A
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY++YYG
Sbjct  408  PTTDLQTGLKKFVRWYLNYYG  428



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA
Sbjct  285  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+NVV MP NGDVPFTHAN+SLA ++ GYK
Sbjct  345  PYRIFNLGNTSPVTVPTLVSILEKHLKMKAKRNVVDMPGNGDVPFTHANISLARRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  405  PTTDLQTGLKKFVRWYLSYYG  425



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  193  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPA  252

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYK
Sbjct  253  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYK  312

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  313  PTTDLQTGLKKFVKWYLSYYG  333



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG A
Sbjct  260  YFFFTKDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKA  319

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYK
Sbjct  320  QLRVFNLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYK  379

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL++FV WY  YY   S+
Sbjct  380  PTTDLKTGLKEFVDWYRLYYSNSSK  404



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  285  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL  KAK+ V+K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  345  QLRVYNLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPRNGDVQFTHANISLAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY++YY
Sbjct  405  PTTDLQTGLKKFVRWYLNYY  424



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L GKPI ++   +   VARDFTYIDD+VKGC+ +LDTA+KSTG+GGKKKG A
Sbjct  193  YFFFTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAA  252

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNGDV +THAN+SLA ++ GYK
Sbjct  253  QFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYK  312

Query  361  PTTDLSSGLRKFVKWYVSY  417
            PTTDL SGL+KFV+WY++Y
Sbjct  313  PTTDLESGLKKFVRWYITY  331



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL++GL+KFVKWY+SYYG
Sbjct  403  PTTDLATGLKKFVKWYLSYYG  423



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+LQG  I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK  PA
Sbjct  263  YFFFTKDILQGNSIRIFEGGKGGVVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKMRPA  322

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL +KA++    MPRNGDV +THAN+SLA K+ GYK
Sbjct  323  QLRVYNLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNGDVMYTHANISLAEKELGYK  382

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL SGL KFVKWY++YY
Sbjct  383  PTTDLRSGLEKFVKWYLTYY  402



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  286  YFFFTRDILKGKTISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q RVYNLGNTSPV V  LVSILE LL + AK+NV+K+P+NGDV FTHAN+SLA ++ GYK
Sbjct  346  QFRVYNLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQNGDVRFTHANISLAQRELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +G++KFV+WY+SYY
Sbjct  406  PSTDLQTGMKKFVRWYLSYY  425



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPA
Sbjct  277  YFFFTKDILKGKTITIFEASDHGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPA  336

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YK
Sbjct  337  QLRIFNLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELRYK  396

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P TDL +GL+KFV+WY+SYY
Sbjct  397  PGTDLETGLKKFVRWYLSYY  416



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+ + +   VARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKG A
Sbjct  285  YFFFTKDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q RV+NLGNTSPV V KLV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA ++FGYK
Sbjct  345  QFRVFNLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PT DL +GLRKFVKWY+ +Y
Sbjct  405  PTIDLETGLRKFVKWYLEFY  424



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKDML+GK I V+       VARDFTYIDD+VKGC+GALDTA+KSTG+GGKKKGPA
Sbjct  301  YFFFTKDMLKGKEITVFEGPNHSTVARDFTYIDDIVKGCLGALDTAKKSTGTGGKKKGPA  360

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPVSV +LVSILE LL +K+ K V+ +PRNGDV FTHAN++LA ++  YK
Sbjct  361  QFRIFNLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPRNGDVQFTHANITLAQRELRYK  420

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL +GL+KFV+WY+SYY    R  T +
Sbjct  421  PTTDLQTGLKKFVRWYLSYYSGTKRKTTSV  450



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  285  YFFFTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  345  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  405  PTTDLQTGLKKFVRWYLSYY  424



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  290  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL + AK++++K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  350  QLRVYNLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPRNGDVQFTHANISLAQRELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+ YY
Sbjct  410  PSTDLQTGLKKFVRWYLGYY  429



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KS GSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSPGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL++GL+KFVKWY+SYYG
Sbjct  403  PTTDLATGLKKFVKWYLSYYG  423



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+GKPIN+Y    DK++ARDFT+IDD+VKGCVGALDTA +STGSGGKKKGPA
Sbjct  299  YFSFTRDILKGKPINIYQGPHDKDLARDFTFIDDIVKGCVGALDTAGESTGSGGKKKGPA  358

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LR++NLGNTSPV+V  LV +LE  L +KA K  +KMPRNGDVPFTHANVSLA     YK
Sbjct  359  MLRLFNLGNTSPVTVPVLVELLEKHLKVKAVKQFIKMPRNGDVPFTHANVSLAQAQLAYK  418

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTE  447
            PTT+L +GL+KFV WY+ YY +QS   T 
Sbjct  419  PTTNLDTGLKKFVTWYLKYYNVQSTKSTR  447



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  286  YFFFTRDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  346  QLRVFNLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY++YY
Sbjct  406  PTTDLQTGLKKFVKWYLNYY  425



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  280  YFFFTRDILKEKSIPIFEAPNRGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPA  339

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLR++NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYK
Sbjct  340  QLRIFNLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYK  399

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  400  PTTDLQTGLKKFVRWYLKYY  419



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  285  YFSFTRNILQGKPITIYRGKNRADLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+S A ++FGYK
Sbjct  345  PYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISSAQREFGYK  404

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFV+WY+SYYG  +R
Sbjct  405  PTTDLQTGLKKFVRWYLSYYGYNNR  429



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  284  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYK
Sbjct  344  PYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  404  PTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGS GKK GPA
Sbjct  281  YFFFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSRGKKHGPA  340

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LV ILE  L +KAKKN++ MP NGDVPFTHAN+S A ++ GYK
Sbjct  341  PYRIFNLGNTSPVTVPALVGILERNLKMKAKKNIIDMPGNGDVPFTHANISSARRELGYK  400

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  401  PTTDLQTGLKKFVRWYLSYYG  421



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  284  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYK
Sbjct  344  PYRIFNLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  404  PTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  403  PTTDLQTGLKKFVKWYLSYYG  423



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  351  QLRVFNLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  411  PTTDLQTGLKKFVRWYLSYY  430



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTRDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  351  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  411  PTTDLQTGLKKFVRWYLSYY  430



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTK++L+GKPI +Y  +   ++ARDFTYIDDVVKGCV +LDTAEKSTGSGGKK+ PA
Sbjct  282  YFSFTKNILKGKPITIYRGKNQVDLARDFTYIDDVVKGCVASLDTAEKSTGSGGKKRRPA  341

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  +VSILE  L +KAKKNVV MP NGDVPFTHAN++ A ++  YK
Sbjct  342  QYRIFNLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPGNGDVPFTHANITAARRELAYK  401

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  402  PTTDLQTGLKKFVRWYLSYYG  422



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYK
Sbjct  349  PYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L  GL+KFVKWY+SYYG
Sbjct  409  PTTNLDVGLKKFVKWYLSYYG  429



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  403  PTTDLQTGLKKFVKWYLSYYG  423



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  287  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A ++ GYK
Sbjct  347  QLRVYNLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+ YY
Sbjct  407  PTTDLKTGLKKFVEWYLGYY  426



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYK
Sbjct  349  PYRIFNLGNTSPVTVPSLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L  GL+KFVKWY+SYYG
Sbjct  409  PTTNLDVGLKKFVKWYLSYYG  429



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  278  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPA  337

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYK
Sbjct  338  PYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYK  397

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  398  PTTDLQTGLKKFVKWYLSYYG  418



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   191 bits (484),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTK +LQGKPI +Y  +   ++ARDFTYIDDVVKGCV +LDTA+KSTGSGGKK+GPA
Sbjct  284  YFSFTKGILQGKPITIYRGKNRVDLARDFTYIDDVVKGCVASLDTAKKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  +V ILE  L +KAKKN V MP NGDVPFTHAN+SLA ++ GYK
Sbjct  344  QYRIFNLGNTSPVTVPMMVGILERHLKVKAKKNYVDMPGNGDVPFTHANISLARRELGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY++YYG
Sbjct  404  PTTDLQTGLKKFVKWYLAYYG  424



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   191 bits (484),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GKPI ++       VARDFT+IDD+VKGCV ALDTAEKSTGSGGKKKGPA
Sbjct  285  YFFFTRDILKGKPIPIFEASNHGTVARDFTFIDDIVKGCVSALDTAEKSTGSGGKKKGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRVYNLGNTSPV V  LV+ILE LL  KA + V+K+PRNGDV FTHAN+SLA ++  YK
Sbjct  345  QLRVYNLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPRNGDVQFTHANISLAQRELDYK  404

Query  361  PTTDLSSGLRKFVKWYVSYYGIQS  432
            PTTDL +GL+KFV+WY+ YY + +
Sbjct  405  PTTDLQTGLKKFVRWYLDYYAVDA  428



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score =   190 bits (482),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTK+ML+GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPA
Sbjct  263  YFSFTKNMLRGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPA  322

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY 
Sbjct  323  QLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYM  382

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GLRKF+ WY+ YY    R
Sbjct  383  PTTDLKTGLRKFLNWYLDYYSESKR  407



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPA
Sbjct  302  YFFFTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPA  361

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE+LL +KAK+ V+K+PRNGDV +THAN+S A ++ GYK
Sbjct  362  QLRVFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNGDVQYTHANISYAKRELGYK  421

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL  GL+KFV+WY++YY
Sbjct  422  PTTDLQGGLKKFVRWYLNYY  441



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+ ++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVTILERLLKVKAKRALMKLPRNGDVQFTHANISFAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTT L +GL+KFV+WY+SYY
Sbjct  408  PTTYLQTGLKKFVRWYLSYY  427



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYK
Sbjct  349  PYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L  GL+KFVKWY+SYYG
Sbjct  409  PTTNLDVGLKKFVKWYLSYYG  429



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTK+ML GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPA
Sbjct  263  YFSFTKNMLSGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPA  322

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY 
Sbjct  323  QLRVFNLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYM  382

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GLRKF+ WY+ YY    R
Sbjct  383  PTTDLKTGLRKFLNWYLDYYSESKR  407



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA
Sbjct  290  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYK
Sbjct  350  PYRIFNLGNTSPVTVPTLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLARQQLGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L +GL+KFVKWY+SYYG
Sbjct  410  PTTNLDAGLKKFVKWYLSYYG  430



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKKKGPA
Sbjct  293  YFFFTRDILKGKTIPIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL  KAK+NV+K+PRNGDV FTHAN+S A  + GYK
Sbjct  353  QLRVFNLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPRNGDVQFTHANISYAQTELGYK  412

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P TDL +GL+KFV+WY++YY
Sbjct  413  PVTDLQTGLKKFVRWYLNYY  432



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LV ILE  L +KAKKN+V MP NGDVPFTHAN+SLA  +FGYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVGILERHLKMKAKKNIVDMPGNGDVPFTHANISLARMEFGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY++YYG
Sbjct  403  PTTDLQTGLKKFVRWYLNYYG  423



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A  + GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARAELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  403  PTTDLQTGLKKFVKWYLSYYG  423



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY++YYG
Sbjct  403  PTTDLETGLKKFVKWYLTYYG  423



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA
Sbjct  293  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKK+V++MP NGDVPFTHAN+SLA +  GYK
Sbjct  353  PYRIFNLGNTSPVTVPTLVSILEKHLRVKAKKHVIEMPGNGDVPFTHANISLARQQLGYK  412

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L +GL+KFVKWY+SYYG
Sbjct  413  PTTNLDAGLKKFVKWYLSYYG  433



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A
Sbjct  286  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGSA  345

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYK
Sbjct  346  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISLARRELGYK  405

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  406  PTTDLQTGLKKFVKWYLSYYG  426



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK   ++     + VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  291  YFFFTRDILKGKTXPIFEGANHRTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+ + K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  351  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRKITKLPRNGDVQFTHANISLAQRELGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY+SYY
Sbjct  411  PTTDLQTGLKKFVRWYLSYY  430



>ref|XP_004515772.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Cicer arietinum]
Length=438

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GK I V+ + +   V+RDFTYIDD+VKGC+GALDTA+KSTGSGGKKKG A
Sbjct  288  YFFFTKDILKGKTITVFESPDGGTVSRDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGSA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q RV+NLGNTSPV V  LV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA+KD GY+
Sbjct  348  QFRVFNLGNTSPVPVSDLVAILERLLKVTAKKKVLPMPRNGDVKFTHANISLAHKDLGYR  407

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            PT DL +GLRKFVKWY+ +Y   S  K
Sbjct  408  PTIDLETGLRKFVKWYLEFYSSGSNYK  434



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTY+DD+VKGC+ ALDTAEKSTGSGGKKKGPA
Sbjct  288  YFFFTRDILKGKSIPIFEAANHGTVARDFTYVDDIVKGCLAALDTAEKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A ++ GYK
Sbjct  348  QLRVFNLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYK  407

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            P+TDL +GL+KFV+WY++YYG
Sbjct  408  PSTDLQTGLKKFVRWYLNYYG  428



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPA
Sbjct  293  YFFFTRDILKGKTIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPA  352

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE LL  KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  353  QLRVFNLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPRNGDVQFTHANISYAQRELGYK  412

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P TDL +GL+KFV+WY++YY
Sbjct  413  PVTDLQAGLKKFVRWYLNYY  432



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  278  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPA  337

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYK
Sbjct  338  PYRIFNLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYK  397

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  398  PTTDLQTGLKKFVRWYLSYYG  418



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FTK++LQGKPI +Y  +   E+ARDFTYIDD+VKGCV +LDTA++STGSGGKK+GPA
Sbjct  284  YFSFTKNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTAKRSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  +V ILE  L  KA KNVV+MP NGDVPFTHAN+S A  + GYK
Sbjct  344  QFRIFNLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPGNGDVPFTHANISSARIELGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  404  PTTDLQTGLKKFVRWYLSYYG  424



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVNILERHLRVKAKRNIVDMPGNGDVPFTHANISLAQRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY++YYG
Sbjct  403  PTTDLETGLKKFVKWYLTYYG  423



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G A
Sbjct  283  YFFFTRDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  343  QLRVFNLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KF +WY+ YY
Sbjct  403  PTTDLQTGLKKFARWYLGYY  422



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGK I +Y  +   E+ARDFTY+DDVV+GCV ALDTA+ STGSGG+K+G A
Sbjct  290  YFAFTRNILQGKAITIYRARGGAELARDFTYVDDVVRGCVAALDTAQPSTGSGGRKRGSA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R+YNLGNT+P+SV +LVSILE  L +KA +NVV+MP NGDVPFTHANV++A  + GYK
Sbjct  350  QYRIYNLGNTTPLSVPQLVSILERHLRVKATRNVVEMPGNGDVPFTHANVTMARLELGYK  409

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTEL  450
            PTTDL +GL+KFVKWY++YYG +   K ++
Sbjct  410  PTTDLQAGLKKFVKWYLNYYGYEHNGKGKI  439



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+G PI+VY     K++ARDFT+IDD+VKGCV +LDTAEKSTGSGGKK GPA
Sbjct  285  YFSFTRDILKGNPISVYSGAGGKDLARDFTFIDDIVKGCVASLDTAEKSTGSGGKKTGPA  344

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRV+NLGNTSPV+V  LV ILE  L+ KAK+ ++KMPRNGDVPFTHAN+S A    GY+
Sbjct  345  MLRVFNLGNTSPVTVPTLVDILEKHLNTKAKRQIIKMPRNGDVPFTHANISSAQAQLGYR  404

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L +GL+KFVKWY+SYYG
Sbjct  405  PTTNLDTGLKKFVKWYLSYYG  425



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFTKD+L+GKPI ++       VARDFTYIDD+VKGCV +LDTA+KSTGSGGKKKGPA
Sbjct  288  YFFFTKDILKGKPITIFEAPGHGSVARDFTYIDDIVKGCVASLDTAKKSTGSGGKKKGPA  347

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV NLGNTSPV V  LVSILE  L +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YK
Sbjct  348  QLRVINLGNTSPVPVSNLVSILEKHLKVKAKRKVLPMPRNGDVRFTHANISLAHKELRYK  407

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFVKWY+++Y
Sbjct  408  PTTDLETGLKKFVKWYLTHY  427



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A
Sbjct  283  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYK
Sbjct  343  PYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTTDL +GL+KFV+WY+SYYG  +R
Sbjct  403  PTTDLQTGLKKFVRWYLSYYGYNNR  427



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 112/141 (79%), Gaps = 10/141 (7%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+            PA
Sbjct  283  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSAG----------PA  332

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+
Sbjct  333  PYRIFNLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYR  392

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  393  PTTDLQTGLKKFVRWYLSYYG  413



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L  KAK+++V MP NGDVPFTHAN++LA ++FGYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSILEKHLKTKAKRHIVDMPGNGDVPFTHANITLARREFGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+ YYG
Sbjct  403  PTTDLQTGLKKFVKWYLWYYG  423



>ref|XP_004306933.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPA
Sbjct  287  YFFFTRDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV+ILE LL +KAK++++K+PRNGDV FTHAN+S A ++ GYK
Sbjct  347  QLRVFNLGNTSPVPVSDLVTILERLLKVKAKRSILKLPRNGDVQFTHANISSAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTTDL +GL+KFV+WY++YY
Sbjct  407  PTTDLQTGLKKFVRWYLTYY  426



>ref|XP_001777338.1| predicted protein [Physcomitrella patens]
 gb|EDQ57868.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+GK IN+Y     K++ARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK GPA
Sbjct  294  YFSFTQDILRGKAINIYTGSGGKDLARDFTYIDDIVKGCMRALDTAEKSTGSGGKKTGPA  353

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV+V  LV ILE  L  KA +N+VKMPRNGDVPFTHAN S A     Y 
Sbjct  354  QLRVFNLGNTSPVTVPILVDILEKHLKQKAIRNIVKMPRNGDVPFTHANTSSAQSQLNYH  413

Query  361  PTTDLSSGLRKFVKWYVSYYGI  426
            PTT+L +GLRKFVKWY+SYYG+
Sbjct  414  PTTNLDTGLRKFVKWYLSYYGV  435



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  4    FFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQ  183
            F FT++MLQGKPI VY  +   +++RDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A 
Sbjct  288  FTFTRNMLQGKPITVYRGKNRVDLSRDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGAAP  347

Query  184  LRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKP  363
             R++NLGNTSPV+V  LVSILE LL +KAKKN+V MP NGDVPFTHAN++ A ++FGYKP
Sbjct  348  YRIFNLGNTSPVTVPTLVSILERLLKVKAKKNIVDMPGNGDVPFTHANITSARREFGYKP  407

Query  364  TTDLSSGLRKFVKWYVSYYG  423
            TTD+ +GL+KFVKWY+SYYG
Sbjct  408  TTDIQTGLKKFVKWYLSYYG  427



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGG+K+GPA
Sbjct  283  YFSFTRNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVASLDTAQKSTGSGGRKRGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  LV ILE  L +KAK++VV+MP NGDVPFTHAN+S A  + GY 
Sbjct  343  QYRIFNLGNTSPVTVPALVGILERHLKVKAKRHVVEMPGNGDVPFTHANISSARTELGYN  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            PTT+L +GL+KFVKWY+SYYG   R
Sbjct  403  PTTNLEAGLKKFVKWYLSYYGYNPR  427



>gb|EYU30554.1| hypothetical protein MIMGU_mgv1a006591mg [Erythranthe guttata]
Length=438

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L+GK I ++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG A
Sbjct  291  YFFFTRDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGVA  350

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            QLRV+NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNGDV FTHAN+SLA ++ GYK
Sbjct  351  QLRVFNLGNTSPVPVSDLVGILEKLLKVKAKRLVMKLPRNGDVQFTHANISLAEREIGYK  410

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            P+TDL +GL+KFV+WY+SYY
Sbjct  411  PSTDLQTGLKKFVQWYLSYY  430



>emb|CAN60968.1| hypothetical protein VITISV_008097 [Vitis vinifera]
Length=435

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L GKPI ++   +   VARDFTYIDD+VKGC+ +LDTA+KSTG+GGKKKG A
Sbjct  287  YFFFTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNGDV +THAN+SLA ++ GYK
Sbjct  347  QFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSY  417
            PTTDL SGL+KFV+WY++Y
Sbjct  407  PTTDLESGLKKFVRWYITY  425



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI V+  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK GPA
Sbjct  283  YFSFTRNILQGKPITVFRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKTGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+S A ++ GYK
Sbjct  343  PYRIFNLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNGDVPFTHANISSARRELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFV+WY+SYYG
Sbjct  403  PTTDLQTGLKKFVRWYLSYYG  423



>ref|XP_003635586.2| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=435

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+D+L GKPI ++   +   VARDFTYIDD+VKGC+ +LDTA+KSTG+GGKKKG A
Sbjct  287  YFFFTRDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAA  346

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNGDV +THAN+SLA ++ GYK
Sbjct  347  QFRIFNLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYK  406

Query  361  PTTDLSSGLRKFVKWYVSY  417
            PTTDL SGL+KFV+WY++Y
Sbjct  407  PTTDLESGLKKFVRWYITY  425



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   E+ARDFTYIDD+VKGCV +LDT++KSTGSGGKK+GPA
Sbjct  284  YFSFTRNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTSKKSTGSGGKKRGPA  343

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  +VS+LE  L +KAKK+ ++MP NGDVPFTHAN+S A  + GYK
Sbjct  344  QFRIFNLGNTSPVTVPMMVSLLEKHLKVKAKKHFLEMPGNGDVPFTHANISSAQIELGYK  403

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GLRKFV+WY+SYYG
Sbjct  404  PTTDLQTGLRKFVRWYLSYYG  424



>ref|XP_010323223.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Solanum lycopersicum]
Length=425

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  279  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPA  338

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYK
Sbjct  339  PYRIFNLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYK  398

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  399  PTTDLQTGLKKFVKWYLSYYG  419



>ref|XP_006343570.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=425

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA
Sbjct  279  YFSFTRNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPA  338

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYK
Sbjct  339  PYRIFNLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYK  398

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY+SYYG
Sbjct  399  PTTDLQTGLKKFVKWYLSYYG  419



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYK
Sbjct  349  PYRIFNLGNTSPVTVPNLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLAREQLGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            P+T+L  GL+KFVKWY+SYYG
Sbjct  409  PSTNLDVGLKKFVKWYLSYYG  429



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A
Sbjct  283  YFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYK
Sbjct  343  PYRIFNLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSR  435
            P+TDL +GL+KFV+WY+SYYG  +R
Sbjct  403  PSTDLQTGLKKFVRWYLSYYGYNNR  427



>ref|XP_001751991.1| predicted protein [Physcomitrella patens]
 gb|EDQ83426.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+GKPI++Y     K++ARDFTYIDD+VKGCV +LDTAEKSTGSGGKK GPA
Sbjct  290  YFSFTRDILKGKPISIYSGAGGKDLARDFTYIDDIVKGCVASLDTAEKSTGSGGKKSGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRV+NLGNTSPV+V  LV ILE  L +KAK+  +KMPRNGDVPFTHAN+S A     YK
Sbjct  350  MLRVFNLGNTSPVTVPTLVDILEKYLKVKAKRETIKMPRNGDVPFTHANISSAELQLHYK  409

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVK  441
            P T+L +GL+KFVKWY+SYYG  S  K
Sbjct  410  PVTNLDTGLKKFVKWYLSYYGDSSNRK  436



>ref|XP_001754001.1| predicted protein [Physcomitrella patens]
 gb|EDQ81323.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+D+L+GKPI+VY     K++ARDFT+IDD+VKGCV +LDTAEKSTGSGGKK GPA
Sbjct  290  YFSFTRDILKGKPISVYSGPGGKDLARDFTFIDDIVKGCVASLDTAEKSTGSGGKKTGPA  349

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRV+NLGNTSPV+V  LV ILE  L++KAK+ ++ MPRNGDVPFTHAN+S A +   Y+
Sbjct  350  MLRVFNLGNTSPVTVPALVDILEKYLNVKAKREIINMPRNGDVPFTHANISSAQEQLHYR  409

Query  361  PTTDLSSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  465
            P T+L +GL+KFVKWY+SYYG  S  K  L    Q
Sbjct  410  PVTNLDTGLKKFVKWYLSYYGDNSNRKLWLGKHEQ  444



>ref|XP_008794557.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Phoenix dactylifera]
Length=462

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YFFFT+++L+GKPI+++       VARDFTYIDD+V+GCV ALDTA KSTGSGGKK+GPA
Sbjct  306  YFFFTRNILRGKPISIFEGPGHATVARDFTYIDDIVRGCVAALDTAGKSTGSGGKKRGPA  365

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
             LRVYNLGNTSPV V  LVSILENLL +KA +  VKMPRNGDV FTHAN+SLA ++ GY 
Sbjct  366  PLRVYNLGNTSPVPVADLVSILENLLGVKAVRKAVKMPRNGDVQFTHANISLAQRELGYH  425

Query  361  PTTDLSSGLRKFVKWYVSYY  420
            PTT+L +GL++FV+WY+ YY
Sbjct  426  PTTNLHTGLKRFVRWYLQYY  445



>dbj|BAJ88176.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQ----EDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkk  168
            YFFFT+D+L G+PI VY +         ++RDFTYIDD+VKGC+GALDTA +STGSGGKK
Sbjct  310  YFFFTRDILAGRPITVYESSGGGTHQTTISRDFTYIDDIVKGCIGALDTAGRSTGSGGKK  369

Query  169  kgPAQLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKD  348
            +GPA  R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNGDVP+THAN+SLA ++
Sbjct  370  RGPAPFRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNGDVPYTHANISLAQRE  429

Query  349  FGYKPTTDLSSGLRKFVKWYVSYYGIQSRVKTELH  453
             GY+P+TDL +GL+KFV+WY+ YY  +  VK + H
Sbjct  430  LGYRPSTDLQTGLKKFVRWYLEYYNPELVVKQKQH  464



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++   +ARDFTYIDD+V+GC+ +LDTA +STG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGRDHVALARDFTYIDDIVRGCLASLDTAGRSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
            Q R++NLGNTSPV+V  LV+ILE  L +KAKKNVV+MP NGDVP+THAN+SLA ++ GYK
Sbjct  349  QYRIFNLGNTSPVTVPTLVAILERYLRVKAKKNVVEMPGNGDVPYTHANISLAREELGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT L  GL+KFV+WY+SYYG
Sbjct  409  PTTSLEMGLKKFVRWYLSYYG  429



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA
Sbjct  289  YFSFTRNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPA  348

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNT+PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN++LA +  GYK
Sbjct  349  PYRIFNLGNTAPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANITLARQQLGYK  408

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTT+L  GL+KFVKWY SYYG
Sbjct  409  PTTNLDVGLKKFVKWYQSYYG  429



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +1

Query  1    YFFFTKDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPA  180
            YF FT+++LQGK I VY  ++  ++ARDFTYIDD+VKGCV +LDT+ KSTGSGGKKKGPA
Sbjct  283  YFSFTRNILQGKRITVYRGKDHTDLARDFTYIDDIVKGCVASLDTSGKSTGSGGKKKGPA  342

Query  181  QLRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYK  360
              R++NLGNTSPV+V  LV ILE  L +KAK+NVV+MP NGDVPFTHAN+SLA K+ GYK
Sbjct  343  PYRIFNLGNTSPVTVPDLVGILEKHLKVKAKRNVVEMPGNGDVPFTHANISLAQKELGYK  402

Query  361  PTTDLSSGLRKFVKWYVSYYG  423
            PTTDL +GL+KFVKWY SYYG
Sbjct  403  PTTDLQTGLKKFVKWYQSYYG  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720