BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030D12

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP32393.1|  hypothetical protein JCGZ_13318                         236   1e-70   Jatropha curcas
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       235   3e-70   Phoenix dactylifera
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       233   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB64775.1|  hypothetical protein B456_010G064200                    231   1e-68   Gossypium raimondii
gb|KJB07736.1|  hypothetical protein B456_001G041900                    224   4e-66   Gossypium raimondii
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like            223   2e-65   
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like            223   3e-65   
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            222   3e-65   Cucumis melo [Oriental melon]
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    221   7e-65   Nelumbo nucifera [Indian lotus]
gb|AFR11354.1|  nitrate transporter                                     221   9e-65   Cucumis sativus [cucumbers]
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    220   2e-64   Eucalyptus grandis [rose gum]
gb|KGN60671.1|  hypothetical protein Csa_2G006170                       220   2e-64   
ref|XP_003609313.1|  Nitrate transporter                                219   3e-64   Medicago truncatula
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    218   8e-64   Vitis vinifera
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    217   2e-63   
ref|XP_002524480.1|  oligopeptide transporter, putative                 217   2e-63   Ricinus communis
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            217   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       216   5e-63   Nicotiana sylvestris
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    214   2e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            214   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    214   3e-62   Nicotiana tomentosiformis
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       214   3e-62   Cucumis melo [Oriental melon]
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            214   4e-62   Cicer arietinum [garbanzo]
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    213   8e-62   Vitis vinifera
gb|AGA60121.1|  nitrate transporter NRT1.4B                             213   8e-62   Cucumis sativus [cucumbers]
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       213   1e-61   Sesamum indicum [beniseed]
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like            213   1e-61   Glycine max [soybeans]
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like            213   1e-61   
gb|KHN47160.1|  Nitrate transporter 1.4                                 212   1e-61   Glycine soja [wild soybean]
emb|CDX71495.1|  BnaC04g17300D                                          213   1e-61   
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             212   2e-61   Phaseolus vulgaris [French bean]
emb|CDY45207.1|  BnaA07g12830D                                          211   3e-61   Brassica napus [oilseed rape]
ref|XP_002880817.1|  nitrate transporter                                211   4e-61   Arabidopsis lyrata subsp. lyrata
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             211   5e-61   Eutrema salsugineum [saltwater cress]
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            210   9e-61   Brassica rapa
ref|NP_850084.1|  nitrate transporter 1.4                               209   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20651.1|  putative nitrate transporter                            209   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       209   2e-60   Nicotiana sylvestris
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       209   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       209   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    209   3e-60   Camelina sativa [gold-of-pleasure]
emb|CDY30787.1|  BnaC07g16870D                                          209   3e-60   Brassica napus [oilseed rape]
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    208   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010093242.1|  Nitrate transporter 1.4                            208   3e-60   
gb|AAB95302.1|  putative nitrate transporter                            208   6e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15097.1|  Nitrate transporter 1.4                                 207   7e-60   Glycine soja [wild soybean]
ref|XP_006475801.1|  PREDICTED: nitrate transporter 1.4-like isof...    204   7e-60   
ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            207   8e-60   Solanum tuberosum [potatoes]
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...    207   9e-60   Citrus sinensis [apfelsine]
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                   207   1e-59   Citrus sinensis [apfelsine]
gb|KJB82816.1|  hypothetical protein B456_013G215400                    207   1e-59   Gossypium raimondii
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    207   1e-59   Arabis alpina [alpine rockcress]
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760          207   1e-59   
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       206   2e-59   Solanum lycopersicum
ref|XP_011458172.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            206   2e-59   Fragaria vesca subsp. vesca
emb|CDP10398.1|  unnamed protein product                                206   2e-59   Coffea canephora [robusta coffee]
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    206   2e-59   
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    206   3e-59   Phoenix dactylifera
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...    206   9e-59   
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            204   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            204   1e-58   Solanum tuberosum [potatoes]
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    204   1e-58   Citrus sinensis [apfelsine]
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             204   2e-58   Citrus clementina [clementine]
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       203   3e-58   
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                   203   3e-58   Gossypium arboreum [tree cotton]
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                203   3e-58   Erythranthe guttata [common monkey flower]
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       203   4e-58   Elaeis guineensis
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    202   7e-58   
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       201   1e-57   
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    200   5e-57   Nicotiana tomentosiformis
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg             199   8e-57   
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like            198   3e-56   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       197   6e-56   Eucalyptus grandis [rose gum]
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       196   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             194   5e-55   
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       193   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       191   6e-54   
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    191   7e-54   Solanum lycopersicum
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       191   8e-54   
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     191   2e-53   Eucalyptus grandis [rose gum]
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       190   2e-53   
gb|EMT23542.1|  Nitrate/chlorate transporter                            187   3e-52   
ref|XP_007013427.1|  Major facilitator superfamily protein, putative    185   2e-51   
ref|XP_010093703.1|  Nitrate transporter 1.1                            176   1e-50   
dbj|BAJ90833.1|  predicted protein                                      180   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    179   3e-49   
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...    178   8e-49   Setaria italica
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            177   1e-48   
emb|CBI28188.3|  unnamed protein product                                177   1e-48   Vitis vinifera
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    176   4e-48   Citrus sinensis [apfelsine]
emb|CDY69100.1|  BnaCnng61860D                                          171   5e-48   Brassica napus [oilseed rape]
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       175   7e-48   Sesamum indicum [beniseed]
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    175   7e-48   
emb|CDY30051.1|  BnaC05g09690D                                          171   8e-48   Brassica napus [oilseed rape]
gb|ACJ85583.1|  unknown                                                 171   9e-48   Medicago truncatula
emb|CAD32549.1|  dicarboxylate transporter                              174   2e-47   Alnus glutinosa
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006841166.1|  hypothetical protein AMTR_s00086p00160300          174   2e-47   
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                    173   3e-47   Arabis alpina [alpine rockcress]
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       173   4e-47   Zea mays [maize]
ref|XP_006307075.1|  hypothetical protein CARUB_v10008661mg             173   4e-47   Capsella rubella
gb|EYU29794.1|  hypothetical protein MIMGU_mgv1a003534mg                173   4e-47   Erythranthe guttata [common monkey flower]
emb|CDY26539.1|  BnaA09g47380D                                          172   6e-47   Brassica napus [oilseed rape]
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter         173   6e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31242.1|  BnaC08g15370D                                          172   6e-47   Brassica napus [oilseed rape]
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            172   7e-47   Brassica rapa
emb|CDY21035.1|  BnaA08g24900D                                          172   7e-47   Brassica napus [oilseed rape]
ref|NP_563899.1|  nitrate transporter 1.1                               172   7e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAA80582.1|  RCH2 protein                                            172   7e-47   Brassica napus [oilseed rape]
ref|XP_002889915.1|  NRT1.1                                             172   8e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       172   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010476167.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       172   1e-46   Camelina sativa [gold-of-pleasure]
ref|NP_001169613.1|  uncharacterized protein LOC100383494               172   1e-46   Zea mays [maize]
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g             172   1e-46   Phaseolus vulgaris [French bean]
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            171   2e-46   Eucalyptus grandis [rose gum]
emb|CDY15967.1|  BnaC08g41560D                                          170   4e-46   Brassica napus [oilseed rape]
gb|KHG28852.1|  Uncharacterized protein F383_16009                      169   4e-46   Gossypium arboreum [tree cotton]
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       170   4e-46   Brassica rapa
gb|AEA35415.1|  nitrate transporter                                     170   5e-46   Brassica rapa subsp. chinensis [bok-choy]
gb|ACT66297.1|  truncated nitrate transporter                           161   5e-46   Fragaria vesca [alpine strawberry]
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       170   5e-46   Populus euphratica
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                   170   5e-46   Citrus sinensis [apfelsine]
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg             170   5e-46   Citrus clementina [clementine]
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg             170   6e-46   Eutrema salsugineum [saltwater cress]
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                    170   6e-46   
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    170   7e-46   Elaeis guineensis
ref|XP_003611286.1|  Nitrate transporter                                170   8e-46   Medicago truncatula
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like            169   1e-45   Citrus sinensis [apfelsine]
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       169   1e-45   Nelumbo nucifera [Indian lotus]
gb|KHN09796.1|  Nitrate transporter 1.1                                 169   1e-45   Glycine soja [wild soybean]
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like            169   1e-45   Glycine max [soybeans]
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             169   1e-45   Phaseolus vulgaris [French bean]
gb|KHN34951.1|  Nitrate transporter 1.1                                 169   2e-45   Glycine soja [wild soybean]
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1                 168   2e-45   Glycine max [soybeans]
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            168   2e-45   Glycine max [soybeans]
ref|XP_010919515.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    167   2e-45   Elaeis guineensis
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       168   3e-45   Elaeis guineensis
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...    167   4e-45   
ref|XP_003611284.1|  Nitrate transporter                                167   5e-45   Medicago truncatula
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   6e-45   Phoenix dactylifera
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   6e-45   Cucumis melo [Oriental melon]
ref|XP_002303512.2|  nitrate transporter family protein                 167   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_003608752.1|  Nitrate transporter                                167   7e-45   Medicago truncatula
ref|XP_002529778.1|  oligopeptide transporter, putative                 167   7e-45   Ricinus communis
ref|NP_001275529.1|  nitrate transporter 1.1-like                       167   7e-45   Cucumis sativus [cucumbers]
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like            167   7e-45   Cicer arietinum [garbanzo]
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   8e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006645998.1|  PREDICTED: nitrate transporter 1.4-like            167   8e-45   
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   9e-45   Tarenaya hassleriana [spider flower]
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       166   1e-44   Nelumbo nucifera [Indian lotus]
emb|CBI31901.3|  unnamed protein product                                166   1e-44   Vitis vinifera
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            166   2e-44   Vitis vinifera
emb|CAN71417.1|  hypothetical protein VITISV_004658                     166   2e-44   Vitis vinifera
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       165   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09929.1|  unnamed protein product                                165   3e-44   Coffea canephora [robusta coffee]
ref|XP_007039888.1|  Nitrate transporter 1.1 isoform 1                  165   3e-44   
ref|XP_008238567.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            165   4e-44   Prunus mume [ume]
gb|KJB20886.1|  hypothetical protein B456_003G170400                    165   5e-44   Gossypium raimondii
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       165   5e-44   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC81420.1|  nitrate transporter                                    164   9e-44   Prunus persica
dbj|BAD22820.1|  nitrate transporter                                    164   9e-44   Prunus persica
ref|XP_007210870.1|  hypothetical protein PRUPE_ppa003177mg             164   1e-43   Prunus persica
ref|XP_004298652.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    163   1e-43   Fragaria vesca subsp. vesca
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       163   1e-43   Sesamum indicum [beniseed]
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       163   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG24776.1|  Uncharacterized protein F383_04224                      162   3e-43   Gossypium arboreum [tree cotton]
gb|KJB20885.1|  hypothetical protein B456_003G170300                    162   3e-43   Gossypium raimondii
ref|XP_009333599.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       162   3e-43   Pyrus x bretschneideri [bai li]
gb|KHG00259.1|  Uncharacterized protein F383_18798                      162   4e-43   Gossypium arboreum [tree cotton]
ref|XP_009333673.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       162   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    160   1e-42   
ref|XP_007039889.1|  Nitrate transporter 1.1 isoform 2                  160   2e-42   
gb|KHG27943.1|  Uncharacterized protein F383_15837                      160   2e-42   Gossypium arboreum [tree cotton]
ref|XP_008358135.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       160   2e-42   Malus domestica [apple tree]
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            160   2e-42   Brachypodium distachyon [annual false brome]
gb|KJB25599.1|  hypothetical protein B456_004G199600                    160   3e-42   Gossypium raimondii
dbj|BAD87491.1|  putative dicarboxylate transporter                     159   7e-42   Oryza sativa Japonica Group [Japonica rice]
gb|ABF93501.1|  Nitrate/chlorate transporter, putative, expressed       159   7e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CAC07206.1|  nitrate transporter                                    158   9e-42   Brassica napus [oilseed rape]
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       158   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    158   1e-41   Cucumis melo [Oriental melon]
ref|XP_006650950.1|  PREDICTED: nitrate transporter 1.1-like            157   1e-41   
ref|XP_009376056.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   2e-41   Solanum lycopersicum
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   3e-41   
ref|XP_004147617.1|  PREDICTED: nitrate transporter 1.1-like            157   3e-41   Cucumis sativus [cucumbers]
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    156   4e-41   Elaeis guineensis
gb|EYU18566.1|  hypothetical protein MIMGU_mgv1a020825mg                156   4e-41   Erythranthe guttata [common monkey flower]
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                156   6e-41   Erythranthe guttata [common monkey flower]
gb|EAY74514.1|  hypothetical protein OsI_02405                          156   6e-41   Oryza sativa Indica Group [Indian rice]
ref|NP_001043326.1|  Os01g0556700                                       155   8e-41   
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like            155   1e-40   Setaria italica
gb|EAZ12317.1|  hypothetical protein OsJ_02208                          155   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       155   2e-40   Phoenix dactylifera
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like            154   2e-40   Setaria italica
ref|XP_009800593.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    154   2e-40   Nicotiana sylvestris
emb|CAC00545.1|  putative low-affinity nitrate transporter              154   2e-40   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          154   2e-40   Sorghum bicolor [broomcorn]
ref|XP_008649786.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       154   3e-40   Zea mays [maize]
ref|XP_009598780.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       154   3e-40   Nicotiana tomentosiformis
dbj|BAC56916.1|  nitrate transporter                                    154   3e-40   Nicotiana tabacum [American tobacco]
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       154   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like            154   3e-40   Solanum tuberosum [potatoes]
gb|EAY88182.1|  hypothetical protein OsI_09629                          154   3e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    154   4e-40   Setaria italica
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    153   4e-40   Nicotiana tomentosiformis
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    153   6e-40   
gb|EMT27348.1|  Nitrate/chlorate transporter                            150   7e-40   
dbj|BAC56915.1|  nitrate transporter                                    153   7e-40   Nicotiana tabacum [American tobacco]
ref|XP_009763469.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       153   7e-40   Nicotiana sylvestris
ref|NP_001145735.1|  uncharacterized protein LOC100279242               153   8e-40   Zea mays [maize]
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    153   9e-40   
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470          152   9e-40   Sorghum bicolor [broomcorn]
ref|XP_008367434.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    152   1e-39   
ref|XP_010669517.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            151   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS53820.1|  Nitrate transporter 1.4                                 151   2e-39   Triticum urartu
dbj|BAK05363.1|  predicted protein                                      151   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       151   3e-39   Nicotiana tomentosiformis
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       151   3e-39   Sesamum indicum [beniseed]
dbj|BAJ90348.1|  predicted protein                                      151   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       150   5e-39   Nicotiana sylvestris
gb|KDP25643.1|  hypothetical protein JCGZ_20799                         150   6e-39   Jatropha curcas
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       150   7e-39   Zea mays [maize]
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       150   8e-39   Phoenix dactylifera
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like            150   8e-39   Oryza brachyantha
gb|EEC67416.1|  hypothetical protein OsI_34598                          149   1e-38   Oryza sativa Indica Group [Indian rice]
gb|EMT10378.1|  Nitrate/chlorate transporter                            149   1e-38   
gb|EAZ16929.1|  hypothetical protein OsJ_32411                          149   1e-38   Oryza sativa Japonica Group [Japonica rice]
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed       149   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       150   1e-38   Tarenaya hassleriana [spider flower]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                  149   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       149   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       148   3e-38   Zea mays [maize]
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    148   3e-38   Citrus sinensis [apfelsine]
ref|XP_004242006.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       148   4e-38   Solanum lycopersicum
ref|XP_006366745.1|  PREDICTED: nitrate transporter 1.1-like            147   7e-38   Solanum tuberosum [potatoes]
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       147   1e-37   Elaeis guineensis
dbj|BAC99394.1|  putative nitrate transporter                           146   2e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KJB64774.1|  hypothetical protein B456_010G064200                    145   2e-37   Gossypium raimondii
gb|KJB64773.1|  hypothetical protein B456_010G064200                    145   2e-37   Gossypium raimondii
ref|XP_002468692.1|  hypothetical protein SORBIDRAFT_01g050410          146   2e-37   Sorghum bicolor [broomcorn]
gb|EPS59108.1|  hypothetical protein M569_15702                         145   3e-37   Genlisea aurea
gb|EAZ41557.1|  hypothetical protein OsJ_26080                          145   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KHN42706.1|  Nitrate transporter 1.1                                 145   3e-37   Glycine soja [wild soybean]
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   5e-37   Brachypodium distachyon [annual false brome]
ref|XP_011005904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    144   1e-36   Populus euphratica
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            144   1e-36   Brachypodium distachyon [annual false brome]
ref|NP_001173227.1|  Os03g0103000                                       136   1e-36   
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like            143   2e-36   Solanum tuberosum [potatoes]
ref|XP_006659845.1|  PREDICTED: nitrate transporter 1.1-like            142   2e-36   
gb|EMT12146.1|  Nitrate/chlorate transporter                            135   3e-36   
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2    142   3e-36   
emb|CAC00544.1|  putative low-affinity nitrate transporter              142   3e-36   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002301604.2|  hypothetical protein POPTR_0002s21630g             142   4e-36   
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       142   4e-36   Nicotiana tomentosiformis
gb|EYU24743.1|  hypothetical protein MIMGU_mgv1a003354mg                142   4e-36   Erythranthe guttata [common monkey flower]
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       142   4e-36   Nicotiana sylvestris
gb|EAZ09238.1|  hypothetical protein OsI_31511                          136   8e-36   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98569.1|  predicted protein                                      140   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090          140   3e-35   Sorghum bicolor [broomcorn]
gb|EEC73483.1|  hypothetical protein OsI_07814                          141   3e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001047240.1|  Os02g0580900                                       139   4e-35   
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    139   6e-35   Eucalyptus grandis [rose gum]
ref|XP_011005903.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    138   1e-34   Populus euphratica
ref|XP_002274227.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            139   1e-34   Vitis vinifera
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       138   1e-34   Solanum lycopersicum
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              137   2e-34   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             137   2e-34   
ref|XP_001781235.1|  predicted protein                                  137   2e-34   
emb|CBI28855.3|  unnamed protein product                                139   8e-34   Vitis vinifera
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373             135   1e-33   
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             134   3e-33   
tpg|DAA41872.1|  TPA: hypothetical protein ZEAMMB73_744112              131   4e-33   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like            134   5e-33   Solanum tuberosum [potatoes]
dbj|BAJ34220.1|  unnamed protein product                                129   1e-32   Eutrema halophilum
ref|XP_009365099.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            132   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106             132   2e-32   
ref|NP_001281186.1|  peptide transporter PTR2                           132   2e-32   
gb|ACG29230.1|  peptide transporter PTR2                                132   2e-32   
gb|ACF22756.1|  nitrate transporter                                     132   2e-32   
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            132   2e-32   
ref|XP_008379664.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   2e-32   
ref|XP_008230007.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            131   4e-32   
ref|XP_004952902.1|  PREDICTED: nitrate transporter 1.3-like            131   5e-32   
gb|KDO54284.1|  hypothetical protein CISIN_1g008231mg                   130   6e-32   
ref|XP_008670698.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       131   6e-32   
ref|XP_006447629.1|  hypothetical protein CICLE_v10014744mg             130   7e-32   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...    129   1e-31   
gb|ACR34962.1|  unknown                                                 129   1e-31   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            129   2e-31   
gb|KDP30797.1|  hypothetical protein JCGZ_13740                         129   3e-31   
ref|XP_006406246.1|  hypothetical protein EUTSA_v10020360mg             128   4e-31   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       128   5e-31   
ref|XP_011047208.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       128   5e-31   
ref|XP_007214955.1|  hypothetical protein PRUPE_ppa003196mg             128   5e-31   
ref|XP_010510466.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       128   6e-31   
ref|XP_010488187.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            128   6e-31   
ref|XP_010035531.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            128   6e-31   
ref|XP_009785350.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       127   8e-31   
ref|XP_010466420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       127   8e-31   
ref|XP_008798047.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    125   8e-31   
ref|XP_008798048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    125   8e-31   
gb|KDO54285.1|  hypothetical protein CISIN_1g008231mg                   127   8e-31   
ref|XP_008342128.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       127   1e-30   
gb|ACJ85753.1|  unknown                                                 123   2e-30   
ref|XP_006441808.1|  hypothetical protein CICLE_v10019334mg             127   2e-30   
ref|XP_011100362.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            127   2e-30   
ref|XP_002975508.1|  hypothetical protein SELMODRAFT_103849             126   2e-30   
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like            126   2e-30   
ref|XP_010548417.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    126   2e-30   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             126   3e-30   
gb|KJB46720.1|  hypothetical protein B456_008G2375002                   125   3e-30   
ref|XP_002885459.1|  nitrate transporter                                126   3e-30   
emb|CDY44319.1|  BnaC05g30740D                                          125   3e-30   
emb|CDY38629.1|  BnaA05g19580D                                          125   4e-30   
ref|NP_176183.1|  probable peptide/nitrate transporter                  125   4e-30   
gb|KJB46719.1|  hypothetical protein B456_008G2375002                   125   4e-30   
ref|XP_009109414.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       125   5e-30   
ref|XP_008798046.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    125   6e-30   
ref|XP_006478312.1|  PREDICTED: probable peptide/nitrate transpor...    125   7e-30   
ref|XP_006297285.1|  hypothetical protein CARUB_v10013300mg             125   7e-30   
ref|XP_010913451.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            125   9e-30   
gb|AFK36687.1|  unknown                                                 124   1e-29   
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like            124   1e-29   
ref|XP_009391232.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            124   2e-29   
ref|XP_002888185.1|  proton-dependent oligopeptide transport fami...    124   2e-29   
ref|XP_007049158.1|  Major facilitator superfamily protein isoform 1    124   2e-29   
gb|EYU34037.1|  hypothetical protein MIMGU_mgv1a003180mg                124   2e-29   
ref|XP_003545571.1|  PREDICTED: nitrate transporter 1.3-like            124   2e-29   
ref|XP_010470202.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       124   2e-29   
ref|XP_003616931.1|  Nitrate transporter                                124   2e-29   
ref|XP_010511033.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       124   2e-29   
gb|KFK39483.1|  hypothetical protein AALP_AA3G250100                    123   2e-29   
gb|EYU30262.1|  hypothetical protein MIMGU_mgv1a019117mg                120   3e-29   
ref|XP_002525323.1|  oligopeptide transporter, putative                 123   3e-29   
ref|XP_009145465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            123   3e-29   
ref|XP_004304094.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            123   4e-29   
gb|KJB25603.1|  hypothetical protein B456_004G199600                    122   4e-29   
ref|XP_001771110.1|  predicted protein                                  123   4e-29   
gb|KHM99092.1|  Nitrate transporter 1.3                                 123   5e-29   
ref|XP_003529696.1|  PREDICTED: probable peptide/nitrate transpor...    122   6e-29   
ref|XP_007153917.1|  hypothetical protein PHAVU_003G076000g             122   7e-29   
gb|KJB42856.1|  hypothetical protein B456_007G170800                    122   7e-29   
ref|NP_188804.1|  nitrate transporter 1.3                               122   8e-29   
gb|KJB10335.1|  hypothetical protein B456_001G196400                    121   1e-28   
gb|KFK40857.1|  hypothetical protein AALP_AA2G050600                    122   1e-28   
ref|XP_009589428.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       121   2e-28   
ref|XP_009779307.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       121   2e-28   
ref|XP_010414658.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    121   2e-28   
gb|KHN38482.1|  Nitrate transporter 1.3                                 121   2e-28   
ref|XP_003519455.1|  PREDICTED: nitrate transporter 1.3                 121   2e-28   
gb|KHG25065.1|  Nitrate transporter 1.3 -like protein                   121   2e-28   
gb|KJB10334.1|  hypothetical protein B456_001G196400                    120   2e-28   
gb|KJB10333.1|  hypothetical protein B456_001G196400                    121   2e-28   
gb|AAM61107.1|  nitrate transporter                                     121   2e-28   
ref|XP_009415000.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       121   2e-28   
ref|XP_006648788.1|  PREDICTED: nitrate transporter 1.3-like            119   4e-28   
ref|XP_010064621.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       120   4e-28   
ref|XP_009416965.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       120   6e-28   
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    119   7e-28   
ref|XP_010110635.1|  Nitrate transporter 1.3                            119   8e-28   
ref|XP_009401109.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       119   8e-28   
ref|XP_009341381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       119   2e-27   
ref|XP_006392243.1|  hypothetical protein EUTSA_v10023363mg             118   2e-27   
gb|KDO42071.1|  hypothetical protein CISIN_1g008953mg                   117   3e-27   
ref|XP_002527829.1|  nitrate transporter, putative                      117   3e-27   
ref|XP_006431440.1|  hypothetical protein CICLE_v10000639mg             118   3e-27   
ref|XP_006470829.1|  PREDICTED: probable peptide/nitrate transpor...    118   3e-27   
ref|XP_006302056.1|  hypothetical protein CARUB_v10020041mg             117   4e-27   
ref|XP_008339431.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       117   5e-27   
emb|CDY67653.1|  BnaAnng24930D                                          115   6e-27   
ref|XP_003579814.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       117   6e-27   
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      116   6e-27   
gb|EMS61581.1|  Nitrate transporter 1.3                                 116   7e-27   
ref|XP_003540130.1|  PREDICTED: probable peptide/nitrate transpor...    117   7e-27   
ref|XP_009113280.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    117   8e-27   
ref|XP_007141630.1|  hypothetical protein PHAVU_008G212300g             117   8e-27   
ref|XP_004300018.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       117   8e-27   
ref|XP_010244160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            117   9e-27   
ref|XP_009403715.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    116   1e-26   
ref|XP_009403716.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    116   1e-26   
emb|CDY70795.1|  BnaCnng69820D                                          113   2e-26   
gb|KHN11039.1|  Putative peptide/nitrate transporter                    115   2e-26   
ref|XP_010682129.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            115   2e-26   
gb|AFR11353.1|  nitrate transporter                                     115   2e-26   
gb|KGN63217.1|  Oligopeptide transporter                                115   2e-26   
ref|XP_010548886.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            115   2e-26   
ref|XP_009103101.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       115   3e-26   
ref|XP_006836895.1|  hypothetical protein AMTR_s00099p00121400          115   3e-26   
ref|XP_009421158.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       115   4e-26   
ref|XP_002268504.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       115   4e-26   
gb|KJB70778.1|  hypothetical protein B456_011G091000                    114   4e-26   
ref|XP_003553503.1|  PREDICTED: peptide transporter PTR3-A-like         115   4e-26   
emb|CBI29637.3|  unnamed protein product                                115   4e-26   
gb|KHG30344.1|  hypothetical protein F383_15360                         114   5e-26   
ref|XP_009776306.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       114   5e-26   
ref|XP_008378949.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       114   5e-26   
ref|XP_007201615.1|  hypothetical protein PRUPE_ppa019863mg             114   6e-26   
ref|XP_010252354.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    114   6e-26   
ref|XP_004151945.1|  PREDICTED: nitrate transporter 1.3-like            115   7e-26   
ref|XP_008459507.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            114   8e-26   
ref|XP_008237812.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       114   9e-26   
ref|XP_007023125.1|  Major facilitator superfamily protein              114   9e-26   
ref|XP_008455932.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            114   1e-25   
ref|XP_007019707.1|  Major facilitator superfamily protein              113   1e-25   
ref|XP_002510466.1|  peptide transporter, putative                      113   1e-25   
emb|CAO02542.1|  putative proton-dependent oligopeptide transport...    108   1e-25   
ref|XP_007046251.1|  Major facilitator superfamily protein isoform 1    113   1e-25   
ref|XP_008218643.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       113   2e-25   
gb|KJB26921.1|  hypothetical protein B456_004G266300                    113   2e-25   
ref|XP_004485415.1|  PREDICTED: probable peptide/nitrate transpor...    113   2e-25   
gb|EMT27347.1|  Nitrate/chlorate transporter                            112   2e-25   
emb|CDP11323.1|  unnamed protein product                                114   2e-25   
gb|KJB30349.1|  hypothetical protein B456_005G138800                    113   2e-25   
emb|CAB38706.1|  nitrate transporter                                    112   2e-25   
ref|XP_004290270.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            113   2e-25   
ref|XP_009803729.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       112   3e-25   
gb|KCW74201.1|  hypothetical protein EUGRSUZ_E02847                     112   4e-25   
ref|XP_010059065.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       112   4e-25   
ref|XP_007221822.1|  hypothetical protein PRUPE_ppa002962mg             112   4e-25   
ref|XP_009355381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       112   5e-25   
ref|XP_004141613.1|  PREDICTED: probable peptide/nitrate transpor...    111   7e-25   
ref|XP_009602084.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       111   7e-25   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       111   8e-25   
ref|XP_009617493.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       111   8e-25   
ref|XP_011095121.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            111   1e-24   
gb|KHN29164.1|  Peptide transporter PTR2                                110   1e-24   
emb|CDO97656.1|  unnamed protein product                                110   1e-24   
gb|KDP42512.1|  hypothetical protein JCGZ_00309                         111   1e-24   
ref|XP_011087621.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       110   1e-24   
ref|XP_003592869.1|  Peptide transporter PTR1                           110   1e-24   
ref|XP_006385089.1|  proton-dependent oligopeptide transport fami...    110   1e-24   
ref|XP_009624590.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       110   1e-24   
ref|XP_003531411.1|  PREDICTED: peptide transporter PTR2-like           110   1e-24   
ref|XP_004967918.1|  PREDICTED: probable peptide/nitrate transpor...    110   2e-24   
ref|XP_004230414.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            110   2e-24   
gb|KHN10768.1|  Peptide transporter PTR3-A                              110   2e-24   
ref|XP_009757633.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       110   2e-24   
ref|XP_003520611.1|  PREDICTED: peptide transporter PTR3-A-like         110   2e-24   
ref|XP_009113281.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    110   2e-24   
gb|KHG26925.1|  hypothetical protein F383_02518                         110   2e-24   
ref|XP_001778896.1|  predicted protein                                  109   3e-24   
gb|KJB67117.1|  hypothetical protein B456_010G175400                    109   3e-24   
ref|XP_004504617.1|  PREDICTED: peptide transporter PTR2-like           109   3e-24   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       109   3e-24   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             109   3e-24   
gb|KDO51375.1|  hypothetical protein CISIN_1g008177mg                   109   4e-24   
ref|XP_011028408.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            109   4e-24   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       108   5e-24   
ref|XP_002306899.1|  hypothetical protein POPTR_0005s25490g             109   5e-24   
ref|NP_001173970.1|  Os04g0464400                                       108   5e-24   
ref|XP_004241845.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    108   5e-24   
ref|XP_006468198.1|  PREDICTED: nitrate transporter 1.2-like            108   6e-24   
ref|XP_007131295.1|  hypothetical protein PHAVU_011G001900g             108   6e-24   
gb|KHN04342.1|  Putative peptide/nitrate transporter                    106   7e-24   
ref|XP_003625349.1|  Peptide transporter PTR3-A                         108   7e-24   
emb|CDP11530.1|  unnamed protein product                                108   7e-24   
gb|AES81567.2|  peptide transporter                                     108   7e-24   
ref|XP_009780466.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       108   7e-24   
ref|XP_011003705.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       108   7e-24   
ref|XP_006356504.1|  PREDICTED: probable peptide/nitrate transpor...    108   7e-24   
ref|XP_006385186.1|  proton-dependent oligopeptide transport fami...    108   7e-24   
gb|KEH23961.1|  peptide transporter                                     108   7e-24   
ref|XP_004500964.1|  PREDICTED: peptide transporter PTR1-like iso...    108   9e-24   
gb|AIU49714.1|  major facilitator superfamily protein                   108   9e-24   
ref|XP_006349278.1|  PREDICTED: probable peptide/nitrate transpor...    108   1e-23   
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             108   1e-23   
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            108   1e-23   
ref|XP_004295409.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.6-like       108   1e-23   
ref|XP_004299089.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            108   1e-23   
ref|XP_006844420.1|  hypothetical protein AMTR_s00016p00024040          108   1e-23   
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...    107   1e-23   
ref|XP_010262415.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       108   1e-23   
ref|XP_010099787.1|  putative peptide/nitrate transporter               108   1e-23   
gb|KHN01167.1|  Nitrate transporter 1.2                                 107   1e-23   
ref|XP_001769410.1|  predicted protein                                  108   1e-23   
ref|XP_002301859.1|  peptide transporter 2 family protein               107   1e-23   
emb|CDP03779.1|  unnamed protein product                                107   1e-23   
ref|XP_010065237.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            107   1e-23   
ref|XP_006362722.1|  PREDICTED: probable peptide/nitrate transpor...    107   2e-23   
emb|CDP07455.1|  unnamed protein product                                107   2e-23   
emb|CBI19780.3|  unnamed protein product                                108   2e-23   
ref|XP_010089167.1|  hypothetical protein L484_000371                   101   2e-23   
gb|AIU49711.1|  major facilitator superfamily protein                   105   2e-23   
ref|XP_004500965.1|  PREDICTED: peptide transporter PTR1-like iso...    107   2e-23   
ref|XP_008221413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       107   2e-23   
ref|XP_002529118.1|  nitrate transporter, putative                      104   2e-23   
gb|KGN50309.1|  hypothetical protein Csa_5G167020                       105   2e-23   
ref|XP_011048871.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       107   2e-23   
dbj|BAJ53174.1|  JHL18I08.8                                             107   2e-23   
gb|KJB55776.1|  hypothetical protein B456_009G093900                    107   2e-23   
ref|XP_010462648.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       101   2e-23   
ref|XP_008224155.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       107   3e-23   
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             107   3e-23   
gb|EYU29966.1|  hypothetical protein MIMGU_mgv1a003471mg                107   3e-23   
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           107   3e-23   
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           107   3e-23   



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSWTV+DAVDYKGFPAD+SKTGGWVPAAL LGIEI ERL+TMGI VNLVTYL GTM
Sbjct  1    MDGKMSWTVSDAVDYKGFPADRSKTGGWVPAALALGIEICERLATMGIGVNLVTYLIGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HL S+TSANIV+DFMGTSF+LCLLGGFLADSFLGR+KTIAIF+ VQ +GTG LA  TKLP
Sbjct  61   HLSSATSANIVTDFMGTSFMLCLLGGFLADSFLGRYKTIAIFAVVQAIGTGMLATVTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            QLRP PC  + +C++A GFQM
Sbjct  121  QLRPPPCGTNNSCEQATGFQM  141



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KM W+VADAVDYKGFPAD+SKTGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDGKMRWSVADAVDYKGFPADRSKTGGWVPAALILVIEISERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SAN+VSDFMGTS+LLCLLGGFLADSFLGR+ TIAIF+ VQ LGTG+L++AT+LP
Sbjct  61   HLPSAESANVVSDFMGTSYLLCLLGGFLADSFLGRYLTIAIFAMVQALGTGTLSVATRLP  120

Query  480  QLRPSPCNPH--QACQEANGFQM  542
            QLRP PCN      CQ A+ FQM
Sbjct  121  QLRPPPCNSSTTTTCQHADRFQM  143



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+RK SW+VADAVDYKG PAD+SKTGGW PAALIL IEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDRKASWSVADAVDYKGLPADRSKTGGWAPAALILVIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            H+PS+ SANIV+DFMGTSFLLCL GGFLADSFLGR+ TIAIF+ +Q LGTG L+++TKLP
Sbjct  61   HIPSAESANIVTDFMGTSFLLCLFGGFLADSFLGRYLTIAIFAMIQALGTGLLSISTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQM  542
            QLRP PCN      CQ ANGFQM
Sbjct  121  QLRPPPCNSTVTGQCQRANGFQM  143



>gb|KJB64775.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=586

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGGT+
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWMPAALILGIEICERLSTMGIAVNLVTYLGGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIFS +Q LGTG+LALATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFSIIQTLGTGTLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            QLRP PC+    C++ANGFQM
Sbjct  121  QLRPPPCHGSHTCKQANGFQM  141



>gb|KJB07736.1| hypothetical protein B456_001G041900 [Gossypium raimondii]
Length=581

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL G M
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+A+Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAAIQTLGTGALAIATKLP  120

Query  480  QLRPSPCN--PHQACQEANGFQM  542
            QLRP PC+      C+ ANGFQM
Sbjct  121  QLRPPPCHASASHTCKPANGFQM  143



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL G
Sbjct  41   KRMDGKQKLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVG  100

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            T+HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTG+LA+ TK
Sbjct  101  TLHLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITK  160

Query  474  LPQLRPSPCNP--HQACQEANGFQM  542
            LPQL P PC+P   + C++ANGFQM
Sbjct  161  LPQLHPPPCHPIASKNCKQANGFQM  185



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M+ K   TVADAVDYKG PA++SKTGGWVPAAL++GIE+ ERLSTMGIAVNLVTYL G
Sbjct  41   KRMDGKQRLTVADAVDYKGCPANRSKTGGWVPAALVVGIELCERLSTMGIAVNLVTYLVG  100

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            T+HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTG+LA+ TK
Sbjct  101  TLHLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITK  160

Query  474  LPQLRPSPCNP--HQACQEANGFQM  542
            LPQL P PC+P   + C++ANGFQM
Sbjct  161  LPQLHPPPCHPIASKNCKQANGFQM  185



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+ +Q LGTG+LA+ TKLP
Sbjct  61   HLPSATSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFATIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQM  542
            QL P PC+P   + C++ANGFQM
Sbjct  121  QLHPPPCHPIGSKNCKQANGFQM  143



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMS +VADAVDYKGFPADKSKTGGWV AALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MENKMSLSVADAVDYKGFPADKSKTGGWVSAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSAN V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS VQ LGTG LA++T+LP
Sbjct  61   HLPSATSANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSVVQTLGTGLLAMSTRLP  120

Query  480  QLRPSPCNP--HQACQEANGFQM  542
            QLRP PCN    + C+EANGFQM
Sbjct  121  QLRPPPCNTTLSRKCEEANGFQM  143



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTG+LA+ TKLP
Sbjct  61   HLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQM  542
            QL P PC+P   + C++ANGFQM
Sbjct  121  QLHPPPCHPIASKNCKQANGFQM  143



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K+SWTV+DAVDYKG PAD+SKTGGWVPAALILGIE+ ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MEEKLSWTVSDAVDYKGSPADRSKTGGWVPAALILGIEVCERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ LGT  LA++TKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLVQTLGTALLAISTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP PC P   C +A+GFQM
Sbjct  121  RLRPPPCQPTLPCNQADGFQM  141



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAAL++GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALVVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTG+LA+ TKLP
Sbjct  61   HLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQM  542
            QL P PC+P   + C++ANGFQM
Sbjct  121  QLHPPPCHPIASKNCKQANGFQM  143



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME+KMSWTV DAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTYL G M
Sbjct  1    MEKKMSWTVGDAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLMGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            H+PSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IFSA+Q LGT +LA++TKLP
Sbjct  61   HMPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFSAIQTLGTAALAISTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
             LRP PC+  ++C+ ANG QM
Sbjct  121  SLRPPPCHAGESCKPANGIQM  141



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   218 bits (555),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVSTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSAN V+DFMGTSFLLCLLGGFLADSFLGRF+TIAIF+ VQ +GTG LA+ T+LP
Sbjct  61   HLPSATSANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIAIFATVQAMGTGMLAIITRLP  120

Query  480  QLRPSPCN--PHQACQEANGFQM  542
            QL+P PC   P Q C++ANGFQM
Sbjct  121  QLQPPPCKNTPTQTCKQANGFQM  143



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLVSTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS++SAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG+LA+ATKLP
Sbjct  61   HLPSASSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAIIQTLGTGTLAIATKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQM  542
            QLRP PC+   +  C+ ANGFQM
Sbjct  121  QLRPPPCHASASLTCKPANGFQM  143



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSW VADAVDYKGFPAD+SKTGGW+PAAL+LGIE+ ERLSTMGI VNLVTYL GTM
Sbjct  1    MDGKMSWAVADAVDYKGFPADRSKTGGWLPAALVLGIEVCERLSTMGIGVNLVTYLIGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ VQ LGTG LA  TK+P
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFALVQTLGTGMLAAITKIP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            QLRP PCN + +C +ANGFQM
Sbjct  121  QLRPPPCNTNNSCVQANGFQM  141



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PA+KSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYL  TM
Sbjct  1    MENKGSWTVADAVDYMGRPAEKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLMDTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIF+ VQ+LGTGSLALATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFAFVQLLGTGSLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
             LRP PC+  + C+ A+GFQM
Sbjct  121  GLRPPPCHHGEHCKPASGFQM  141



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMS TVADAV+YKG PAD+SKTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKMSLTVADAVNYKGLPADRSKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SANIV+DFMGT+FLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L LAT LP
Sbjct  61   HLPSAASANIVTDFMGTAFLLCLLGGFLADSFLGRYKTIAIFAIIQSLGTGMLTLATGLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            QLRP PC+PH+ C+ A GFQM
Sbjct  121  QLRPQPCHPHEKCKPATGFQM  141



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS +VADAVDYKGFPADKSKTGGWV AALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSLSVADAVDYKGFPADKSKTGGWVSAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSAN V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS VQ LGTG LA++T+LPQLRP
Sbjct  61   ATSANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSVVQTLGTGLLAMSTRLPQLRP  120

Query  492  SPCNP--HQACQEANGFQM  542
             PCN    + C+EANGFQM
Sbjct  121  PPCNTTLSRKCEEANGFQM  139



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K  WTVADAVDYKG PA+KSKTGGW+PAALILGIEIVERLSTMGIAVNLVTYL  TM
Sbjct  1    MENKGGWTVADAVDYKGRPAEKSKTGGWIPAALILGIEIVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLL LLGGFLADSFLGRFKTIA F+ VQMLGTGSLALATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLSLLGGFLADSFLGRFKTIAAFAVVQMLGTGSLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
             LRP PC+  + C  A+GFQM
Sbjct  121  GLRPPPCHHGEHCNPASGFQM  141



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTV+DAVDYKG PADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  2    MSWTVSDAVDYKGSPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L LA  LPQLRP
Sbjct  62   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFALIQTLGTGMLTLAVSLPQLRP  121

Query  492  SPCNPHQ-ACQEANGFQM  542
             PC+ H  +CQ A G QM
Sbjct  122  PPCHRHDVSCQPAKGSQM  139



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  4    KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  63

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT +LA++TKLPQL
Sbjct  64   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISAIIQTLGTATLAVSTKLPQL  123

Query  486  RPSPCNPHQACQEANGFQM  542
            RP PC+  + C+EANGFQM
Sbjct  124  RPPPCDGTKTCKEANGFQM  142



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME+KMSWT+ DAVDYKGFPAD+SKTGGWV AALILGIEIVERLSTMGIAVNLVTYL G M
Sbjct  1    MEKKMSWTIGDAVDYKGFPADRSKTGGWVTAALILGIEIVERLSTMGIAVNLVTYLMGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGRF+TI IF+A+Q LGT +LA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIVIFAAIQTLGTATLAISTKLP  120

Query  480  QLRPSPC-NPHQACQEANGFQM  542
            QLRP PC   +++C+ ANG QM
Sbjct  121  QLRPPPCPASNESCKPANGIQM  142



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL  TMHLPS
Sbjct  1    MSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVSTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSAN V+DFMGTSFLLCLLGGFLADSFLGRF+TIAIF+ VQ +GTG LA+ T+LPQL+P
Sbjct  61   ATSANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIAIFATVQAMGTGMLAIITRLPQLQP  120

Query  492  SPCN--PHQACQEANGFQM  542
             PC   P Q C++ANGFQM
Sbjct  121  PPCKNTPTQTCKQANGFQM  139



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  4    KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  63

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT +LA++TKLPQL
Sbjct  64   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISALIQTLGTAALAVSTKLPQL  123

Query  486  RPSPCNPHQACQEANGFQM  542
            RP PC+  + C+EANGFQM
Sbjct  124  RPPPCDGTKTCKEANGFQM  142



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K S TVADA+DYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKRSLTVADALDYKGFPADRSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGT FLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG LA+ ++LP
Sbjct  61   HLPSSTSANIVTDFMGTCFLLCLLGGFLADSFLGRYKTIAVFAIIQTLGTGMLAITSELP  120

Query  480  QLRPSPCNPHQA-CQEANGFQM  542
            QLRP PC+ H   C++ANGFQM
Sbjct  121  QLRPPPCHAHDINCKQANGFQM  142



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MKEKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT +LA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQM  542
             LRP PC+ +  +C++ANGFQM
Sbjct  121  GLRPPPCHANSDSCKQANGFQM  142



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  23   KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  82

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT +LA++TKLPQL
Sbjct  83   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISALIQTLGTAALAVSTKLPQL  142

Query  486  RPSPCNPHQACQEANGFQM  542
            RP PC+  + C+EANGFQM
Sbjct  143  RPPPCDGTKTCKEANGFQM  161



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAV+YKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MEEKMSWTVADAVNYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT +LA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQM  542
             LRP PC+ +  +C++ANGFQM
Sbjct  121  GLRPPPCHANSDSCKQANGFQM  142



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  
Sbjct  22   RKMESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLME  81

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATK
Sbjct  82   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  141

Query  474  LPQLRPSPCNPHQACQEANGFQM  542
            LPQLRP  C+  +AC  A  FQM
Sbjct  142  LPQLRPPTCHHGEACTPATAFQM  164



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW V +AVDYKGFPAD+SKTGGW+PAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MEEKMSWIVTEAVDYKGFPADRSKTGGWIPAALILGIEIVERLSTMGIAVNLVTYMISVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT +LA+++KLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTAALAISSKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQM  542
            QLRP PC+ +  +CQ+ANGFQM
Sbjct  121  QLRPPPCHANSDSCQQANGFQM  142



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  
Sbjct  9    RKMESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLME  68

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATK
Sbjct  69   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  128

Query  474  LPQLRPSPCNPHQACQEANGFQM  542
            LP+LRP  C+  +AC  A  FQM
Sbjct  129  LPELRPPTCHHGEACTPATAFQM  151



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATSFQM  141



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL GTM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  + C  A  FQM
Sbjct  121  ELRPPVCHHGEVCTPATAFQM  141



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACTPATAFQM  141



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATAFQM  141



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATAFQM  141



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            KEM   MSWTV+DAVDYKG PADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG
Sbjct  3    KEM---MSWTVSDAVDYKGSPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  59

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            TMHLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+ +Q LGTG L LA  
Sbjct  60   TMHLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIVIFALIQTLGTGMLTLAVS  119

Query  474  LPQLRPSPCNPHQA-CQEANGFQM  542
            LPQLRP  C+ H   CQ A G QM
Sbjct  120  LPQLRPPLCHRHDVNCQPAKGSQM  143



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATTFQM  141



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPACHHGEACIPATTFQM  141



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATTFQM  141



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AA ILGIE+VERLSTMGIAVNLVTYL  
Sbjct  23   RKMESKGSWTVADAVDYNGLPADKSKTGGWITAAFILGIEVVERLSTMGIAVNLVTYLME  82

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATK
Sbjct  83   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  142

Query  474  LPQLRPSPCNPHQACQEANGFQM  542
            LP+LRP  C+  + C  A  FQM
Sbjct  143  LPELRPPTCHHGETCTTATAFQM  165



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACIPATTFQM  141



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPADKSKTGGW+PAALIL IE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWTVADAVDYKGFPADKSKTGGWLPAALILVIELSERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+A+Q LGTG+LA++TKLPQL+P
Sbjct  61   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAAIQTLGTGALAISTKLPQLQP  120

Query  492  SPCNPH--QACQEANGFQM  542
              C+    + C+ ANGFQM
Sbjct  121  PACDTASGKNCKPANGFQM  139



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TMH
Sbjct  11   ESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETMH  70

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            LPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG+LA+ATKLP+
Sbjct  71   LPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLPE  130

Query  483  LRPSPCNPHQACQEANGFQM  542
            LRP  C+  +AC  A  FQM
Sbjct  131  LRPPTCHHGEACIPATAFQM  150



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   MHLPS
Sbjct  1    MSWTVADAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            ST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT +LA++TKLP LRP
Sbjct  61   STAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLPGLRP  120

Query  492  SPCNPH-QACQEANGFQM  542
             PC+ +  +C++ANGFQM
Sbjct  121  PPCHANSDSCKQANGFQM  138



>ref|XP_006475801.1| PREDICTED: nitrate transporter 1.4-like isoform X6 [Citrus sinensis]
Length=417

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCNP--HQACQEANGFQM  542
             PC       C++A+GFQM
Sbjct  121  RPCKETATHTCEQASGFQM  139



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS TVADA+DYKG PADKSKTGGWVPA LILGIEIVERLSTMGIAVNLVTYLGG MHL S
Sbjct  1    MSLTVADAMDYKGSPADKSKTGGWVPATLILGIEIVERLSTMGIAVNLVTYLGGAMHLAS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            S SANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG L +AT LPQLRP
Sbjct  61   SNSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIALFALIQTLGTGMLTVATSLPQLRP  120

Query  492  SPCNPHQA-CQEANGFQM  542
            SPC+ H   CQ ANGFQM
Sbjct  121  SPCHRHDVNCQPANGFQM  138



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M   +SWTVADAVDYKGFPAD+SKTGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MGEMVSWTVADAVDYKGFPADRSKTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ  GTG LA++TK P
Sbjct  61   HLPSATSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFATVQTFGTGLLAISTKQP  120

Query  480  QLRPSPCNPHQ--ACQEANGFQM  542
            QLRP PC       CQ A+G QM
Sbjct  121  QLRPPPCQATDITKCQHASGIQM  143



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M   +SWTVADAVDYKGFPAD+SKTGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MGEMVSWTVADAVDYKGFPADRSKTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ  GTG LA++TK P
Sbjct  61   HLPSATSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFATVQTFGTGLLAISTKQP  120

Query  480  QLRPSPCNPHQ--ACQEANGFQM  542
            QLRP PC       CQ A+G QM
Sbjct  121  QLRPPPCQATDITKCQHASGIQM  143



>gb|KJB82816.1| hypothetical protein B456_013G215400 [Gossypium raimondii]
Length=579

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TVADAVDYKG PADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDEKMSLTVADAVDYKGHPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ VQMLGT  LA++TKLP
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAMVQMLGTCLLAVSTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQM  542
            QLRP PC       C++AN FQM
Sbjct  121  QLRPPPCKYTNVTQCEQANSFQM  143



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SW VADAVDY+G PA+KSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWMVADAVDYRGRPAEKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP  C+  +AC  A  FQM
Sbjct  121  ELRPPTCHHGEACTPATSFQM  141



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
            A+DYKGFPAD+SKTGGWVPAA ILGIE+VERLST+GI VNLVTYL GTMHLPS+TSANIV
Sbjct  4    ALDYKGFPADRSKTGGWVPAAFILGIELVERLSTLGIGVNLVTYLVGTMHLPSATSANIV  63

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NPH  509
            +DFMGT FLLCLLGGF+ADSFLGR+ TI IFSA+Q LGTG LA+ +++PQL P PC + +
Sbjct  64   TDFMGTCFLLCLLGGFIADSFLGRYLTILIFSALQALGTGMLAIVSRIPQLHPPPCGHGN  123

Query  510  QACQEANGFQM  542
              C++ANG QM
Sbjct  124  HHCEQANGLQM  134



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAV+YKG PAD++KTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  2    MSWTVADAVNYKGLPADRTKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGTMHLPS  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SANIV+DFMGT+FLL LLGGFLADSFLGR+KTIAIF+ +Q LGTG L + T LPQLRP
Sbjct  62   AASANIVTDFMGTAFLLSLLGGFLADSFLGRYKTIAIFALIQALGTGMLTVTTGLPQLRP  121

Query  492  SPCNPH-QACQEANGFQM  542
              C+PH + C+ ANGFQM
Sbjct  122  PTCHPHDKYCEPANGFQM  139



>ref|XP_011458172.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWT ADAVDYKGFPADKS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTM
Sbjct  1    MEEKMSWTAADAVDYKGFPADKSRTGGWVSAALILGIEICERLSTMGIAVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DF GTSFLLCLLGGFLADSFLGR+KTIAIF+++Q LG  +LA++ KLP
Sbjct  61   HLPSSTSANIVTDFAGTSFLLCLLGGFLADSFLGRYKTIAIFASIQSLGIVALAISVKLP  120

Query  480  QLRPSPCN---PHQACQEANGFQM  542
            QLRP  C+    +  CQ+AN FQM
Sbjct  121  QLRPPHCDITAANNDCQQANEFQM  144



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  147  ADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSAN  326
            ADAVD++GFPADKSKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS+ SAN
Sbjct  8    ADAVDHEGFPADKSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPSAVSAN  67

Query  327  IVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNP  506
             V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS +Q +GTG LA+ TK+PQLRP PC  
Sbjct  68   TVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSTIQAMGTGMLAITTKVPQLRPPPCAA  127

Query  507  HQACQEANGFQM  542
            H  CQ ANG QM
Sbjct  128  HANCQTANGLQM  139



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 129/153 (84%), Gaps = 12/153 (8%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALIL----------GIEIVERLSTMGIAV  269
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALIL           IEI ERLSTMGIAV
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALILEGPEKSSSRKRIEICERLSTMGIAV  60

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGT  449
            NLVTYL  TMHLPS++SAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGT
Sbjct  61   NLVTYLVSTMHLPSASSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAIIQTLGT  120

Query  450  GSLALATKLPQLRPSPCNPHQA--CQEANGFQM  542
            G+LA+ATKLPQLRP PC+   +  C+ ANGFQM
Sbjct  121  GTLAIATKLPQLRPPPCHASASLTCKPANGFQM  153



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KM W+V DAVDYKG PAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDGKMRWSVEDAVDYKGLPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGT  L++ T+LP
Sbjct  61   HLPSAESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTCMLSVTTRLP  120

Query  480  QLRPSPCNPHQA----CQEANGFQM  542
            QLRP PCN   +    C++ANGFQ+
Sbjct  121  QLRPPPCNSLSSRSTKCEQANGFQL  145



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M  KMS TVADA+DYKGFPADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGG
Sbjct  87   KTMAEKMSLTVADAMDYKGFPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGG  146

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATK  473
            TMHLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ +Q LGT  LA++T+
Sbjct  147  TMHLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAIIQTLGTCMLAVSTR  206

Query  474  LPQLRPSPCNPHQA--CQEANGFQM  542
            LP+LRP PC   +   C++AN FQM
Sbjct  207  LPELRPPPCQSTEVAQCKQANNFQM  231



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW VADA DYKG PAD+SKTGGWVPAALILGIE+ ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWAVADAFDYKGDPADRSKTGGWVPAALILGIEMCERLSTMGIAVNLVTYLVNTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGRFKT+AIF+ VQ LGT  LA++TK+P
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRFKTVAIFAVVQALGTAMLAISTKIP  120

Query  480  QLRPSPCN--PHQACQEANGFQM  542
            +LRP PC+   ++ CQ A  FQM
Sbjct  121  ELRPPPCDSSKNEPCQRATEFQM  143



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAV+YKG PAD++KTGGW+PAAL+LGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSWTVADAVNYKGLPADRTKTGGWMPAALVLGIEINERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SANIV+DFMGT+FLL LLGGFLADSFLGR+KTIAIF+ +Q LGTG L + T +PQLRP
Sbjct  61   AASANIVTDFMGTAFLLSLLGGFLADSFLGRYKTIAIFALIQALGTGMLTVTTGMPQLRP  120

Query  492  SPCNPH-QACQEANGFQM  542
              C+PH + C+ ANGFQM
Sbjct  121  PTCHPHDKYCEPANGFQM  138



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCNP--HQACQEANGFQM  542
             PC       C++A+GFQM
Sbjct  121  RPCKETATHTCEQASGFQM  139



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCNP--HQACQEANGFQM  542
             PC       C++A GFQM
Sbjct  121  RPCKETATHTCEQARGFQM  139



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 118/131 (90%), Gaps = 2/131 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DAVDYKGFPADKSKTGGWVPA LILGIEIVERLSTMGIAVNLVTYLGGTMHL SS SANI
Sbjct  4    DAVDYKGFPADKSKTGGWVPATLILGIEIVERLSTMGIAVNLVTYLGGTMHLASSNSANI  63

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V+DFMGTSFLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG L +AT LPQLRP PCN +
Sbjct  64   VTDFMGTSFLLCLLGGFLADSFLGRYKTIALFALIQTLGTGMLTVATTLPQLRPPPCNLN  123

Query  510  QACQEANGFQM  542
              CQ ANGFQM
Sbjct  124  --CQPANGFQM  132



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TVADAVDYKG PADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDEKMSLTVADAVDYKGHPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ VQMLGT  LA++TKLP
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAMVQMLGTCLLAVSTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQM  542
            QLRP  C       C++AN FQM
Sbjct  121  QLRPPLCKYTDVTQCEQANSFQM  143



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 120/141 (85%), Gaps = 1/141 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TV DAVDY G PAD+S TGGWVPAALILGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MDEKMSLTVGDAVDYNGLPADRSNTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGT FLLCLLGGFLADSFLGR+KTIA+F+ VQ LGTG LA  T LP
Sbjct  61   HLPSSTSANIVTDFMGTCFLLCLLGGFLADSFLGRYKTIAVFALVQTLGTGMLATITALP  120

Query  480  QLRPSPCNPHQA-CQEANGFQ  539
            +LRP PC+     C+EANGFQ
Sbjct  121  ELRPPPCHTRDINCKEANGFQ  141



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 3/144 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS +V DAVDYKG  AD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL GTM
Sbjct  1    MDGKMSLSVEDAVDYKGSLADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SAN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGTG L++ T+LP
Sbjct  61   HLPSAESANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTGMLSVTTRLP  120

Query  480  QLRPSPCNPHQA---CQEANGFQM  542
            QLRP+PCN   A   CQ+ANGFQM
Sbjct  121  QLRPAPCNASTATKSCQQANGFQM  144



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 4/141 (3%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M W+V DAVDYKG PAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MRWSVEDAVDYKGLPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGT  L++ T+LPQLRP
Sbjct  61   AESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTCMLSVTTRLPQLRP  120

Query  492  SPCNPHQA----CQEANGFQM  542
             PCN   +    C++ANGFQ+
Sbjct  121  PPCNSLSSRSTKCEQANGFQL  141



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW+V DAVDYKGFPAD++KTGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGT+HLPS
Sbjct  1    MSWSVGDAVDYKGFPADRTKTGGWVPAALILVIEIAERLSTMGIAVNLVTYLGGTLHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TI IF+ +Q LGTG L++ T+LPQLRP
Sbjct  61   AESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIVIFAVIQALGTGMLSVVTRLPQLRP  120

Query  492  SPCNPHQA--CQEANGFQM  542
             PCN      CQEA+ FQM
Sbjct  121  PPCNSSTTAKCQEADVFQM  139



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAV+YKG PAD+SKTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKMSWTVADAVNYKGLPADRSKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SANIV+DFMGT+FLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L L T LP
Sbjct  61   HLPSAASANIVTDFMGTAFLLCLLGGFLADSFLGRYKTIAIFAIIQSLGTGLLTLTTGLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            QLRP PC+PH+ C+ A G QM
Sbjct  121  QLRPHPCHPHEKCKPATGIQM  141



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPADKS+TGGWV AALILGIEI ERLSTMGI VNLVTYL GTMHLPS
Sbjct  1    MSWTVADAVDYKGFPADKSRTGGWVAAALILGIEICERLSTMGIGVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            STSANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q +G  +LA++ KLPQLRP
Sbjct  61   STSANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTVGMVALAISVKLPQLRP  120

Query  492  SPCNPHQA---CQEANGFQM  542
              C+   A   C++ANGFQM
Sbjct  121  PLCHATAASNNCKQANGFQM  140



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 119/146 (82%), Gaps = 6/146 (4%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M  K S +V D+VDYKG  A +SKTGGW+  ALI+GIE+ ERLSTMGIAVNLVTYL GTM
Sbjct  1    MRTKNSSSV-DSVDYKGLLAIRSKTGGWLSNALIVGIEVSERLSTMGIAVNLVTYLIGTM  59

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TSA IVSDFMGTSFLLCLLGG +ADSFLGR++TIAIF+ +Q LGTG L+++T+LP
Sbjct  60   HLPSATSAKIVSDFMGTSFLLCLLGGVIADSFLGRYRTIAIFAIIQTLGTGMLSISTRLP  119

Query  480  QLRPSPCNPHQA-----CQEANGFQM  542
            QL+P+PCN H +     C++A   QM
Sbjct  120  QLQPTPCNVHYSLKSTNCEQATTSQM  145



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   197 bits (501),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW ++DAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MEEKMSWAISDAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ +Q LGT +LAL+ KLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLIQTLGTATLALSAKLP  120

Query  480  QLRPSPCNPHQACQEANGFQM  542
            +LRP PC P + C++A+G QM
Sbjct  121  RLRPPPCLPDRPCEQADGLQM  141



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 119/144 (83%), Gaps = 3/144 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW+VADAVDYKG PAD++KTGGW+PA LIL IEI ERLST+GI VNLVTYL GTM
Sbjct  1    MEGKMSWSVADAVDYKGSPADRTKTGGWIPAMLILVIEICERLSTLGIGVNLVTYLSGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+ SAN+VSDFMGTSFLLCLLGGFLAD++LGR+ T+AIFSAVQ  GTG L + TKLP
Sbjct  61   HLPSAESANVVSDFMGTSFLLCLLGGFLADAYLGRYLTVAIFSAVQAFGTGMLTVVTKLP  120

Query  480  QLRPSPCNPHQA---CQEANGFQM  542
            QLRP PC        C  ANGFQ+
Sbjct  121  QLRPPPCGSSSGASKCHRANGFQI  144



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            VADAVDY G PADKSKTGGW+ A LILGIE+VERLSTMGIAVNLVTYL  TMHLPSSTSA
Sbjct  2    VADAVDYSGQPADKSKTGGWITATLILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            NIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG+L++ATKLP+LRP  C+
Sbjct  62   NIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALSIATKLPELRPPTCH  121

Query  504  PHQACQEANGFQM  542
              +AC  A  FQM
Sbjct  122  HGEACVPATSFQM  134



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M WTVA AVDYKGFPA+ S+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MGWTVAGAVDYKGFPANNSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLRP
Sbjct  61   ATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLRP  120

Query  492  SPCNPHQA---CQEANGFQM  542
              C+   A   C+EANGFQM
Sbjct  121  PHCDTTAATNHCKEANGFQM  140



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +3

Query  129  KMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLP  308
            KM WTVA  +DYKG PA+KS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLP
Sbjct  5    KMGWTVAGVMDYKGLPANKSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLP  64

Query  309  SSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLR  488
            S+T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLR
Sbjct  65   SATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLR  124

Query  489  PSPCNPHQA---CQEANGFQM  542
            P  C+   A   C+EANGFQM
Sbjct  125  PPHCDTTAATNHCKEANGFQM  145



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score =   191 bits (486),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 5/135 (4%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
            AVDYKG  A +SKTGGW+  ALI+GIE+ ERLSTMGIAVNLVTYL G MH+PS+TSA IV
Sbjct  9    AVDYKGLLAIRSKTGGWLSNALIVGIEVSERLSTMGIAVNLVTYLIGRMHIPSATSAKIV  68

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQ  512
            SDFMGTSFLLCLLGG +ADSFLGR++TIAIF+ +Q LGTG LA+++ LPQL+P+PCN H 
Sbjct  69   SDFMGTSFLLCLLGGLIADSFLGRYRTIAIFAIIQTLGTGMLAISSMLPQLQPTPCNIHY  128

Query  513  A-----CQEANGFQM  542
            +     C++A   QM
Sbjct  129  SLKSSNCEQATTSQM  143



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +3

Query  129  KMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLP  308
            KM WTVA  +DYKG PA+KS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLP
Sbjct  5    KMGWTVAGVMDYKGLPANKSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLP  64

Query  309  SSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLR  488
            S+T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLR
Sbjct  65   SATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLR  124

Query  489  PSPCNPHQA---CQEANGFQM  542
            P  C+   A   C+EANGFQM
Sbjct  125  PPHCDTTAATNHCKEANGFQM  145



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW ++DAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSWAISDAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ +Q LGT +LAL+ KLP+LRP
Sbjct  61   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLIQTLGTATLALSAKLPRLRP  120

Query  492  SPCNPHQACQEANGFQM  542
             PC P + C++A+G QM
Sbjct  121  PPCLPDRPCEQADGLQM  137



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS  VADAVDYKGFPAD+S TGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSPAVADAVDYKGFPADRSVTGGWVPAALILVIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SAN+VSDF+G SFLLCLLGGFLADSFLGR+ T+AIF+ VQ LGTG L ++T LP+LRP
Sbjct  61   AESANVVSDFLGASFLLCLLGGFLADSFLGRYLTVAIFALVQALGTGMLTVSTSLPRLRP  120

Query  492  SPCNPH--QACQEANGFQM  542
             PCN      C+ A+GFQM
Sbjct  121  PPCNTSATNRCRRASGFQM  139



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 6/147 (4%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            E+ER  SW+     V DAVDY+G PA++S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  54   EIERS-SWSDDGNLVQDAVDYRGCPANRSSTGSWLGAASVVGIELCERLATMGIAVNLVT  112

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLA  461
            YL  TMHLP + SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+ VQ LGTG LA
Sbjct  113  YLTDTMHLPGAASANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFALVQALGTGLLA  172

Query  462  LATKLPQLRPSPCNPHQACQEANGFQM  542
            ++T +  LRP PC     C+EA G QM
Sbjct  173  VSTTVRHLRPPPCGGAAPCEEATGLQM  199



>ref|XP_007013427.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY31046.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=583

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME   +  V+DAVDYKG  AD++ +GGWV AALILG+EI ERLSTM I VNLVTYL GTM
Sbjct  1    MEENQTQLVSDAVDYKGNSADRNTSGGWVAAALILGVEICERLSTMAIVVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLP  479
            HLPS+TS+N+ ++F GTS++LCLLGG LAD+FL R+ TIAIF+ +  +GT  LA++T LP
Sbjct  61   HLPSATSSNVSTNFGGTSYMLCLLGGILADTFLTRYWTIAIFAVINAMGTCLLAISTGLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQM  542
            QLRP PC P Q+  C EAN  QM
Sbjct  121  QLRPPPCGPAQSNECVEANSLQM  143



>ref|XP_010093703.1| Nitrate transporter 1.1 [Morus notabilis]
 gb|EXB54483.1| Nitrate transporter 1.1 [Morus notabilis]
Length=272

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = +3

Query  96   TVELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNL  275
            T  LP K+ E     T+ DA DYKG PA++SKTGGW  AA+ILG E++ERL+T+GIAVNL
Sbjct  4    TNSLPKKQGE-----TIPDAWDYKGRPAERSKTGGWASAAMILGGEVMERLTTLGIAVNL  58

Query  276  VTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGS  455
            VTYL GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   
Sbjct  59   VTYLVGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTI  118

Query  456  LALATKLPQLRPSPCNPHQACQEANGFQM  542
            L ++T +P LRP  C   + C +A+G ++
Sbjct  119  LTISTIVPSLRPPKCTADKPCIQASGMEL  147



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 112/147 (76%), Gaps = 11/147 (7%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            +ME + SW+     V DAVDY+G PAD+S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  4    KMEIERSWSEDGNLVQDAVDYRGCPADRSSTGSWLGAASVVGIELCERLATMGIAVNLVT  63

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLA  461
            YL  TMHLPS+ SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+ VQ LGTG LA
Sbjct  64   YLTDTMHLPSADSANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFALVQALGTGLLA  123

Query  462  LATKLPQLRPSPCNPHQACQEANGFQM  542
            ++T + QLRP P       +EA   QM
Sbjct  124  VSTTVHQLRPPP------SEEATDLQM  144



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            RKM+   ADA DYKG  ADKSKTGGW+PAA ILGIE  ERLSTMGIAVNLVTYL G MHL
Sbjct  23   RKMNLIHADAFDYKGLLADKSKTGGWLPAAFILGIEFCERLSTMGIAVNLVTYLSGKMHL  82

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQL  485
             SS SANIV+DFMGTSFLLCLLGGFLADSFLGRF+TIAI + +Q +GTG LAL+T+LP L
Sbjct  83   SSSASANIVTDFMGTSFLLCLLGGFLADSFLGRFRTIAISAIIQTIGTGLLALSTRLPSL  142

Query  486  RPSPCNPHQA--CQEANGFQM  542
             P PC+   A  C+ A+ FQM
Sbjct  143  HPPPCDTTNADKCEPASSFQM  163



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 115/135 (85%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G  ADKS TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+T+A
Sbjct  23   VQDAVDYRGCRADKSSTGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSATAA  82

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GTG LA++T++ QLRP PC 
Sbjct  83   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFALVQAIGTGLLAVSTEVRQLRPPPCG  142

Query  504  PHQA--CQEANGFQM  542
            P  A  C++A G QM
Sbjct  143  PGAAGPCEQATGLQM  157



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 109/148 (74%), Gaps = 4/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + ++  ERK    V DA DYKG PAD+++TGGWV AA ILGIE+ ER +TMGIAVNLVTY
Sbjct  1    MEMETEERKA--LVLDAYDYKGAPADRAQTGGWVSAATILGIEVSERFTTMGIAVNLVTY  58

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L  TMH PS+TS+ IV++F G SFLLCLLGG +ADSFLGR+ TIAIF+ ++ LG   LA+
Sbjct  59   LDNTMHQPSATSSTIVANFSGVSFLLCLLGGCVADSFLGRYWTIAIFAVIEALGACVLAI  118

Query  465  ATKLPQLRPSPCNPHQA--CQEANGFQM  542
            +  L  LRP PCNP  A  C +AN  QM
Sbjct  119  SATLSHLRPPPCNPSVAIKCVKANNLQM  146



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 106/142 (75%), Gaps = 4/142 (3%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            ERK    V DA DYKG PAD+++TGGWV AA ILGIE+ ER +TMGIAVNLVTYL  TMH
Sbjct  5    ERKA--LVLDAYDYKGAPADRAQTGGWVSAATILGIEVSERFTTMGIAVNLVTYLDNTMH  62

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
             PS+TS+ IV++F G SFLLCLLGG +ADSFLGR+ TIAIF+ ++ LG   LA++  L  
Sbjct  63   QPSATSSTIVANFSGVSFLLCLLGGCVADSFLGRYWTIAIFAVIEALGACVLAISATLSH  122

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP PCNP  A  C +AN  QM
Sbjct  123  LRPPPCNPSVAIKCVKANNLQM  144



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 112/139 (81%), Gaps = 12/139 (9%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTG          IE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTG----------IELCERLSTMGIAVNLVTYLVGTMHLPS  50

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  51   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  110

Query  492  SPCNP--HQACQEANGFQM  542
             PC       C++A+GFQM
Sbjct  111  RPCKETATHTCEQASGFQM  129



>emb|CDY69100.1| BnaCnng61860D [Brassica napus]
Length=332

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWTSAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P L+P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLQPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 110/148 (74%), Gaps = 4/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + ++  ER M   V+ AVDY G PA +S TGGWV AA IL +E+ ERLSTM IAVNLVTY
Sbjct  1    MSMEASERTM--FVSAAVDYTGAPASRSTTGGWVSAASILVVELCERLSTMAIAVNLVTY  58

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHLPSSTS+ I++++ G S+L  LLGG LADSFLGR+ TIAIF+ + MLG+  LA+
Sbjct  59   LVGTMHLPSSTSSTIITNWSGISYLFSLLGGVLADSFLGRYWTIAIFANIHMLGSCLLAI  118

Query  465  ATKLPQLRPSPCNPH--QACQEANGFQM  542
            ++ LP LRP PCNP     C+EANG QM
Sbjct  119  SSVLPNLRPPPCNPSLLDNCKEANGLQM  146



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M+   ADA DYKG  ADKSKTGGW+PAA ILGIE  ERLSTMGIAVNLVTYL G MHL S
Sbjct  1    MNLIHADAFDYKGLLADKSKTGGWLPAAFILGIEFCERLSTMGIAVNLVTYLSGKMHLSS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            S SANIV+DFMGTSFLLCLLGGFLADSFLGRF+TIAI + +Q +GTG LAL+T+LP L P
Sbjct  61   SASANIVTDFMGTSFLLCLLGGFLADSFLGRFRTIAISAIIQTIGTGLLALSTRLPSLHP  120

Query  492  SPCNPHQA--CQEANGFQM  542
             PC+   A  C+ A+ FQM
Sbjct  121  PPCDTTNADKCEPASSFQM  139



>emb|CDY30051.1| BnaC05g09690D [Brassica napus]
Length=349

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P L+P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLQPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>gb|ACJ85583.1| unknown [Medicago truncatula]
Length=360

 Score =   171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG PAD+S TGGW  AA+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVPDASDYKGRPADRSTTGGWSAAAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+AVQ +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAVQAIGVTILTISTIIPSLHPPKC  130

Query  501  NPH-QACQEANGFQM  542
                ++C +A+  Q+
Sbjct  131  KEDSKSCIQADSKQL  145



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 109/144 (76%), Gaps = 4/144 (3%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K S  ++D VDYKG PAD++ TGGWVPAALI+GIE+ ERLSTMGI VNLVTYL GTMH
Sbjct  3    ESKKSCFISDRVDYKGDPADRNTTGGWVPAALIVGIEVSERLSTMGIIVNLVTYLKGTMH  62

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
              S+TS+N  S+  GTSFLLCLLGG LADSFLGR+ TIAIFS +  LGT  LA++  LP+
Sbjct  63   QSSTTSSNSTSNVAGTSFLLCLLGGILADSFLGRYWTIAIFSVIHALGTCMLAISAALPE  122

Query  483  LRPSPCNPHQ----ACQEANGFQM  542
            LRPS CN H      C+E + FQM
Sbjct  123  LRPSECNLHHDFPLKCEEPSSFQM  146



>ref|XP_010676153.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=593

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA +YKG PA++S+TGGW+ +A+ILG+E  ERL T+GIA NLVTYL G MHL ++TS
Sbjct  12   TLNDAWNYKGLPANRSETGGWISSAMILGVETCERLITLGIAFNLVTYLTGVMHLGNATS  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ LG   L ++T +P LRP PC
Sbjct  72   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQALGVTVLTISTIIPNLRPPPC  131

Query  501  NPHQA-CQEANGFQM  542
              H + C +ANG Q+
Sbjct  132  AEHSSTCVQANGTQL  146



>ref|XP_006841166.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
 gb|ERN02841.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
Length=578

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S TGGW+ AA ILG+E+VERL+T+GIAVNLVTYL  TMHL S+ +AN 
Sbjct  10   DAWDYKGRPAKRSTTGGWLSAASILGVELVERLTTLGIAVNLVTYLTNTMHLRSAYAANS  69

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+ADSFLGR++TIAIF+AVQ LG   L ++T +P LRP PCN  
Sbjct  70   VTNFLGTSFMLCLLGGFIADSFLGRYRTIAIFAAVQALGVTLLTISTVIPALRPPPCNEG  129

Query  510  QACQEANGFQM  542
              C  A+  Q+
Sbjct  130  GRCVPASTLQL  140



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K   T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSENTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP  CNP  +  C +A+G Q+
Sbjct  125  LRPPRCNPTTSSNCVQASGIQL  146



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 120/153 (78%), Gaps = 10/153 (7%)
 Frame = +3

Query  114  KEMERKMSW--------TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAV  269
            K+++ + +W         V DAVDY+G  ADKS TGGWV AAL LGIE+ ERL+TMGIAV
Sbjct  4    KKVQERAAWGASDGGGNLVQDAVDYRGCRADKSSTGGWVAAALALGIELCERLATMGIAV  63

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGT  449
            NLVTYL  TMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ +Q +GT
Sbjct  64   NLVTYLTDTMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFALIQAIGT  123

Query  450  GSLALATKLPQLRPSPCNPHQA--CQEANGFQM  542
            G LA++T++ QLRP PC P  A  C++A GFQM
Sbjct  124  GLLAVSTEVRQLRPPPCGPGAAGPCEQATGFQM  156



>ref|XP_006307075.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
 gb|EOA39973.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
Length=590

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDVLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAVQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP  CNP  +  C++A G Q+
Sbjct  125  LRPPRCNPTTSSHCEQATGIQL  146



>gb|EYU29794.1| hypothetical protein MIMGU_mgv1a003534mg [Erythranthe guttata]
Length=579

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V+DA DYKG PA KS TGGW+ AA IL +E+ ERLSTM IAVNLVTYL GT+HLPS+ S+
Sbjct  11   VSDATDYKGAPAHKSTTGGWLSAASILSVELCERLSTMAIAVNLVTYLQGTLHLPSAESS  70

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
             +VS++ G SFLL L GG LADSFLGR+ TIAIFS V  LG+  LAL+T  P+LRP PCN
Sbjct  71   AVVSNWGGISFLLSLFGGILADSFLGRYWTIAIFSTVHFLGSCLLALSTVFPKLRPPPCN  130

Query  504  P--HQACQEANGFQM  542
            P     C +ANG QM
Sbjct  131  PSLSNNCIQANGLQM  145



>emb|CDY26539.1| BnaA09g47380D [Brassica napus]
Length=574

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQM  542
            +P  +  C +ANG Q+
Sbjct  130  DPTTSSHCVQANGIQL  145



>pdb|4OH3|A Chain A, Crystal Structure Of A Nitrate Transporter
 pdb|4OH3|B Chain B, Crystal Structure Of A Nitrate Transporter
Length=599

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDILLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP  CNP  +  C++A+G Q+
Sbjct  125  LRPPRCNPTTSSHCEQASGIQL  146



>emb|CDY31242.1| BnaC08g15370D [Brassica napus]
Length=575

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>ref|XP_009110669.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brassica rapa]
 gb|AFK74856.1| low-affinity nitrate transporter [Brassica rapa subsp. oleifera]
Length=590

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>emb|CDY21035.1| BnaA08g24900D [Brassica napus]
Length=575

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>ref|NP_563899.1| nitrate transporter 1.1 [Arabidopsis thaliana]
 sp|Q05085.1|PTR7_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.3; Short=AtNPF6.3; AltName: 
Full=Nitrate transporter 1.1; Short=AtNRT1; AltName: 
Full=Nitrate/chlorate transporter; AltName: Full=Protein CHLORINA 
1 [Arabidopsis thaliana]
 pdb|4CL4|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL4|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL5|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 pdb|4CL5|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 gb|AAA32770.1| CHL1 [Arabidopsis thaliana]
 gb|AAC17604.1| Identical to nitrate/chlorate transporter cDNA gb|L10357 from 
A. thaliana. ESTs gb|H37533 and gb|R29790, gb|T46117, gb|T46068, 
gb|T75688, gb|R29817, gb|R29862, gb|Z34634 and gb|Z34258 
come from this gene [Arabidopsis thaliana]
 gb|AAN72027.1| putative NPK1-related protein kinase 2 [Arabidopsis thaliana]
 gb|AAP68222.1| At1g12110 [Arabidopsis thaliana]
 dbj|BAH20163.1| AT1G12110 [Arabidopsis thaliana]
 gb|AEE28838.1| nitrate transporter 1.1 [Arabidopsis thaliana]
Length=590

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDILLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP  CNP  +  C++A+G Q+
Sbjct  125  LRPPRCNPTTSSHCEQASGIQL  146



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQM  542
            +P  +  C +ANG Q+
Sbjct  130  DPTTSSHCVQANGIQL  145



>ref|XP_002889915.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66174.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
Length=589

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQM  542
             +  C++A+G Q+
Sbjct  133  TSSHCEQASGIQL  145



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQM  542
             +  C++A G Q+
Sbjct  133  TSSHCEQATGIQL  145



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQM  542
             +  C++A G Q+
Sbjct  133  TSSHCEQATGIQL  145



>ref|XP_010476167.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQM  542
             +  C++A G Q+
Sbjct  133  TSSHCEQATGIQL  145



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 10/153 (7%)
 Frame = +3

Query  114  KEMERKMSWTVAD--------AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAV  269
            K+++ + +W V+D        AVDY+G  ADKS TGGW  AAL +GIE+ ERLSTMGIAV
Sbjct  4    KKVQERAAWCVSDGGGNLVQDAVDYRGCRADKSSTGGWASAALAVGIELCERLSTMGIAV  63

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGT  449
            NLVTYL  TMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GT
Sbjct  64   NLVTYLTATMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQAIGT  123

Query  450  GSLALATKLPQLRPSPCNPHQA--CQEANGFQM  542
            G LA++T++ QLRP PC P  A  C++A G QM
Sbjct  124  GLLAVSTEVRQLRPPPCGPGAAGPCEQATGLQM  156



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TIPDATDYKGHPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR++TIA+F+AVQ  G   LA++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAVFAAVQATGVAILAISTIVPSLHPPKC  130

Query  501  NPHQA--CQEANGFQM  542
                   C  AN  Q+
Sbjct  131  REDTVPPCVRANEKQL  146



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + L E E K   T+ DA DY+G PAD+S+TGGW  AA+ILG E  ERL+T+G+AVNLVTY
Sbjct  1    MSLPETEGK---TIPDAWDYQGRPADRSRTGGWTSAAMILGGEACERLTTLGVAVNLVTY  57

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL S+TSANIV++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   LA+
Sbjct  58   LTGTMHLGSATSANIVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFATIQATGVTILAI  117

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C     Q C  A   QM
Sbjct  118  STIIPSLRPPTCTASNDQLCTPATDTQM  145



>emb|CDY15967.1| BnaC08g41560D [Brassica napus]
Length=574

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQM  542
            +P  +  C +A+G Q+
Sbjct  130  DPTTSSHCVQASGIQL  145



>gb|KHG28852.1| Uncharacterized protein F383_16009 [Gossypium arboreum]
Length=526

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 103/137 (75%), Gaps = 3/137 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG P D+SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TVPDAWDYKGHPVDRSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++F GTSF+LCLLGGF+AD+FLGR+ TI IF+AVQ  G   L ++T +P LRP  C
Sbjct  70   ANIVTNFFGTSFMLCLLGGFIADTFLGRYFTIGIFTAVQATGVTILTVSTIIPTLRPPKC  129

Query  501  NPHQ---ACQEANGFQM  542
            N       C  A+G Q+
Sbjct  130  NREDITTICTPASGIQL  146



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQM  542
            +P  +  C +A+G Q+
Sbjct  130  DPTTSSHCVQASGIQL  145



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 108/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQM  542
            +P  +  C +A+G Q+
Sbjct  130  DPTTSSHCVQASGIQL  145



>gb|ACT66297.1| truncated nitrate transporter [Fragaria vesca]
Length=172

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 5/144 (3%)
 Frame = +3

Query  117  EMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGT  296
            E E K   T+ DA DY+G PAD+S TGGW  AA+ILG E  ERL+T+GIAVNLVTYL GT
Sbjct  5    ETEGK---TLPDAWDYQGQPADRSTTGGWTSAAMILGGEACERLTTLGIAVNLVTYLTGT  61

Query  297  MHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKL  476
            MHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +
Sbjct  62   MHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTVI  121

Query  477  PQLRPSPCN--PHQACQEANGFQM  542
            P LRP  C       C   +G Q+
Sbjct  122  PSLRPPQCTRGSDSPCISCSGKQL  145



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA++LG E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGRPAERSKTGGWTSAAMVLGGEAMERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQM  542
                 C  ANG Q+
Sbjct  130  VDSTGCIPANGEQL  143



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  1    MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQM  542
             +P LRP  CN +  Q+C +A+G Q+
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQL  146



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  1    MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQM  542
             +P LRP  CN +  Q+C +A+G Q+
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQL  146



>ref|XP_006417264.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
 gb|ESQ35617.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
Length=590

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+ KTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRFKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQM  542
             CNP  +  C +A+G Q+
Sbjct  128  RCNPTTSSHCVQASGIQL  145



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 111/135 (82%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G  ADKS TGGW  AAL +GIE+ ERLSTMGIAVNLVTYL  TMHLPS+ +A
Sbjct  18   VQDAVDYRGCRADKSSTGGWASAALAVGIELCERLSTMGIAVNLVTYLTATMHLPSAAAA  77

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GTG LA++T++ QLRP PC 
Sbjct  78   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQAIGTGLLAVSTEVRQLRPPPCG  137

Query  504  PHQA--CQEANGFQM  542
            P  A  C++A G QM
Sbjct  138  PGAAGPCEQATGLQM  152



>ref|XP_010919516.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=592

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDCKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ LG   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQALGITILTISTVAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQM  542
                A  C +A G Q+
Sbjct  133  ADPSAGGCVQAKGAQL  148



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG PAD+S TGGW  AA+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVPDASDYKGRPADRSTTGGWSAAAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+AVQ +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAVQAIGVTILTISTIIPSLHPPKC  130

Query  501  NPH-QACQEANGFQM  542
                ++C +A+  Q+
Sbjct  131  KEDSKSCIQADSKQL  145



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVN+VTYL 
Sbjct  1    MTELPQTQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNMVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQM  542
             +P LRP  CN +  Q+C +A+G Q+
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQL  146



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + L E E K   T++DA DYKG  A++  TGGW  AA+ILG+E+ ERL+T+GIAVNLVTY
Sbjct  1    MSLPETEGK---TLSDAWDYKGRSAERFTTGGWTSAAMILGVELCERLTTLGIAVNLVTY  57

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ T+AIF+ VQ  G   L +
Sbjct  58   LTGTMHLGNATSANNVTNFLGTSFMLCLLGGFIADTFLGRYLTVAIFATVQATGVTILTI  117

Query  465  ATKLPQLRPSPCNPHQACQEANGFQM  542
            +T +P LRP  C   + C +A+G Q+
Sbjct  118  STIVPSLRPPKCTAGEVCVQASGLQL  143



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  11   TIPDACDYKGHPAERSKTGGWTAAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++FMGTSF+LCL GGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  71   ANTVTNFMGTSFMLCLFGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQM  542
              +  + C  AN  Q+
Sbjct  131  IRDATRRCMPANNMQL  146



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 102/136 (75%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  11   TIPDACDYKGHPAERSKTGGWTAAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++FMGTSF+LCL GGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  71   ANTVTNFMGTSFMLCLFGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQM  542
              +  + C  AN  Q+
Sbjct  131  IRDATRRCMPANNMQL  146



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA +SKTGGWV AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  38   TIPDACDYKGHPAQRSKTGGWVAAAMILGVEASERLTTMGVAVNLVTYLTGTMHLGSANS  97

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++FMGTSF+LCLLGGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  98   ANTVTNFMGTSFMLCLLGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPGLHPPKC  157

Query  501  --NPHQACQEANGFQM  542
              +  + C+ A+  Q+
Sbjct  158  VRSATRRCEPASNMQL  173



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQM  542
                  C  AN  Q+
Sbjct  132  GDTVPPCVRANEKQL  146



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQM  542
                  C  AN  Q+
Sbjct  132  GDTVPPCVRANEKQL  146



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQM  542
                  C  AN  Q+
Sbjct  132  GDTVPPCVRANEKQL  146



>ref|XP_010919515.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=509

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDCKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ LG   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQALGITILTISTVAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQM  542
                A  C +A G Q+
Sbjct  133  ADPSAGGCVQAKGAQL  148



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDFKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+G+SF+LCLLGGFLADSFLGR+ TIAIF+AVQ  GT  L ++T  P LRP  C
Sbjct  73   ANTVTNFLGSSFMLCLLGGFLADSFLGRYLTIAIFTAVQASGTTILTISTAAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQM  542
                A  C  A+G Q+
Sbjct  133  ADPSAGGCVRASGAQL  148



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA D+KG PAD+S TGGW  AA+ILG EI+ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVHDASDFKGRPADRSTTGGWSAAAMILGGEIMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+A+Q +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAIQAMGVTILTISTIIPSLHPPKC  130

Query  501  NPHQA--CQEANGFQM  542
                   C EA+  Q+
Sbjct  131  TKDSTTPCVEASNKQL  146



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 107/146 (73%), Gaps = 3/146 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    + K+   V DA D KGFPA++SKTGGW  A++ILG E++ERL+T+GI VNLVTY
Sbjct  4    LPTTTQQEKI---VPDAYDCKGFPAERSKTGGWTSASMILGGEVMERLTTLGITVNLVTY  60

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL +++SANIV++F+GTSF+LCL GGFL D+++GR+  IA+F+AVQ  G   L +
Sbjct  61   LTGTMHLGNASSANIVTNFVGTSFMLCLFGGFLGDTYIGRYLNIAVFAAVQATGVALLMI  120

Query  465  ATKLPQLRPSPCNPHQACQEANGFQM  542
            +T +P L P  C  H  C +AN  Q+
Sbjct  121  STIIPSLSPPTCKEHTTCVKANNTQL  146



>ref|XP_008796822.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=600

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K   T++DA D+KG PA +S+TG W  AA+ILG+E+ ERL+T+GIAVNLVTY
Sbjct  4    LPETDAEGK---TLSDAWDFKGRPAVRSQTGRWTSAAMILGVELCERLTTLGIAVNLVTY  60

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++ SAN V++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ  GT  L +
Sbjct  61   LTGTMHLGNAASANTVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQATGTTILTV  120

Query  465  ATKLPQLRPSPCN--PHQACQEANGFQM  542
            +T  P LRP  C   P   C  A+G Q+
Sbjct  121  STAAPGLRPPACADPPAGGCARASGAQL  148



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PAD+SKTG W  AA+ILG E VERL+T+GIAVNLVTY+ GTMHL ++ SANI
Sbjct  15   DAWDYKGRPADRSKTGRWTAAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANI  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVE  134

Query  510  QA--CQEANGFQM  542
             +  C  A  FQ+
Sbjct  135  SSSHCAPATDFQL  147



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  AA+ILG E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDCKGRPAERSKTGGWTSAAMILGGEAMERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQM  542
              +  C  ANG Q+
Sbjct  130  VDNTDCIPANGEQL  143



>ref|XP_003608752.1| Nitrate transporter [Medicago truncatula]
 gb|AES90949.1| peptide/nitrate transporter [Medicago truncatula]
Length=593

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  +A+ILG+E  ERL+TMGIAVNLVTYL GTMHL +++S
Sbjct  11   TIQDAWDCKGHPAERSKTGGWTSSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++FMGT F+LCLLGGF+AD+F+GR+ TIAIF+ V+ +G   L ++T +P L P  C
Sbjct  71   ANIVTNFMGTCFMLCLLGGFVADTFIGRYLTIAIFATVEAIGVTILTISTIIPSLHPPKC  130

Query  501  NPH--QACQEANGFQM  542
                 ++C+ AN  Q+
Sbjct  131  TKSNLKSCEPANNIQL  146



>ref|XP_002529778.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32592.1| oligopeptide transporter, putative [Ricinus communis]
Length=584

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  +A+ILG+E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  12   TLPDAWDYKGRPAERSKTGGWTSSAMILGVEAIERLTTLGIAVNLVTYLTGTMHLANATS  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+L LLGGF+AD+FLGR+ TIAIF+ VQ +G   L ++T +P LRP  C
Sbjct  72   ANTVTNFLGTSFMLTLLGGFVADTFLGRYLTIAIFATVQAMGITILTISTIIPSLRPPKC  131

Query  501  NPHQACQEANGFQM  542
            + + AC  A+G Q+
Sbjct  132  HNNTACIPASGTQL  145



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PAD+SKTG W  AA+ILG E VERL+T+GIAVNLVTY+ GTMHL ++ SANI
Sbjct  15   DAWDYKGRPADRSKTGRWTAAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANI  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVE  134

Query  510  QA--CQEANGFQM  542
             +  C  A  FQ+
Sbjct  135  SSSHCAPATDFQL  147



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  +A+ILG+E  ERL+TMGIAVNLVTYL GTMHL +++S
Sbjct  11   TIQDAWDCKGSPAERSKTGGWTSSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++FMGT F+LCLLGGF+AD+F+GR+ TIAIF+ V+ +G   L ++T +P L P  C
Sbjct  71   ANIVTNFMGTCFMLCLLGGFVADTFIGRYLTIAIFATVEAIGVTMLTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQM  542
              N  + C+ AN  Q+
Sbjct  131  TQNSVKHCEAANNIQL  146



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            +V DA DYKG PAD+SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL G MHL ++ S
Sbjct  20   SVFDAWDYKGRPADRSKTGGWKSAAMILGGEACERLTTLGIAVNLVTYLTGVMHLGNAAS  79

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ LG   L ++T +P LRP  C
Sbjct  80   ANTVTNFMGTSFMLCLLGGFIADTFLGRYLTIAIFATVQALGVTVLTISTIIPSLRPPAC  139

Query  501  NPH-QACQEANGFQM  542
             P   +C  A+  Q+
Sbjct  140  KPEFGSCTPASDTQL  154



>ref|XP_006645998.1| PREDICTED: nitrate transporter 1.4-like [Oryza brachyantha]
Length=593

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
             V DAVDY+G PAD++ TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +
Sbjct  76   VVRDAVDYRGCPADRAATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAA  135

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GTG LA++T + QLRP PC
Sbjct  136  ANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQAVGTGLLAVSTLMHQLRPPPC  195

Query  501  NPHQ---ACQEANGFQM  542
                   AC++A   QM
Sbjct  196  AAAAAGVACEQATPVQM  212



>ref|XP_010553465.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=589

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 106/136 (78%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PA +SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++TS
Sbjct  9    TLLDAWDFQGRPAIRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLKGTMHLGNATS  68

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L L+T +P LRP  C
Sbjct  69   ANTVTNFIGTSFMLCLLGGFVADTFLGRYMTIAIFATIQATGVTILTLSTIIPGLRPPKC  128

Query  501  NP--HQACQEANGFQM  542
            +P    +C +A+G Q+
Sbjct  129  DPTSSNSCVQASGMQL  144



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA +Y G PA++S TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMH  +++S
Sbjct  10   TISDARNYNGRPAERSTTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHFGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFILCLLGGFVADTFLGRYLTIAIFATVQATGVTLLTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQ  539
               + C  AN  Q
Sbjct  130  TAGEPCTPANRLQ  142



>emb|CBI31901.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
                   C  A+G Q
Sbjct  130  AMETGPLCTPASGMQ  144



>ref|XP_002266951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Vitis vinifera]
Length=591

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
                   C  A+G Q
Sbjct  130  AMETGPLCTPASGMQ  144



>emb|CAN71417.1| hypothetical protein VITISV_004658 [Vitis vinifera]
Length=591

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
                   C  A+G Q
Sbjct  130  AMETGPLCTPASGMQ  144



>ref|XP_009382411.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ADA D+KG PA KS TGGW  AA+ILG+E+ ER++T+GIAVNLVTYL GTMHL ++ S
Sbjct  13   TLADAWDFKGRPAVKSTTGGWTSAAMILGVELCERMTTLGIAVNLVTYLTGTMHLGNAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+A+Q  G   L ++T  P LRP  C
Sbjct  73   ANVVTNFLGTSFMLCLLGGFVADTYLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPEC  132

Query  501  -NP-HQACQEANGFQ  539
             NP    C  ANG Q
Sbjct  133  SNPLGGGCVTANGTQ  147



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K   T+ DA DYKG  A +S TGGW  AA+ILG+E  ERL+T+GIAVNLVTY
Sbjct  3    LPQSYEEAK---TIPDAWDYKGGQAQRSTTGGWAAAAMILGVEACERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L +
Sbjct  60   LTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIAIFAAVQATGVALLTI  119

Query  465  ATKLPQLRPSPC-NPHQACQEANGFQ  539
            +T +P LRP  C    ++C +A+G Q
Sbjct  120  STTIPSLRPPKCAQGSRSCVQASGNQ  145



>ref|XP_007039888.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
 gb|EOY24389.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
Length=583

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGSPAERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  129

Query  501  ---NPHQACQEANGFQ  539
               NP   C +A+G Q
Sbjct  130  SMDNP-TTCTQASGIQ  144



>ref|XP_008238567.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Prunus mume]
Length=599

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 4/146 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWAAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+++Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFASIQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQM  542
             +P LRP  C       C  A+G Q+
Sbjct  124  TVPSLRPPKCTADTGTPCIPASGKQL  149



>gb|KJB20886.1| hypothetical protein B456_003G170400 [Gossypium raimondii]
Length=585

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG P+++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPSERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++F GTSF+LCLLGGF+AD+FLGR+ TI IF+AVQ  G   L ++T +P LRP  C
Sbjct  70   ANIVTNFFGTSFMLCLLGGFVADTFLGRYLTIGIFTAVQATGVTILTVSTIIPSLRPPKC  129

Query  501  --NPHQACQEANGFQM  542
              +    C  A+G Q+
Sbjct  130  TRDSTTVCIPASGIQL  145



>ref|XP_009411557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D+KG PA KS+TGGW  AA ILG+E+ ERL+T+GIAVNLVTYL GTMHL S+ S
Sbjct  13   TLPDAWDFKGRPAVKSRTGGWSCAATILGVELCERLTTLGIAVNLVTYLTGTMHLGSAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFIADTYLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQ  539
            +   +  C  A+G Q
Sbjct  133  DGSYSGGCARASGLQ  147



>dbj|BAC81420.1| nitrate transporter [Prunus persica]
Length=596

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQM  542
             +P LRP  C    +  C  A+G Q+
Sbjct  124  TIPSLRPPKCTSDTSTPCIPASGKQL  149



>dbj|BAD22820.1| nitrate transporter [Prunus persica]
Length=594

 Score =   164 bits (415),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 109/146 (75%), Gaps = 4/146 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQM  542
             +P LRP  C    +  C  A+G Q+
Sbjct  124  TIPSLRPPKCTSDTSTPCIPASGKQL  149



>ref|XP_007210870.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
 gb|EMJ12069.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
Length=596

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQM  542
             +P LRP  C       C  A+G Q+
Sbjct  124  TIPSLRPRKCTSDTGTPCIPASGKQL  149



>ref|XP_004298652.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=591

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 107/146 (73%), Gaps = 5/146 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L+E E K   T+ DA DY+G PAD+S TGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  4    LQETEGK---TLPDAWDYQGQPADRSTTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTIST  120

Query  471  KLPQLRPSPCN--PHQACQEANGFQM  542
             +P LRP  C       C  A+G Q+
Sbjct  121  VIPSLRPPKCTAGSDSPCIPASGKQL  146



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA KS +GGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  14   TLPDAWDYKGRPAVKSSSGGWTSAAMILGVEVCERLTTLGIAVNLVTYLTGTMHLGNAGS  73

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD++LGR+ TI IF+ VQ +G   L ++T +P LRP  C
Sbjct  74   ANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKC  133

Query  501  NP-HQACQEANGFQM  542
            +P  ++C  A+  Q+
Sbjct  134  SPGSKSCIPASNKQL  148



>ref|XP_009411558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA KS+TGGW  A++ILG+E+ ERL+T+GIAVNLVTYL  TMHL S+ S
Sbjct  13   TLSDAWDFKGRPAVKSQTGGWTCASMILGVELCERLTTLGIAVNLVTYLTATMHLGSAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANAVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPAC  132

Query  501  -NPHQ-ACQEANGFQM  542
             +P    C  ANG QM
Sbjct  133  ADPLTGGCVRANGTQM  148



>gb|KHG24776.1| Uncharacterized protein F383_04224 [Gossypium arboreum]
Length=585

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S TGGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPAERSTTGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTVLTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQM  542
                A  C  A+G Q+
Sbjct  130  TRDNATICTPASGIQL  145



>gb|KJB20885.1| hypothetical protein B456_003G170300 [Gossypium raimondii]
Length=586

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S TGGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPAERSTTGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTVLTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQM  542
                A  C  A+G Q+
Sbjct  130  TRDNATICTPASGIQL  145



>ref|XP_009333599.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  A +ILG E  ERL+T+GIAVNLVTYL GTMHL S+TS
Sbjct  15   TLPDAWDYKGHPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATS  74

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P  C
Sbjct  75   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKC  134

Query  501  NP--HQACQEANGFQM  542
                   C  A+G Q+
Sbjct  135  TAGTGSQCLPASGKQL  150



>gb|KHG00259.1| Uncharacterized protein F383_18798 [Gossypium arboreum]
Length=585

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG+E  ERL+T+GIAVN+VTYL GTMHL ++TS
Sbjct  10   TLPDAWDYRGCPAERSKSGGWTSAAMILGVEACERLTTLGIAVNMVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI +F+AVQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIVLFAAVQATGVTILTISTVIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
            +      C  A+G Q
Sbjct  130  SRDSVTTCTPASGIQ  144



>ref|XP_009333673.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  A +ILG E  ERL+T+GIAVNLVTYL GTMHL S+TS
Sbjct  15   TLPDAWDYKGRPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATS  74

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P  C
Sbjct  75   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKC  134

Query  501  NP--HQACQEANGFQM  542
                   C  A+G Q+
Sbjct  135  TAGTGSQCLPASGKQL  150



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = +3

Query  201  WVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGF  380
            ++   + +GIE+ ERLSTMGIAVNLVTYL G MH+PS+TSA IVSDFMGTSFLLCLLGG 
Sbjct  5    YIQHVISIGIEVSERLSTMGIAVNLVTYLIGRMHIPSATSAKIVSDFMGTSFLLCLLGGL  64

Query  381  LADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQA-----CQEANGFQM  542
            +ADSFLGR++TIAIF+ +Q LGTG LA+++ LPQL+P+PCN H +     C++A   QM
Sbjct  65   IADSFLGRYRTIAIFAIIQTLGTGMLAISSMLPQLQPTPCNIHYSLKSSNCEQATTSQM  123



>ref|XP_007039889.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
 gb|EOY24390.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
Length=584

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGSPAERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLG-RFKTIAIFSAVQMLGTGSLALATKLPQLRPSP  497
            A  V++F+GTSF+LCLLGGF+AD+FLG R+ TI IF+ VQ  G   L ++T +P LRP  
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGSRYLTIGIFATVQATGVTILTISTVIPSLRPPK  129

Query  498  C---NPHQACQEANGFQ  539
            C   NP   C +A+G Q
Sbjct  130  CSMDNP-TTCTQASGIQ  145



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG E  ERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  10   TLPDAWDYRGKPAERSKSGGWASAAMILGGEACERLTTLGIAVNLVTYLTETMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
                A  C  A+G Q
Sbjct  130  TRDNATTCTPASGIQ  144



>ref|XP_008358135.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Malus domestica]
Length=595

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E + + T+ DA DY+G PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLV YL GTMH
Sbjct  9    ETQGNLTLPDAWDYRGCPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVNYLTGTMH  68

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L ++T +P 
Sbjct  69   LGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQATGVTVLTISTIVPS  128

Query  483  LRPSPCNP--HQACQEANGFQM  542
            LRP  C       C  A+G Q+
Sbjct  129  LRPPKCTDGTDLPCITASGKQL  150



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 113/155 (73%), Gaps = 19/155 (12%)
 Frame = +3

Query  117  EMERKM------SWT-------VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTM  257
             ME KM      SW        V DAVDY G PAD+S+TG WV AAL+LGIE+ ERL+TM
Sbjct  45   NMEEKMETGARPSWIGAGNGNLVHDAVDYHGCPADRSRTGSWVAAALVLGIELCERLATM  104

Query  258  GIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQ  437
            GIAVNLVTYL  TMHLPS+ SAN+V+DFMGTSFLLCLLGGFLADSFLGRF TIAIF+ +Q
Sbjct  105  GIAVNLVTYLTDTMHLPSAESANVVTDFMGTSFLLCLLGGFLADSFLGRFLTIAIFALLQ  164

Query  438  MLGTGSLALATKLPQLRPSPCNPHQACQEANGFQM  542
             LGTG LA++T + QLRP P       + A G QM
Sbjct  165  ALGTGLLAVSTTVRQLRPGP------GEAATGLQM  193



>gb|KJB25599.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=586

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG+E  ERL+T+GIAVN+VTYL GTMHL +++S
Sbjct  10   TLPDAWDYRGCPAERSKSGGWTSAAMILGVEACERLTTLGIAVNMVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQ  539
            +      C  A+G Q
Sbjct  130  SRDSVTTCTPASGIQ  144



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 111/139 (80%), Gaps = 10/139 (7%)
 Frame = +3

Query  111  LKEMERKMS-WT---------VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMG  260
            ++E+E+K S W+         V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMG
Sbjct  2    VREVEKKTSAWSGGGGGGGNMVRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMG  61

Query  261  IAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQM  440
            IAVNLVTYL GTMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ 
Sbjct  62   IAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQS  121

Query  441  LGTGSLALATKLPQLRPSP  497
            +GT  LA +T +  LRP P
Sbjct  122  IGTALLAASTLVTHLRPPP  140



>gb|ABF93501.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01124.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64490.1| hypothetical protein OsJ_19340 [Oryza sativa Japonica Group]
Length=589

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V +A DYKG  A +  TGGW  AA+IL +E+ ERL+T+G+AVNLVTYL GTMHL S+ SA
Sbjct  29   VGEAWDYKGRGAIRGSTGGWRSAAMILCVELNERLTTLGVAVNLVTYLTGTMHLGSAASA  88

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGFLAD++LGR+ TIAIF+AVQ  G   L ++T  P LRP PC+
Sbjct  89   NAVTNFLGTSFMLCLLGGFLADTYLGRYLTIAIFTAVQAAGMAVLTISTAAPGLRPPPCS  148

Query  504  P-HQACQEANGFQM  542
                 C  ANG Q+
Sbjct  149  SGGSGCAAANGTQL  162



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+A +FLGR+ TIAIF+A+Q  G   L L+T +P  +P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIAHTFLGRYLTIAIFAAIQATGVSILTLSTIIPGFQPP  127

Query  495  PC-NPHQACQEANGFQM  542
             C      C + +G Q+
Sbjct  128  RCPTTSSHCVQPSGIQL  144



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA +S++GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  14   LSDAWDYKGRPAIRSRSGGWTSAAMILVVELNERLTTLGIAVNLVTYLRGTMHLGTAVSA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +  LRP  C+
Sbjct  74   NTVTNFMGTSFMLCLLGGFIADTFLGRYLTIAIFAAVQASGVTILTISTVVRGLRPPACS  133

Query  504  PHQA--CQEANGFQ  539
               A  C +A+G Q
Sbjct  134  DLAAGGCVKASGTQ  147



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY G PA KSKTGGWV AA+ILG E VERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  13   TLPDAWDYTGKPAIKSKTGGWVAAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCL GGF+AD+FLGR+ TI+IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLFGGFVADTFLGRYLTISIFATVQATGVTLLTISTIIPSLRPPKC  132

Query  501  NP  506
            +P
Sbjct  133  SP  134



>ref|XP_006650950.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=570

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS  + DA DYKG PA ++ TGGW  AA+IL +E+ ERL+T+GIAVNLVTYL  TMHL +
Sbjct  2    MSSQLPDAWDYKGRPAIRASTGGWSCAAMILFVELNERLTTLGIAVNLVTYLTATMHLGT  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            + SAN V++F+GTSF+LCLLGGFLAD++L R+ TIAIF+A+Q  G   L ++T    LRP
Sbjct  62   AASANTVTNFLGTSFILCLLGGFLADTYLARYLTIAIFTALQATGMAVLTISTAATGLRP  121

Query  492  SPC-NPHQACQEANGFQ  539
             PC +P  +C+ ANG Q
Sbjct  122  PPCTDPIGSCEPANGTQ  138



>ref|XP_009376056.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=597

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E + + T+ DA DY+G PA++SKTGGW  A +ILG E  ERL+T+GIAVNLV YL GTMH
Sbjct  9    ETQGNLTLPDAWDYRGCPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVNYLTGTMH  68

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQ  482
            L ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L ++T +P 
Sbjct  69   LGNATSANTVTNFLGTSFILCLLGGFVADTFLGRYLTIAIFATIQATGVTVLTISTIVPS  128

Query  483  LRPSPCNPHQA--CQEANGFQM  542
            LRP  C       C  ++G Q+
Sbjct  129  LRPPKCTDGTVLPCITSSGKQL  150



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA +S+TG W  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  11   LSDAWDYKGRPAVRSRTGVWSGAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAASA  70

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-  500
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  71   NTVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFAAVQASGVSILTISTAVPGLRPPACA  130

Query  501  NPHQ-ACQEANGFQM  542
            +P    C +A+G Q+
Sbjct  131  DPASGGCVKASGAQL  145



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 107/151 (71%), Gaps = 4/151 (3%)
 Frame = +3

Query  96   TVELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNL  275
            TV LP  E        ++DA DYKG  A +S+TGGW  AA+IL +E+ ERL+T+GIAVNL
Sbjct  5    TVGLP--ETSAASGEVLSDAWDYKGRLAVRSRTGGWTGAAMILVVELNERLATLGIAVNL  62

Query  276  VTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGS  455
            VTYL GTMH  ++ +AN+V++FMG SF+LCLLGGF+AD++LGR+ T+ IF+AVQ  G   
Sbjct  63   VTYLTGTMHQGNADAANVVTNFMGVSFMLCLLGGFVADAYLGRYLTVGIFTAVQASGVTI  122

Query  456  LALATKLPQLRPSPC--NPHQACQEANGFQM  542
            L ++T LP L P PC      +C EA+G QM
Sbjct  123  LTISTALPGLHPPPCADTASGSCAEASGLQM  153



>ref|XP_004244572.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG P+ +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+
Sbjct  12   TLPDAWDYKGRPSLRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATA  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C
Sbjct  72   ANNVTNFLGTSFMLTLLGGFIADTFLGRYLTIGIFATVQAIGVTILTISTIVPSLRPPKC  131

Query  501  NP-HQACQEANGFQM  542
                 +C  ANG Q+
Sbjct  132  EQGSSSCIPANGKQL  146



>ref|XP_009382412.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA KS+T GW  AA ILG+E+ ERL+T+GIAVNLVTY  GTMHL  + S
Sbjct  13   TLSDAWDFKGRPAIKSRTAGWACAAAILGVEMGERLTTLGIAVNLVTYPTGTMHLGGADS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            ANI+++F+GTSF+LCL GGF+AD+FLGR+ TIA+F+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANIITNFLGTSFILCLFGGFIADTFLGRYLTIAVFTAVQACGVIILTISTVAPGLRPPAC  132

Query  501  -NPHQ-ACQEANGFQM  542
              P    C  ANG QM
Sbjct  133  AGPSSGGCVPANGLQM  148



>ref|XP_004147617.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004171170.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY G PA K+KTGGWV AA+ILG E VERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  13   TLPDAWDYTGKPAIKAKTGGWVAAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCL GGF+AD+FLGR+ TI+IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLFGGFVADTFLGRYLTISIFATVQAAGVTILTISTIIPSLRPPKC  132

Query  501  NP  506
            +P
Sbjct  133  SP  134



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DY+G PA +SK+GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ +A
Sbjct  14   LSDAWDYRGRPAVRSKSGGWTSAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+F+GR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  74   NTVTNFMGTSFMLCLLGGFVADTFIGRYLTIAIFAAVQASGVTILTISTAVPGLRPPKC-  132

Query  504  PHQA---CQEANGFQM  542
            P+ A   C +A+  Q+
Sbjct  133  PNMASGNCMKASPAQL  148



>gb|EYU18566.1| hypothetical protein MIMGU_mgv1a020825mg [Erythranthe guttata]
Length=590

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  + +S +GGW  AA+ILG+E VERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  13   TLPDAWDYKGRASVRSSSGGWASAAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNAMS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  132

Query  501  NP-HQACQEANGFQM  542
                ++C  A+G Q+
Sbjct  133  TAGSESCIPASGKQL  147



>gb|EYU30304.1| hypothetical protein MIMGU_mgv1a003140mg [Erythranthe guttata]
Length=605

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  A +S +GGW  AA+ILG+E  ERL+T+GIAVNL+TYL  TMHL ++TS
Sbjct  13   TLPDAWDYKGRAAVRSSSGGWASAAMILGVETCERLTTLGIAVNLLTYLTATMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD++LGR+ TI IF+AVQ +G   L ++T +P LRP  C
Sbjct  73   ANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIGIFAAVQAMGVALLTVSTIIPGLRPPKC  132

Query  501  NP-HQACQEANGFQM  542
                ++C  A G Q+
Sbjct  133  AAGGESCIPATGKQL  147



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSP  497
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP  119



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSP  497
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP  119



>ref|XP_004983703.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +A
Sbjct  15   LTDAWDYKGRPASRATTGGWACAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGF+ADS+LGR+ TIA+F+AVQ  G   L ++T  P LRP PC 
Sbjct  75   NTVTNFIGTSFMLCLLGGFVADSYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCA  134

Query  504  PHQA----CQEANGFQ  539
              +     C  ANG Q
Sbjct  135  DAKGASPDCVPANGTQ  150



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVCAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSP  497
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP  119



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA ++++GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ +A
Sbjct  14   LSDAWDYKGRPAVRAQSGGWTSAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  74   NTVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFAAVQASGVTILTISTAVPGLRPPACT  133

Query  504  PHQA--CQEANGFQM  542
               +  C +A+  Q+
Sbjct  134  DVGSGNCVKASAAQL  148



>ref|XP_004983702.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +A
Sbjct  15   LTDAWDYKGRPASRASTGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGF+ADS+LGR+ TIAIF+AVQ  G   L ++T  P LRP PC 
Sbjct  75   NTVTNFIGTSFMLCLLGGFVADSYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPPCA  134

Query  504  PHQA----CQEANGFQ  539
              +     C  ANG Q
Sbjct  135  DAKGASPDCVPANGTQ  150



>ref|XP_009800593.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800594.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Nicotiana 
sylvestris]
Length=594

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALLDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++T+AN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNATAANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>emb|CAC00545.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=594

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALPDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++T+AN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNATAANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 101/134 (75%), Gaps = 3/134 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP+ C+ +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPAACSAN  138

Query  510  QA---CQEANGFQM  542
                 C  A+G Q+
Sbjct  139  AGDGECARASGAQL  152



>ref|XP_008649786.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA42806.1| TPA: hypothetical protein ZEAMMB73_647219 [Zea mays]
Length=600

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 6/151 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E KM+ T+ DA DYKG PA ++ +GGW  AA+IL +E+ ERL+T+G+ VNLVTY
Sbjct  7    LPETVAEGKMTTTMNDAWDYKGRPAVRASSGGWSSAAMILVVELNERLTTLGVGVNLVTY  66

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL  + SAN V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L +
Sbjct  67   LIGTMHLGGAASANAVTNFLGASFMLCLLGGFVADTYLGRYLTIAIFTAVQAAGMCVLTV  126

Query  465  ATKLPQLRPSPC------NPHQACQEANGFQ  539
            +T  P LRP  C      +   +C E +G Q
Sbjct  127  STAAPGLRPPACADPTGPSRRSSCVEPSGTQ  157



>ref|XP_009598780.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=594

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALPDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL +++SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>dbj|BAC56916.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALPDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL +++SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DY+G PA +  TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +AN+
Sbjct  17   DAWDYRGRPAARVSTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANV  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGRF TIAIF+A+Q  G   L ++T  P LRP+ C P 
Sbjct  77   VTNFMGTSFMLCLLGGFVADSFLGRFLTIAIFTAIQASGVTILTISTAAPGLRPASCTPS  136

Query  510  QA---CQEANGFQM  542
             +   C  A+G Q+
Sbjct  137  SSSPVCARASGAQL  150



>ref|XP_006358355.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG P+ +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPSLRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFIADTFLGRYLTIGIFATVQAIGVTILTISTIIPSLRPPKCEQG  134

Query  507  HQACQEANGFQM  542
              +C  A+G Q+
Sbjct  135  SSSCIPASGKQL  146



>gb|EAY88182.1| hypothetical protein OsI_09629 [Oryza sativa Indica Group]
Length=589

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V +A DYKG  A +  TGGW  AA+IL +E+ ERL+T+G+AV+LVTYL GTMHL S+ SA
Sbjct  29   VGEAWDYKGRGAIRGSTGGWRSAAMILCVELNERLTTLGVAVHLVTYLTGTMHLGSAASA  88

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGFLAD++LGR+  IAIF+AVQ  G   L ++T  P LRP PC+
Sbjct  89   NAVTNFLGTSFMLCLLGGFLADTYLGRYLPIAIFTAVQAAGMAVLTISTAAPGLRPPPCS  148

Query  504  P-HQACQEANGFQM  542
                 C  ANG Q+
Sbjct  149  SGGSGCAAANGTQL  162



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRASTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C  +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSN  138

Query  510  QA-CQEANGFQM  542
             A C  A G Q+
Sbjct  139  DASCSRATGPQL  150



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +3

Query  225  GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGR  404
            GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR
Sbjct  26   GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGR  85

Query  405  FKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQ-ACQEANGFQM  542
            +KTIAIF+ +Q LGTG L LA  LPQLRP PC+ H  +CQ A G QM
Sbjct  86   YKTIAIFALIQTLGTGMLTLAVSLPQLRPPPCHRHDVSCQPAKGSQM  132



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRASTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C  +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSN  138

Query  510  QA-CQEANGFQM  542
             A C  A G Q+
Sbjct  139  DASCSRATGPQL  150



>gb|EMT27348.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=381

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 4/148 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E+  +    + DA D KG PA +S TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ 
Sbjct  5    LPEIAAEGKGILTDAWDSKGRPAARSTTGGWGCAAMILGAELFERMTTLGIAVNLVPYMT  64

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL S+ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T
Sbjct  65   GTMHLGSAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTIST  124

Query  471  KLPQLRPSPCNPHQA----CQEANGFQM  542
              P LRP+ C         C  ANG Q+
Sbjct  125  VAPGLRPAVCGDATGQSPDCVPANGTQL  152



>dbj|BAC56915.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALPDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++T+AN V++F+GTSF+L L GGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNATAANNVTNFLGTSFMLTLFGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>ref|XP_009763469.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=594

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K    + DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDSK---ALPDAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L GTMHL ++T+AN V++F+GTSF+L L GGF+AD+FLGR+ TI IF+ VQ +G   L +
Sbjct  60   LTGTMHLGNATAANNVTNFLGTSFMLTLFGGFVADTFLGRYLTIGIFATVQAMGVTILTI  119

Query  465  ATKLPQLRPSPCNP--HQACQEANGFQM  542
            +T +P LRP  C      +C  AN  Q+
Sbjct  120  STIIPSLRPPKCEQVGSSSCIPANSKQL  147



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C+  
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSAT  138

Query  510  QA-----CQEANGFQM  542
                   C  A+G Q+
Sbjct  139  GGGVVGECARASGAQL  154



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C+  
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSAT  138

Query  510  QA-----CQEANGFQM  542
                   C  A+G Q+
Sbjct  139  GGGVVGECARASGAQL  154



>ref|XP_002464959.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
 gb|EER91957.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
Length=595

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG+E+ ER++T+GIAVNLV Y+ GTMHL ++++AN 
Sbjct  17   DAWDYKGRPASRATTGGWACAAMILGVELFERMTTLGIAVNLVPYMTGTMHLGNASAANT  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+G SF+LCLLGGF+AD++LGR+ TIA+F+AVQ  G   L ++T  P LRP PC   
Sbjct  77   VTNFIGASFMLCLLGGFVADTYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCGDA  136

Query  510  QA----CQEANGFQ  539
            +     C  A G Q
Sbjct  137  RGASADCVPATGTQ  150



>ref|XP_008367434.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Malus domestica]
Length=598

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 102/139 (73%), Gaps = 5/139 (4%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGI---EIVERLSTMGIAVNLVTYLGGTMHLPS  311
            T+ DA  YKG P ++SKTGGW  AA+ILGI   E  ERL+T+GIAVNLVTYL GT HL S
Sbjct  15   TLPDAWVYKGCPTERSKTGGWTAAAMILGITSGEACERLTTLGIAVNLVTYLTGTTHLGS  74

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRP  491
            +T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P
Sbjct  75   ATAANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQP  134

Query  492  SPCNP--HQACQEANGFQM  542
              C       C  A+G Q+
Sbjct  135  PKCTAGTGSQCLPASGKQL  153



>ref|XP_010669517.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
             VDY G PADKS+TGGW+ A LILG E  ER+  MGI++NLVTYL G +HL SS SA IV
Sbjct  16   VVDYNGNPADKSRTGGWLAAGLILGTEFAERVCVMGISMNLVTYLVGYLHLSSSKSATIV  75

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH-  509
            ++FMGT  LL L GGF+AD+ LGR+ T+AIF+++  LG   L LAT LP +RP PCNP  
Sbjct  76   TNFMGTLNLLGLFGGFVADAKLGRYLTVAIFASIAALGVALLTLATSLPSMRPPPCNPRS  135

Query  510  --QACQEANGFQM  542
                C  A+G Q+
Sbjct  136  PGSHCISADGKQL  148



>gb|EMS53820.1| Nitrate transporter 1.4 [Triticum urartu]
Length=542

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 6/114 (5%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            E+ER  SW+     V DAVDY+G PA++S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  2    EIERS-SWSEDGNLVQDAVDYRGCPANRSNTGSWLGAASVVGIELCERLATMGIAVNLVT  60

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQML  443
            YL  TMHLPS+ SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+ + +L
Sbjct  61   YLTDTMHLPSAESANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFALMVVL  114



>dbj|BAK05363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DY+G PA +  +GGW  AA+ILG+E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN 
Sbjct  18   DAWDYRGRPAVRDSSGGWSSAAMILGVELNERLTTLGIAVNLVTYLTATMHLGNAASANA  77

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            V++F+GTSFLLCLLGGF+AD++LGR+ TIAI +AVQ  G   L ++T  P LRP+PC 
Sbjct  78   VTNFLGTSFLLCLLGGFVADTYLGRYLTIAISTAVQAAGMTVLTVSTAAPGLRPAPCK  135



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 106/149 (71%), Gaps = 4/149 (3%)
 Frame = +3

Query  99   VELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLV  278
            ++LP  + + K   ++ DA DYKG PA KS +GGW  +A+ILG+E VERL T+GIAVNLV
Sbjct  1    MDLPQTQQDTK---SIPDAWDYKGRPALKSLSGGWASSAMILGVEAVERLVTLGIAVNLV  57

Query  279  TYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSL  458
             YL  TMHL ++ +ANIV++FMGTS++L LLGG++AD+F+GR+ TI IF+ VQ +G   L
Sbjct  58   VYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIADTFIGRYLTIGIFATVQAIGVTIL  117

Query  459  ALATKLPQLRPSPCN-PHQACQEANGFQM  542
             ++T +P LRP  C      C  A+G Q+
Sbjct  118  TISTIIPSLRPPKCELGSSTCIPASGKQL  146



>ref|XP_011070105.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L +  ++ + T+ DA DYKG  + KS +GGW  AA+ILG+E  ER++T+GI VNLVTYL 
Sbjct  5    LPDTAQQAAETIPDAWDYKGRLSLKSSSGGWGSAAMILGVEACERMTTLGIVVNLVTYLT  64

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALAT  470
            GTMHL ++T+AN V++F+GT+F+LCLLGGF+AD+FLGR+ TI IF+ +Q  G   L ++T
Sbjct  65   GTMHLGNATAANDVTNFLGTAFMLCLLGGFVADTFLGRYLTIGIFTTIQATGITILTIST  124

Query  471  KLPQLRPSPCNPHQ-ACQEANGFQM  542
             +P LRP  C     +C  ANG Q+
Sbjct  125  VVPGLRPPKCTAGSPSCIPANGKQL  149



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DY+G PA +S TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +AN+
Sbjct  19   DAWDYRGRPAARSTTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP  C   
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACTAE  138

Query  510  QA----CQEANGFQM  542
             A    C  A+G Q+
Sbjct  139  GAGIGTCTRASGGQL  153



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = +3

Query  99   VELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLV  278
            ++LP  + + K    + DA DYKG PA KS +GGW  +A+ILG+E VERL T+GIAVNLV
Sbjct  1    MDLPQTQQDTK---AIPDAWDYKGRPALKSLSGGWASSAMILGVEAVERLVTLGIAVNLV  57

Query  279  TYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSL  458
             YL  TMHL ++ +ANIV++FMGTS++L LLGG++AD+F+GR+ TI IF+ VQ +G   L
Sbjct  58   VYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIADTFIGRYLTIGIFATVQAIGVTIL  117

Query  459  ALATKLPQLRPSPCN-PHQACQEANGFQM  542
             ++T +P LRP  C      C  A+G Q+
Sbjct  118  TISTIIPSLRPPKCELGSSTCIPASGEQL  146



>gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA++S TGGW  AA+ILG E VERL+T+GI VNLVTY+  TMHL ++T+AN 
Sbjct  13   DAWDYKGRPAERSITGGWTSAAMILGGEAVERLTTLGIVVNLVTYMTDTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
             ++F+GT+F+LCLLGGF+AD+FLGR+ TIAIF+ VQ +G   L ++T LP LRP  C  +
Sbjct  73   TTNFLGTTFMLCLLGGFVADTFLGRYLTIAIFATVQAMGITILTISTALPSLRPPKCENN  132

Query  510  QACQEANGFQM  542
              C  A+G Q+
Sbjct  133  TGCIPASGKQL  143



>ref|XP_008658424.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46299.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
 tpg|DAA46300.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
Length=595

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++++AN 
Sbjct  17   DAWDYKGRPASRATTGGWACAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNASAANT  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C   
Sbjct  77   VTNFIGASFMLCLLGGFVADTYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPACADA  136

Query  510  QA----CQEANGFQ  539
            +     C  ANG Q
Sbjct  137  KGASPDCVPANGTQ  150



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++++GGW  AA+IL +E+ ERL+T+GI VNLVTYL GTMHL ++ +AN 
Sbjct  16   DAWDYKGRPAIQARSGGWTSAAMILVVELNERLTTLGIGVNLVTYLTGTMHLGNAAAANA  75

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+AD+FLGR++TIAIF+AVQ  G   L ++T  P+LRP  C   
Sbjct  76   VTNFMGTSFMLCLLGGFIADTFLGRYRTIAIFTAVQAAGVTILTISTAAPELRPPACADA  135

Query  510  QA--C-QEANGFQM  542
             +  C  EA+  QM
Sbjct  136  ASGDCGNEASAVQM  149



>ref|XP_006662041.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=589

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 7/149 (5%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  5    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  61

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIA+F+AVQ  G   L +
Sbjct  62   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFIADTYLGRYLTIAVFAAVQATGVMILTI  121

Query  465  ATKLPQLRPSPCNPHQA----CQEANGFQ  539
            +T  P LRP  C+  +     C  ANG Q
Sbjct  122  STAAPGLRPPACSDPKGESADCVVANGTQ  150



>gb|EEC67416.1| hypothetical protein OsI_34598 [Oryza sativa Indica Group]
Length=568

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  15   DAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NP  506
            V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L ++T  P LRP  C +P
Sbjct  75   VTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDP  134

Query  507  HQA---CQEANGFQ  539
              A   C  A+G Q
Sbjct  135  KGASAECVAADGTQ  148



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DY+G PA +S TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +AN+
Sbjct  19   DAWDYRGRPAARSTTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP  C   
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACTAE  138

Query  510  QA----CQEANGFQM  542
                  C  A+G Q+
Sbjct  139  GGGIGTCSRASGAQL  153



>gb|EAZ16929.1| hypothetical protein OsJ_32411 [Oryza sativa Japonica Group]
Length=574

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  15   DAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NP  506
            V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L ++T  P LRP  C +P
Sbjct  75   VTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDP  134

Query  507  HQA---CQEANGFQ  539
              A   C  A+G Q
Sbjct  135  KGASAECVAADGTQ  148



>gb|ABB47972.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=596

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  17   DAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NP  506
            V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L ++T  P LRP  C +P
Sbjct  77   VTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDP  136

Query  507  HQA---CQEANGFQ  539
              A   C  A+G Q
Sbjct  137  KGASAECVAADGTQ  150



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 113/164 (69%), Gaps = 14/164 (9%)
 Frame = +3

Query  72   FYQLENLFTVELPLKEMERKMSWTVADAVDYKGFPADKSKTGG-WVPAALILG-----IE  233
            F  L+NL  + LP  +       T+ DA +++G PA +SKTGG +V     L      IE
Sbjct  39   FLFLQNLSDMSLPETQD------TLLDAWNFQGQPAVRSKTGGVYVYRVFFLKREFSCIE  92

Query  234  IVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKT  413
             VERL+T+GI VNLVTYL GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ T
Sbjct  93   AVERLTTLGIGVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTFLGRYLT  152

Query  414  IAIFSAVQMLGTGSLALATKLPQLRPSPCNP--HQACQEANGFQ  539
            IA+F+AVQ  G   L L+T +P LRP  C+P    +C++A+G Q
Sbjct  153  IAVFAAVQATGVTILTLSTIIPGLRPPKCDPTSSNSCEQASGVQ  196



>gb|AAK15441.1|AC037426_3 putative nitrate transporter [Oryza sativa Japonica Group]
Length=594

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 4/134 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  15   DAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NP  506
            V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L ++T  P LRP  C +P
Sbjct  75   VTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDP  134

Query  507  HQA---CQEANGFQ  539
              A   C  A+G Q
Sbjct  135  KGASAECVAADGTQ  148



>ref|XP_003572060.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=601

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 98/137 (72%), Gaps = 4/137 (3%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+I G E+ ER++T+GIAVNLV Y+  TMHL S+ +A
Sbjct  23   LTDAWDYKGRPASRAATGGWGCAAMICGAELFERMTTLGIAVNLVPYMTATMHLGSAAAA  82

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T  P LRP+ C 
Sbjct  83   NTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACG  142

Query  504  P----HQACQEANGFQM  542
                    C  ANG Q+
Sbjct  143  DATGQSSECVPANGTQL  159



>ref|XP_008658431.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46302.1| TPA: hypothetical protein ZEAMMB73_201644 [Zea mays]
Length=588

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ LG+E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  17   DAWDYKGRPASRATTGGWACAAMTLGVELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPH  509
            V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C   
Sbjct  77   VTNFIGASFMLCLLGGFVADTYLGRYLTIAIFTAVQATGVVILTISTAAPGLRPPACGAA  136

Query  510  Q-ACQEANGFQ  539
               C  AN  Q
Sbjct  137  SPNCVRANKTQ  147



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +3

Query  219  ILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFL  398
            ++GIE+ ERLSTMGIAVNLVTYL GTMHLPS+TSANIV+DFMGTSFLLCLLGGFLAD+FL
Sbjct  15   LVGIELCERLSTMGIAVNLVTYLVGTMHLPSATSANIVTDFMGTSFLLCLLGGFLADTFL  74

Query  399  GRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNP--HQACQEANGFQM  542
            GR+KTIAIF+AVQ LGTG LA+ TKL QLRP PC       C++A+GFQM
Sbjct  75   GRYKTIAIFAAVQTLGTGMLAMVTKLRQLRPRPCKETATHTCEQASGFQM  124



>ref|XP_004242006.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=592

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 106/147 (72%), Gaps = 4/147 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K+   + DA DYKG PA +S +GGW  AA+ILG+E VERL T+GIAVNLV Y
Sbjct  3    LPHTQQETKV---IPDAWDYKGRPALRSTSGGWAGAAMILGVEAVERLVTLGIAVNLVVY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L  TMHL ++++ANIV++FMGTS++L LLGG++AD+FLGR+ T+ I + VQ +G   L +
Sbjct  60   LTKTMHLGNASAANIVTNFMGTSYILTLLGGYVADTFLGRYLTVGIGATVQAIGVTILTI  119

Query  465  ATKLPQLRPSPCN-PHQACQEANGFQM  542
            +T +P LRP  C+    +C  A+G Q+
Sbjct  120  STIVPSLRPPKCDLGSPSCIPADGKQL  146



>ref|XP_006366745.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=592

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 105/147 (71%), Gaps = 4/147 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K+   V DA DYKG  A +S +GGW  AA+ILG+E VERL T+GIAVNLV Y
Sbjct  3    LPHTQQETKV---VPDAWDYKGRHALRSTSGGWAGAAMILGVEAVERLVTLGIAVNLVVY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L  TMHL ++++ANIV++FMGTS++L LLGG++AD+FLGR+ T+ I + VQ +G   L +
Sbjct  60   LTKTMHLGNASAANIVTNFMGTSYILTLLGGYVADTFLGRYLTVGIGATVQAIGVTILTI  119

Query  465  ATKLPQLRPSPCN-PHQACQEANGFQM  542
            +T +P L+P  CN    +C  ANG Q+
Sbjct  120  STIIPSLQPPKCNLGSPSCIPANGKQL  146



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA +S++GGW  AA+IL +E+ ER++T+GIAVNLVTY+  TMHL ++ +
Sbjct  13   TLSDAWDHKGRPAVQSRSGGWTSAAMILVVELNERMTTLGIAVNLVTYMTVTMHLGNAAA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++FMGTSF+L LLGGF+AD+FLGR+ TIAIF+AVQ  G   LA++T  P LRP PC
Sbjct  73   ANAVTNFMGTSFILSLLGGFIADTFLGRYVTIAIFAAVQASGVVILAISTVAPGLRPPPC  132

Query  501  NPHQA--CQEANGFQM  542
                +  C +A+G Q+
Sbjct  133  ADLASGGCAKASGVQL  148



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    +      + DA DY+G PA +S+TG W  AA+IL  E+ ERL+T+GIAVNLVTY
Sbjct  5    LPETNAQAAAEEVLGDAWDYRGRPAARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTY  64

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L  TMH  ++ +AN+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L +
Sbjct  65   LTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTI  124

Query  465  ATKLPQLRPSPCNPHQACQE-ANGFQM  542
            +T  P LRP+ C    A  E A G QM
Sbjct  125  STAAPGLRPAACAAGSAACERATGAQM  151



>gb|KJB64774.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=541

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  255  MGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAV  434
            MGIAVNLVTYLGGT+HLPSSTSAN+V+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIFS +
Sbjct  1    MGIAVNLVTYLGGTLHLPSSTSANVVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFSII  60

Query  435  QMLGTGSLALATKLPQLRPSPCNPHQACQEANGFQM  542
            Q LGTG+LALATKLPQLRP PC+    C++ANGFQM
Sbjct  61   QTLGTGTLALATKLPQLRPPPCHGSHTCKQANGFQM  96



>gb|KJB64773.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=517

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  255  MGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAV  434
            MGIAVNLVTYLGGT+HLPSSTSAN+V+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIFS +
Sbjct  1    MGIAVNLVTYLGGTLHLPSSTSANVVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFSII  60

Query  435  QMLGTGSLALATKLPQLRPSPCNPHQACQEANGFQM  542
            Q LGTG+LALATKLPQLRP PC+    C++ANGFQM
Sbjct  61   QTLGTGTLALATKLPQLRPPPCHGSHTCKQANGFQM  96



>ref|XP_002468692.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
 gb|EER95690.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
Length=605

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA +  +GGW  AA+IL +E+ ERL+T+G+ VNLVTYL  TMHL  + S
Sbjct  23   TMMDAWDYKGRPAVRGSSGGWSSAAMILVVELNERLTTLGVGVNLVTYLMDTMHLGGAAS  82

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC  500
            AN V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ +G   L ++T  P LRP  C
Sbjct  83   ANAVTNFLGASFMLCLLGGFVADTYLGRYLTIAIFTAVQAVGMCVLTVSTAAPGLRPPAC  142

Query  501  ----NPHQACQEANGFQM  542
                 P+  C E +G Q+
Sbjct  143  ADPTGPNH-CVEPSGTQL  159



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +3

Query  225  GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGR  404
            GIEI ERLSTMGIAVNLVTYLGG MHLPS TSANIV+DFMGT FLLCLLGGFLADSFLGR
Sbjct  1    GIEICERLSTMGIAVNLVTYLGGVMHLPSFTSANIVTDFMGTCFLLCLLGGFLADSFLGR  60

Query  405  FKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQA-CQEANGFQM  542
            + TIAIF+AVQ+LGT +L+L TKLP LRP PC    A C++A GFQM
Sbjct  61   YTTIAIFTAVQILGTAALSLTTKLPHLRPPPCAAGAADCRQATGFQM  107



>gb|EAZ41557.1| hypothetical protein OsJ_26080 [Oryza sativa Japonica Group]
Length=634

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    +      + DA DY+G PA +S+TG W  AA+IL  E+ ERL+T+GIAVNLVTY
Sbjct  5    LPETNAQAAAEEVLGDAWDYRGRPAARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTY  64

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLAL  464
            L  TMH  ++ +AN+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L +
Sbjct  65   LTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQAPGVTILTI  124

Query  465  ATKLPQLRPSPCNPHQACQE-ANGFQM  542
            +T  P LRP+ C    A  E A G QM
Sbjct  125  STAAPGLRPAACAAGSAACERATGAQM  151



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +3

Query  183  KSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLL  362
            K   GGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SAN+V++F+GTSF+L
Sbjct  14   KQVAGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFML  73

Query  363  CLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQA--CQEANGF  536
            CLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN      C  AN  
Sbjct  74   CLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEK  133

Query  537  QM  542
            Q+
Sbjct  134  QL  135



>ref|XP_003574312.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=599

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D KG PA ++ TGGW  AA+I G E+ ER++T+GIAVNLV Y+  TMHL S+ +AN 
Sbjct  21   DAWDSKGRPAARASTGGWGCAAMICGAELFERMTTLGIAVNLVPYMTSTMHLGSAAAANT  80

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNP-  506
            V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T  P LRP+ C   
Sbjct  81   VTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACGDA  140

Query  507  ---HQACQEANGFQM  542
                  C  ANG Q+
Sbjct  141  TGQSSECVPANGTQL  155



>ref|XP_011005904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4-like isoform X2 [Populus 
euphratica]
Length=589

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
            AVD++G P DKS+TGGW+ A LIL  E+ ER+  MGI++NLVTYL G +H+ S+ SAN+V
Sbjct  18   AVDFRGIPVDKSRTGGWLAAGLILVTELSERICVMGISMNLVTYLVGVLHISSAKSANMV  77

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPCNPHQ  512
            ++FMGT  LL L GGFLAD+ LGR+ T+AIF+ V  LG   L +AT +P +RP PC+ ++
Sbjct  78   TNFMGTLNLLGLFGGFLADAKLGRYLTVAIFAIVTALGVSLLTVATTIPSMRPPPCDDYR  137

Query  513  A----CQEANGFQM  542
                 C E  G Q+
Sbjct  138  KQNHQCIEVKGNQL  151



>ref|XP_003575234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Brachypodium distachyon]
Length=598

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 1/126 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DAVD++G P DKSKTGGW+ A LILG E+ ER+  MGI++NLVTYL G +HL ++ SANI
Sbjct  13   DAVDFRGNPVDKSKTGGWLGAGLILGTELAERVCVMGISMNLVTYLVGELHLSNAKSANI  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMLGTGSLALATKLPQLRPSPC-NP  506
            V++FMGT  LL ++GGFLAD+ LGR+ TIAI + +  LG   L + T +P +RP PC +P
Sbjct  73   VTNFMGTLNLLAIVGGFLADAKLGRYLTIAISATIAALGVSLLTVDTTVPGMRPPPCGDP  132

Query  507  HQACQE  524
             Q+ Q+
Sbjct  133  RQSTQQ  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690