BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF030C23

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like             87.4    5e-17   Nicotiana tomentosiformis
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like             87.4    5e-17   Nicotiana tomentosiformis
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like             84.0    1e-15   Nicotiana sylvestris
ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like             76.6    2e-14   Nicotiana tomentosiformis
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like             77.4    3e-14   Nicotiana sylvestris
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like             79.3    4e-14   Nicotiana tomentosiformis
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like             79.3    5e-14   
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like             79.0    6e-14   Solanum tuberosum [potatoes]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like             79.0    7e-14   Solanum tuberosum [potatoes]
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like             76.3    3e-13   Nicotiana tomentosiformis
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like             73.6    8e-13   Nicotiana tomentosiformis
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like             75.1    1e-12   Nicotiana sylvestris
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like             72.8    2e-12   Solanum lycopersicum
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like             73.6    3e-12   
ref|XP_009778171.1|  PREDICTED: cytochrome P450 86B1-like             71.2    4e-12   Nicotiana sylvestris
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like             72.4    6e-12   Solanum lycopersicum
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like             71.6    9e-12   Solanum tuberosum [potatoes]
emb|CDX79038.1|  BnaA01g11050D                                        72.0    2e-11   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like             72.0    2e-11   Brassica rapa
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like             71.2    2e-11   Populus euphratica
emb|CDP18605.1|  unnamed protein product                              70.9    2e-11   Coffea canephora [robusta coffee]
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like             71.2    3e-11   Solanum lycopersicum
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like             70.9    4e-11   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like             67.0    4e-11   Elaeis guineensis
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg           68.2    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg           68.2    4e-11   Eutrema salsugineum [saltwater cress]
emb|CDX82804.1|  BnaC01g12540D                                        70.5    4e-11   
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg              70.1    6e-11   Erythranthe guttata [common monkey flower]
ref|XP_006374652.1|  cytochrome P450 family protein                   69.7    9e-11   
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like             69.3    1e-10   Nicotiana tomentosiformis
ref|XP_002869292.1|  CYP96A2                                          68.9    1e-10   Arabidopsis lyrata subsp. lyrata
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like             67.8    4e-10   Sesamum indicum [beniseed]
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944           63.2    4e-10   
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like             67.4    5e-10   Nelumbo nucifera [Indian lotus]
emb|CDP12889.1|  unnamed protein product                              67.4    6e-10   Coffea canephora [robusta coffee]
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like             67.0    8e-10   Sesamum indicum [beniseed]
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like             66.6    8e-10   Solanum lycopersicum
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg           66.6    8e-10   Capsella rubella
gb|KFK22185.1|  hypothetical protein AALP_AAs38949U000100             67.4    9e-10   Arabis alpina [alpine rockcress]
dbj|BAF46296.1|  cytochrome P450                                      63.9    9e-10   Ipomoea nil [qian niu]
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like             66.2    1e-09   Camelina sativa [gold-of-pleasure]
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg              66.2    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                  66.2    1e-09   Vitis vinifera
emb|CDY13727.1|  BnaA06g31960D                                        65.9    2e-09   Brassica napus [oilseed rape]
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like             65.9    2e-09   Brassica rapa
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...  65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94304.1|  cytochrome p450 - like protein                       65.5    2e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ25521.1|  hypothetical protein OsJ_09345                        63.2    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg              63.9    3e-09   Erythranthe guttata [common monkey flower]
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...  65.1    3e-09
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like             62.4    3e-09   Populus euphratica
gb|EEC74485.1|  hypothetical protein OsI_09945                        62.8    3e-09   Oryza sativa Indica Group [Indian rice]
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                  62.0    4e-09   Arabis alpina [alpine rockcress]
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like             62.8    4e-09   Sesamum indicum [beniseed]
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg           64.7    4e-09   Capsella rubella
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                  64.7    4e-09   Camelina sativa [gold-of-pleasure]
emb|CDY13726.1|  BnaA06g31970D                                        62.4    4e-09   Brassica napus [oilseed rape]
gb|ABF93891.1|  Cytochrome P450 family protein                        63.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like             64.7    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like             64.3    5e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like             64.3    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg           64.3    6e-09   Capsella rubella
ref|XP_010474125.1|  PREDICTED: cytochrome P450 86A8-like             63.2    6e-09   
ref|XP_010418988.1|  PREDICTED: cytochrome P450 86B1-like             63.9    7e-09   Camelina sativa [gold-of-pleasure]
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like             63.9    7e-09   Nicotiana sylvestris
emb|CDX72693.1|  BnaC07g47150D                                        63.5    8e-09   
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...  63.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like             63.5    9e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010275494.1|  PREDICTED: cytochrome P450 86B1-like             63.5    9e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like             60.8    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like             63.5    1e-08   Nicotiana sylvestris
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like             59.7    1e-08   Phoenix dactylifera
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg           63.2    1e-08   
ref|XP_002894062.1|  CYP96A8                                          63.2    1e-08   Arabidopsis lyrata subsp. lyrata
emb|CDY53178.1|  BnaA06g40570D                                        62.8    2e-08   Brassica napus [oilseed rape]
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg           62.4    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g           60.5    2e-08   
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                  62.4    3e-08   Brassica rapa
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like             62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like             62.0    3e-08   Nicotiana tomentosiformis
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like             62.0    3e-08   Solanum lycopersicum
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like             62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg           62.0    3e-08   Capsella rubella
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                  62.0    3e-08   
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like             61.6    4e-08   Sesamum indicum [beniseed]
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like             61.6    4e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  61.6    4e-08   
gb|EPS60789.1|  hypothetical protein M569_14012                       57.4    4e-08   Genlisea aurea
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433           61.6    4e-08   
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  61.6    5e-08   Brassica rapa
emb|CAN80536.1|  hypothetical protein VITISV_035975                   61.2    5e-08   Vitis vinifera
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                  61.2    6e-08   Vitis vinifera
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg              60.8    7e-08   Erythranthe guttata [common monkey flower]
gb|EYU43136.1|  hypothetical protein MIMGU_mgv1a007195mg              60.1    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like             58.5    1e-07   
ref|XP_002868909.1|  CYP96A12                                         60.5    1e-07   
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  60.1    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like             59.3    1e-07   Solanum tuberosum [potatoes]
gb|EPS57870.1|  hypothetical protein M569_16947                       60.1    1e-07   Genlisea aurea
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                  58.5    2e-07   Solanum lycopersicum
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg           59.7    2e-07   Capsella rubella
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...  59.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53179.1|  BnaA06g40580D                                        59.7    2e-07   Brassica napus [oilseed rape]
gb|EPS67771.1|  hypothetical protein M569_06997                       59.3    2e-07   Genlisea aurea
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg              59.7    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like             59.3    2e-07   Nicotiana sylvestris
ref|XP_002866852.1|  CYP96A9                                          59.3    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like             58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...  58.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg           58.9    4e-07   Eutrema salsugineum [saltwater cress]
gb|KHN27468.1|  Cytochrome P450 86B1                                  53.5    4e-07   Glycine soja [wild soybean]
gb|KDP35257.1|  hypothetical protein JCGZ_09416                       58.5    4e-07   Jatropha curcas
gb|EMS45869.1|  Cytochrome P450 86B1                                  58.5    4e-07   Triticum urartu
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like             53.5    4e-07   Glycine max [soybeans]
ref|XP_010442700.1|  PREDICTED: cytochrome P450 86B1-like             58.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like             53.1    4e-07   Glycine max [soybeans]
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg           58.5    5e-07   Capsella rubella
ref|XP_002894061.1|  CYP96A8                                          58.2    5e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                  58.2    5e-07   Brassica rapa
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg           58.2    6e-07   Eutrema salsugineum [saltwater cress]
gb|KEH40921.1|  cytochrome P450 family protein                        55.8    6e-07   Medicago truncatula
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                  57.8    6e-07   Arabis alpina [alpine rockcress]
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg           58.2    6e-07   Capsella rubella
gb|KHN27469.1|  Cytochrome P450 86B1                                  52.4    6e-07   Glycine soja [wild soybean]
ref|XP_002521474.1|  cytochrome P450, putative                        58.2    7e-07   Ricinus communis
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like             57.8    7e-07   Camelina sativa [gold-of-pleasure]
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like             54.3    7e-07   Glycine max [soybeans]
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like             57.8    7e-07   Nicotiana tomentosiformis
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg              57.8    7e-07   Erythranthe guttata [common monkey flower]
ref|XP_011092582.1|  PREDICTED: cytochrome P450 86A8-like             51.6    7e-07   Sesamum indicum [beniseed]
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                  55.5    8e-07   Arabis alpina [alpine rockcress]
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like             54.7    8e-07   Brassica rapa
gb|KHN27470.1|  Cytochrome P450 86B1                                  54.3    8e-07   Glycine soja [wild soybean]
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like             53.5    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                  57.4    9e-07   Brassica rapa
emb|CDY53181.1|  BnaA06g40600D                                        57.4    1e-06   Brassica napus [oilseed rape]
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like             57.4    1e-06   Camelina sativa [gold-of-pleasure]
emb|CDX72695.1|  BnaC07g47170D                                        57.4    1e-06   
ref|XP_010270999.1|  PREDICTED: cytochrome P450 86B1-like             54.7    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_002866853.1|  CYP96A10                                         57.4    1e-06   Arabidopsis lyrata subsp. lyrata
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                  57.4    1e-06   Arabis alpina [alpine rockcress]
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like             57.0    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007052012.1|  Cytochrome P450 family protein                   57.0    1e-06   
gb|KEH21495.1|  cytochrome P450 family 94 protein                     57.0    1e-06   Medicago truncatula
gb|EYU41727.1|  hypothetical protein MIMGU_mgv1a023193mg              56.6    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_003533692.1|  PREDICTED: cytochrome P450 86B1-like             51.6    1e-06   Glycine max [soybeans]
ref|XP_007052011.1|  Cytochrome P450 family protein isoform 3         56.6    2e-06   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like             56.6    2e-06   Brassica rapa
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like             50.8    2e-06   Setaria italica
ref|XP_006282428.1|  hypothetical protein CARUB_v100285721mg          55.1    2e-06   
dbj|BAK06287.1|  predicted protein                                    49.7    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH24774.1|  cytochrome P450 family protein                        54.7    2e-06   Medicago truncatula
ref|XP_007031595.1|  Cytochrome P450, putative                        52.4    2e-06   
ref|XP_002320802.1|  cytochrome P450 family protein                   51.6    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like             53.1    2e-06   Glycine max [soybeans]
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...  56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g           56.2    2e-06   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg              55.5    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like             55.5    2e-06   Glycine max [soybeans]
gb|KHN19678.1|  Cytochrome P450 86B1                                  55.5    2e-06   Glycine soja [wild soybean]
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g           52.4    2e-06   Phaseolus vulgaris [French bean]
ref|XP_007052009.1|  Cytochrome P450 family protein isoform 1         56.2    2e-06   
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like             56.2    3e-06   Populus euphratica
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like             52.4    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB44684.1|  cytochrome P450-like protein                         56.2    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                  56.2    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  55.8    3e-06   
gb|EAY88476.1|  hypothetical protein OsI_09947                        55.8    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3  55.8    3e-06   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like             55.8    3e-06   Camelina sativa [gold-of-pleasure]
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg              54.3    3e-06   Erythranthe guttata [common monkey flower]
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100             55.8    3e-06   Arabis alpina [alpine rockcress]
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g           55.8    3e-06   Populus trichocarpa [western balsam poplar]
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...  55.8    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  55.8    3e-06   
ref|XP_004158225.1|  PREDICTED: cytochrome P450 86B1-like             48.9    3e-06   
ref|XP_004135954.1|  PREDICTED: cytochrome P450 86B1-like             48.9    3e-06   
gb|KDP35260.1|  hypothetical protein JCGZ_09419                       55.8    3e-06   Jatropha curcas
ref|NP_001048917.1|  Os03g0140100                                     55.8    4e-06   
gb|KCW78253.1|  hypothetical protein EUGRSUZ_D02440                   55.5    4e-06   Eucalyptus grandis [rose gum]
gb|KHN29577.1|  Cytochrome P450 86B1                                  51.2    4e-06   Glycine soja [wild soybean]
gb|AJD25225.1|  cytochrome P450 CYP96A85                              55.5    4e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010474120.1|  PREDICTED: cytochrome P450 86B1-like             55.8    4e-06   
ref|XP_006379954.1|  cytochrome P450 family protein                   55.5    4e-06   
emb|CDP12888.1|  unnamed protein product                              55.5    4e-06   Coffea canephora [robusta coffee]
gb|KHM99063.1|  Cytochrome P450 86B1                                  55.5    4e-06   Glycine soja [wild soybean]
ref|XP_003556602.2|  PREDICTED: cytochrome P450 86B1-like             55.5    4e-06   Glycine max [soybeans]
ref|XP_010431922.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  54.7    4e-06   
emb|CDP11007.1|  unnamed protein product                              50.4    4e-06   Coffea canephora [robusta coffee]
gb|AEI59774.1|  cytochrome P450                                       52.8    4e-06   Helianthus annuus
gb|KFK44487.1|  hypothetical protein AALP_AA1G263300                  45.8    5e-06   Arabis alpina [alpine rockcress]
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like             55.5    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like             55.5    5e-06   Camelina sativa [gold-of-pleasure]
gb|KEH24775.1|  cytochrome P450 family protein                        53.5    5e-06   Medicago truncatula
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like             55.1    5e-06   Tarenaya hassleriana [spider flower]
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg           55.1    5e-06   
ref|XP_010054891.1|  PREDICTED: cytochrome P450 704C1-like            55.1    5e-06   
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like             50.1    5e-06   Populus euphratica
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like             55.1    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like             55.1    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010666951.1|  PREDICTED: cytochrome P450 86B1-like             55.1    6e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002865881.1|  hypothetical protein ARALYDRAFT_331566           55.1    6e-06   
emb|CDX76867.1|  BnaC08g34530D                                        55.1    6e-06   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522           55.1    6e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_006430501.1|  hypothetical protein CICLE_v10011533mg           55.1    6e-06   Citrus clementina [clementine]
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like             54.7    7e-06   
gb|EYU32135.1|  hypothetical protein MIMGU_mgv1a003916mg              48.9    7e-06   Erythranthe guttata [common monkey flower]
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like             54.7    7e-06   Populus euphratica
ref|XP_010431920.1|  PREDICTED: cytochrome P450 86B1-like             54.7    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg           54.7    7e-06   Capsella rubella
ref|XP_002529227.1|  cytochrome P450, putative                        54.7    7e-06   Ricinus communis
gb|EMT05588.1|  Cytochrome P450 86A2                                  54.7    7e-06   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like             54.7    8e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006482030.1|  PREDICTED: cytochrome P450 94A1-like             54.7    8e-06   Citrus sinensis [apfelsine]
dbj|BAJ86572.1|  predicted protein                                    54.7    8e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX72690.1|  BnaC07g47120D                                        54.7    8e-06   
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                  54.7    9e-06   Arabis alpina [alpine rockcress]
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g           50.8    9e-06   Phaseolus vulgaris [French bean]
gb|KHN19680.1|  Cytochrome P450 86B1                                  50.1    9e-06   Glycine soja [wild soybean]
ref|XP_010682470.1|  PREDICTED: cytochrome P450 86B1-like             50.4    9e-06   
gb|EMT10522.1|  Cytochrome P450 86A1                                  54.3    9e-06   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg           54.3    9e-06   Capsella rubella
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like             51.6    9e-06   
gb|AJD25224.1|  cytochrome P450 CYP96A84                              54.3    9e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg           54.3    9e-06   Capsella rubella
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg           54.3    9e-06   Eutrema salsugineum [saltwater cress]
ref|XP_002523775.1|  cytochrome P450, putative                        53.1    1e-05   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg           54.3    1e-05   Capsella rubella
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                  54.3    1e-05   Arabis alpina [alpine rockcress]
ref|XP_009613728.1|  PREDICTED: cytochrome P450 704C1-like            53.1    1e-05   Nicotiana tomentosiformis
ref|XP_001782495.1|  predicted protein                                46.2    1e-05   
gb|KDO82148.1|  hypothetical protein CISIN_1g041858mg                 54.3    1e-05   Citrus sinensis [apfelsine]
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1       53.9    1e-05   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100             53.9    1e-05   Arabis alpina [alpine rockcress]
gb|EPS72790.1|  hypothetical protein M569_01963                       53.9    1e-05   Genlisea aurea
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg           50.4    1e-05   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like             50.1    1e-05   Glycine max [soybeans]
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like             49.3    1e-05   Brachypodium distachyon [annual false brome]
emb|CDY42628.1|  BnaC01g00400D                                        53.9    1e-05   Brassica napus [oilseed rape]
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like             49.7    1e-05   Setaria italica
ref|XP_003538960.2|  PREDICTED: cytochrome P450 86B1-like             49.3    2e-05   Glycine max [soybeans]
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g           50.8    2e-05   Phaseolus vulgaris [French bean]
ref|XP_007052008.1|  Cytochrome P450 family protein                   53.5    2e-05   
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   Nicotiana sylvestris
emb|CBH32607.1|  cytochrome P450, putative, expressed                 52.8    2e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011034022.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   Populus euphratica
ref|XP_008461361.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  48.9    2e-05   Cucumis melo [Oriental melon]
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   Camelina sativa [gold-of-pleasure]
gb|EYU23445.1|  hypothetical protein MIMGU_mgv1a026937mg              53.5    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like             51.2    2e-05   Cicer arietinum [garbanzo]
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   Phoenix dactylifera
ref|XP_006661879.1|  PREDICTED: cytochrome P450 86B1-like             48.9    2e-05   Oryza brachyantha
gb|KCW78249.1|  hypothetical protein EUGRSUZ_D02437                   53.1    2e-05   Eucalyptus grandis [rose gum]
gb|KDP28614.1|  hypothetical protein JCGZ_14385                       51.2    2e-05   Jatropha curcas
ref|XP_002878665.1|  CYP96A1                                          53.5    2e-05   
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like             53.5    2e-05   
ref|XP_006301190.1|  hypothetical protein CARUB_v10021589mg           53.1    2e-05   
ref|NP_176086.1|  alkane hydroxylase CYP96A15                         53.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...  53.1    2e-05   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like             53.1    2e-05   
ref|NP_001117509.1|  alkane hydroxylase CYP96A15                      53.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010041418.1|  PREDICTED: cytochrome P450 704C1-like            53.1    2e-05   
ref|XP_010275501.1|  PREDICTED: cytochrome P450 86B1-like             53.1    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g           48.1    2e-05   Phaseolus vulgaris [French bean]
ref|XP_011100143.1|  PREDICTED: cytochrome P450 86B1-like             49.7    2e-05   Sesamum indicum [beniseed]
ref|XP_010111215.1|  Cytochrome P450 94A2                             53.1    2e-05   Morus notabilis
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like             50.8    2e-05   
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like             53.1    3e-05   
ref|XP_010513569.1|  PREDICTED: cytochrome P450 86A2-like             52.8    3e-05   
gb|KCW44361.1|  hypothetical protein EUGRSUZ_L02168                   53.1    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010054890.1|  PREDICTED: cytochrome P450 704C1-like            53.1    3e-05   Eucalyptus grandis [rose gum]
gb|KGN48434.1|  hypothetical protein Csa_6G487550                     53.1    3e-05   Cucumis sativus [cucumbers]
gb|AGV40485.1|  hypothetical protein                                  53.1    3e-05   Phaseolus vulgaris [French bean]
gb|KDP26701.1|  hypothetical protein JCGZ_17859                       53.1    3e-05   Jatropha curcas
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like             53.1    3e-05   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like             53.1    3e-05   Brassica rapa
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like             52.8    3e-05   
gb|KHG09498.1|  Cytochrome P450 protein                               50.8    3e-05   Gossypium arboreum [tree cotton]
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g           47.8    3e-05   
gb|KHN32292.1|  Cytochrome P450 86B1                                  49.3    3e-05   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like             52.8    3e-05   
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg           52.8    3e-05   
ref|XP_010042417.1|  PREDICTED: cytochrome P450 704C1-like            52.8    3e-05   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg           52.8    4e-05   
ref|XP_010054889.1|  PREDICTED: cytochrome P450 704C1-like            52.8    4e-05   
ref|XP_003607255.1|  Cytochrome P450                                  52.8    4e-05   
ref|XP_002509820.1|  cytochrome P450, putative                        48.9    4e-05   
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                  52.8    4e-05   
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A7                  46.2    4e-05   
gb|KCW78247.1|  hypothetical protein EUGRSUZ_D02436                   52.4    4e-05   
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                  52.0    4e-05   
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                  52.4    4e-05   
ref|XP_002986290.1|  fatty acid omega-hydroxylase                     50.4    4e-05   
ref|XP_002278009.1|  PREDICTED: cytochrome P450 94A1                  52.4    4e-05   
ref|XP_002988762.1|  hypothetical protein SELMODRAFT_128482           50.4    5e-05   
ref|XP_010089087.1|  Cytochrome P450 86A2                             50.8    5e-05   
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg           49.7    5e-05   
ref|XP_006438203.1|  hypothetical protein CICLE_v10033706mg           52.4    5e-05   
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg              52.0    5e-05   
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like             51.2    5e-05   
ref|XP_007040281.1|  Cytochrome P450, family 86, subfamily A, pol...  49.7    5e-05   
gb|EMT29854.1|  Cytochrome P450 86A2                                  47.4    5e-05   
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like             47.8    6e-05   
ref|XP_006583288.1|  PREDICTED: cytochrome P450 86A8-like             48.1    6e-05   
ref|XP_009389623.1|  PREDICTED: cytochrome P450 704C1-like            52.0    6e-05   
ref|XP_010247229.1|  PREDICTED: cytochrome P450 94B3-like             52.0    6e-05   
gb|AIE57505.1|  MAH1                                                  50.4    7e-05   
ref|XP_006348044.1|  PREDICTED: cytochrome P450 704C1-like            52.0    7e-05   
gb|KJB77357.1|  hypothetical protein B456_012G133700                  49.7    7e-05   
gb|KJB41141.1|  hypothetical protein B456_007G092700                  51.6    7e-05   
ref|XP_010556203.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  49.7    7e-05   
ref|XP_010247228.1|  PREDICTED: cytochrome P450 94B3-like             49.3    7e-05   
ref|XP_002873349.1|  predicted protein                                51.6    7e-05   
gb|KCW78251.1|  hypothetical protein EUGRSUZ_D02439                   51.6    7e-05   
ref|XP_007135090.1|  hypothetical protein PHAVU_010G099900g           47.8    7e-05   
gb|AHH81835.1|  putative cytochrome P450                              51.6    7e-05   
ref|XP_007152374.1|  hypothetical protein PHAVU_004G124700g           51.6    7e-05   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g           47.8    7e-05   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859           48.5    8e-05   
gb|KJB52139.1|  hypothetical protein B456_008G247600                  51.6    8e-05   
gb|KCW78252.1|  hypothetical protein EUGRSUZ_D02439                   51.6    8e-05   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                  51.6    8e-05   
ref|XP_007019555.1|  Cytochrome P450                                  51.6    8e-05   
ref|XP_010425287.1|  PREDICTED: cytochrome P450 86B1-like             45.4    8e-05   
gb|AAL59025.1|AC087182_8  putative cytochrome P450 protein            45.8    9e-05   
ref|NP_001064901.2|  Os10g0486100                                     45.8    9e-05   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like             51.6    9e-05   
emb|CDY53177.1|  BnaA06g40560D                                        51.6    9e-05   
ref|XP_010544373.1|  PREDICTED: cytochrome P450 704C1-like isofor...  51.2    9e-05   
gb|KJB41140.1|  hypothetical protein B456_007G092700                  51.2    1e-04   
gb|KJB41137.1|  hypothetical protein B456_007G092700                  51.2    1e-04   
ref|XP_010053880.1|  PREDICTED: cytochrome P450 704C1-like            51.2    1e-04   
ref|XP_009776441.1|  PREDICTED: cytochrome P450 704C1-like isofor...  51.2    1e-04   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like             51.2    1e-04   
emb|CAN80156.1|  hypothetical protein VITISV_023926                   47.0    1e-04   
ref|XP_010274329.1|  PREDICTED: cytochrome P450 86B1-like             48.5    1e-04   
ref|XP_002511875.1|  cytochrome P450, putative                        46.6    1e-04   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like             51.2    1e-04   
ref|XP_007044873.1|  Cytochrome P450 86A2                             51.2    1e-04   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg              51.2    1e-04   
ref|XP_010681240.1|  PREDICTED: cytochrome P450 86A7-like             50.8    1e-04   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g           51.2    1e-04   
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like             50.8    1e-04   
gb|KGN48432.1|  hypothetical protein Csa_6G487530                     51.2    1e-04   
gb|KDP46409.1|  hypothetical protein JCGZ_10249                       50.8    1e-04   
emb|CDY46088.1|  BnaA09g42120D                                        51.2    1e-04   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630        50.8    1e-04   
gb|EMS50674.1|  Cytochrome P450 86B1                                  42.7    1e-04   
ref|NP_197710.1|  cytochrome P450 86B1                                50.8    1e-04   
gb|KJB73314.1|  hypothetical protein B456_011G227100                  50.8    1e-04   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein          46.6    1e-04   
ref|XP_009526595.1|  hypothetical protein PHYSODRAFT_499752           48.5    1e-04   
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like             50.8    1e-04   
ref|XP_002275115.1|  PREDICTED: cytochrome P450 86A8                  46.6    1e-04   
gb|AJD25207.1|  cytochrome P450 CYP86A91                              50.8    1e-04   
ref|XP_006339781.1|  PREDICTED: cytochrome P450 704C1-like            50.8    1e-04   
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like             48.5    1e-04   
ref|XP_006286797.1|  hypothetical protein CARUB_v10003490mg           50.8    1e-04   
ref|XP_002304502.2|  cytochrome P450 family protein                   47.0    1e-04   
gb|KJB41354.1|  hypothetical protein B456_007G100300                  50.8    2e-04   
ref|XP_003574090.1|  PREDICTED: cytochrome P450 86B1-like             46.6    2e-04   
ref|XP_002464461.1|  hypothetical protein SORBIDRAFT_01g018855        46.6    2e-04   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                  50.4    2e-04   
gb|EYU25023.1|  hypothetical protein MIMGU_mgv1a004800mg              50.8    2e-04   
ref|XP_009389611.1|  PREDICTED: cytochrome P450 704C1-like            50.4    2e-04   
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like             50.4    2e-04   
gb|ABE66239.1|  cytochrome P450 family                                48.9    2e-04   
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  50.4    2e-04   
gb|KJB44293.1|  hypothetical protein B456_007G244800                  50.4    2e-04   
emb|CBH32604.1|  cytochrome P450, putative, expressed                 50.4    2e-04   
ref|XP_010502523.1|  PREDICTED: cytochrome P450 86B1-like             43.9    2e-04   
ref|XP_006303857.1|  hypothetical protein CARUB_v10012597mg           50.4    2e-04   
ref|XP_002306380.1|  hypothetical protein POPTR_0005s09500g           50.4    2e-04   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like             47.4    2e-04   
ref|XP_009130123.1|  PREDICTED: cytochrome P450 86B1-like             50.4    2e-04   
ref|XP_002874114.1|  CYP86B1                                          50.4    2e-04   
ref|XP_006445219.1|  hypothetical protein CICLE_v10019805mg           50.4    2e-04   
ref|XP_007051775.1|  Cytochrome P450, family 86, subfamily A, pol...  48.9    2e-04   
ref|XP_006445218.1|  hypothetical protein CICLE_v10019805mg           50.1    2e-04   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like             50.4    2e-04   
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...  47.8    2e-04   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg           47.4    2e-04   
ref|XP_011088865.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  50.4    2e-04   
gb|KJB31090.1|  hypothetical protein B456_005G175500                  50.4    2e-04   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like             46.6    2e-04   
ref|XP_002310074.1|  hypothetical protein POPTR_0007s07700g           50.4    2e-04   
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                  47.4    2e-04   
ref|XP_010905515.1|  PREDICTED: cytochrome P450 86B1-like             48.9    2e-04   
ref|XP_002878579.1|  CYP96A5                                          50.4    2e-04   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                  50.4    2e-04   
emb|CDY53182.1|  BnaA06g40610D                                        50.1    2e-04   
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like             43.9    2e-04   
ref|XP_011022041.1|  PREDICTED: cytochrome P450 86B1                  50.1    2e-04   
emb|CDM86413.1|  unnamed protein product                              50.1    2e-04   
ref|XP_011022670.1|  PREDICTED: cytochrome P450 86A7-like             46.6    2e-04   
ref|XP_007051777.1|  Cytochrome P450 86A2 isoform 3                   48.9    2e-04   
ref|XP_011006771.1|  PREDICTED: cytochrome P450 86B1-like             50.1    2e-04   
ref|XP_011101147.1|  PREDICTED: cytochrome P450 704C1-like            50.1    2e-04   
emb|CDP06233.1|  unnamed protein product                              50.1    2e-04   
ref|XP_003592376.1|  Cytochrome P450 monooxygenase CYP704G9           50.1    2e-04   
ref|XP_010452806.1|  PREDICTED: cytochrome P450 86B1 isoform X2       50.1    3e-04   
dbj|BAJ85246.1|  predicted protein                                    50.1    3e-04   
ref|XP_009797232.1|  PREDICTED: cytochrome P450 86A8-like             47.0    3e-04   
gb|ABC59094.1|  cytochrome P450 monooxygenase CYP704G9                50.1    3e-04   
gb|AAZ39646.1|  cytochrome P450 monooxygenase                         50.1    3e-04   
ref|XP_002307954.2|  putative cytochrome P450 family protein          50.1    3e-04   
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                  48.5    3e-04   
gb|KHN12182.1|  Cytochrome P450 94A1                                  50.1    3e-04   
ref|XP_011091066.1|  PREDICTED: cytochrome P450 704C1-like            50.1    3e-04   
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like             50.1    3e-04   
emb|CDP03436.1|  unnamed protein product                              50.1    3e-04   
ref|XP_010452805.1|  PREDICTED: cytochrome P450 86B1 isoform X1       50.1    3e-04   
ref|XP_003521105.1|  PREDICTED: cytochrome P450 94A1                  49.7    3e-04   
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg           49.7    3e-04   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1  48.1    3e-04   
gb|KEH24777.1|  cytochrome P450 family protein                        49.7    3e-04   
ref|XP_009629836.1|  PREDICTED: cytochrome P450 86A8                  47.0    3e-04   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like             49.7    3e-04   
ref|XP_006339516.1|  PREDICTED: cytochrome P450 704C1-like            49.7    3e-04   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like             49.7    3e-04   
emb|CDY39035.1|  BnaA02g17240D                                        49.7    3e-04   
ref|XP_009593544.1|  PREDICTED: cytochrome P450 704C1-like isofor...  49.7    3e-04   
ref|XP_010255798.1|  PREDICTED: cytochrome P450 86B1-like             44.3    3e-04   
emb|CDX90337.1|  BnaA08g16470D                                        49.7    3e-04   
ref|NP_200003.1|  Cytochrome P450 family protein                      49.3    3e-04   
gb|KDO86201.1|  hypothetical protein CISIN_1g009235mg                 47.4    3e-04   
ref|XP_006445018.1|  hypothetical protein CICLE_v10019633mg           47.4    3e-04   
dbj|BAG88047.1|  unnamed protein product                              49.7    3e-04   
ref|XP_010514257.1|  PREDICTED: cytochrome P450 86B1-like             43.1    3e-04   
gb|ABK94777.1|  unknown                                               49.7    3e-04   
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like             49.7    3e-04   
gb|EAZ31703.1|  hypothetical protein OsJ_15852                        49.7    3e-04   
ref|XP_006339777.1|  PREDICTED: cytochrome P450 704C1-like            49.7    3e-04   
ref|XP_004493756.1|  PREDICTED: cytochrome P450 94A1-like             49.7    4e-04   
gb|EAY95236.1|  hypothetical protein OsI_17053                        49.7    4e-04   
ref|XP_010544374.1|  PREDICTED: cytochrome P450 704C1-like isofor...  49.7    4e-04   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like             49.7    4e-04   
emb|CDY46948.1|  BnaA02g32980D                                        49.7    4e-04   
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like             49.7    4e-04   
ref|XP_002465041.1|  hypothetical protein SORBIDRAFT_01g031080        49.7    4e-04   
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like             49.7    4e-04   
ref|NP_001053615.1|  Os04g0573900                                     49.7    4e-04   
ref|NP_196442.2|  cytochrome P450 superfamily protein                 49.7    4e-04   
ref|XP_010087951.1|  Cytochrome P450 86A2                             45.4    4e-04   
ref|XP_002282185.1|  PREDICTED: cytochrome P450 86B1                  49.7    4e-04   
ref|XP_011093193.1|  PREDICTED: cytochrome P450 704C1-like            49.7    4e-04   
emb|CAB93726.1|  cytochrome P450-like protein                         49.7    4e-04   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg           49.7    4e-04   
emb|CAN77648.1|  hypothetical protein VITISV_032391                   49.7    4e-04   
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like             49.3    4e-04   
ref|XP_009530674.1|  hypothetical protein PHYSODRAFT_511223           49.3    4e-04   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                     49.3    4e-04   
ref|XP_010242796.1|  PREDICTED: cytochrome P450 86B1-like             42.4    4e-04   
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like             49.3    4e-04   
ref|XP_006394587.1|  hypothetical protein EUTSA_v10003923mg           49.3    4e-04   
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...  49.3    4e-04   
ref|XP_011040725.1|  PREDICTED: cytochrome P450 94A1                  49.3    4e-04   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...  49.3    4e-04   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like             47.4    4e-04   
ref|XP_010245486.1|  PREDICTED: cytochrome P450 86B1                  49.3    4e-04   
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                  49.3    4e-04   
ref|XP_009351729.1|  PREDICTED: cytochrome P450 86B1-like             43.9    5e-04   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                 47.4    5e-04   
emb|CDY61911.1|  BnaC07g49710D                                        49.3    5e-04   
ref|XP_010673086.1|  PREDICTED: cytochrome P450 94A1-like             44.3    5e-04   
gb|KEH40920.1|  cytochrome P450 family protein                        49.3    5e-04   
ref|XP_004306772.1|  PREDICTED: cytochrome P450 86A8-like             49.3    5e-04   
gb|KEH24773.1|  cytochrome P450 family protein                        44.7    5e-04   
ref|XP_010247227.1|  PREDICTED: cytochrome P450 94B3                  49.3    5e-04   
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase     45.1    5e-04   
ref|XP_010269253.1|  PREDICTED: cytochrome P450 86B1-like             49.3    5e-04   
ref|XP_002527038.1|  cytochrome P450, putative                        49.3    5e-04   
ref|XP_008777681.1|  PREDICTED: cytochrome P450 704C1-like isofor...  49.3    5e-04   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like             49.3    5e-04   
ref|XP_006293183.1|  hypothetical protein CARUB_v10019500mg           44.7    5e-04   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like             49.3    5e-04   
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like             42.7    5e-04   
gb|ABD97099.1|  cytochrome P450 monooxygenase CYP94D24                48.9    5e-04   
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like             48.9    5e-04   
ref|XP_004231179.1|  PREDICTED: cytochrome P450 704C1-like            48.9    5e-04   
ref|XP_008777559.1|  PREDICTED: cytochrome P450 704C1-like isofor...  48.9    5e-04   
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg              48.9    5e-04   
ref|XP_008777680.1|  PREDICTED: cytochrome P450 704C1-like isofor...  48.9    5e-04   
emb|CDX72698.1|  BnaC07g47200D                                        48.9    6e-04   
gb|ETI45717.1|  hypothetical protein F443_09789                       47.8    6e-04   
ref|XP_008892807.1|  hypothetical protein PPTG_01313                  47.8    6e-04   
emb|CDY61808.1|  BnaC03g76440D                                        48.9    6e-04   
gb|KDO85886.1|  hypothetical protein CISIN_1g010681mg                 48.9    6e-04   
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                  44.7    6e-04   
ref|XP_008777682.1|  PREDICTED: cytochrome P450 704C1-like            48.9    6e-04   
gb|EYU25718.1|  hypothetical protein MIMGU_mgv1a025848mg              48.9    6e-04   
emb|CAN80040.1|  hypothetical protein VITISV_037194                   44.7    6e-04   
ref|XP_008777558.1|  PREDICTED: cytochrome P450 704C1-like isofor...  48.9    6e-04   
ref|XP_010670184.1|  PREDICTED: cytochrome P450 86A8                  44.3    6e-04   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2  47.0    6e-04   
ref|XP_006415814.1|  hypothetical protein EUTSA_v10007367mg           41.6    6e-04   
gb|ETP15529.1|  hypothetical protein F441_09735                       47.8    6e-04   
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like             48.9    7e-04   
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like             44.3    7e-04   



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score = 87.4 bits (215),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P+ KA  D + A+L+R+I  E CWKLQK+   G   +EKKL+QA +S
Sbjct  194  DPRSLSID-LPYLPYEKAFGDALDALLHRHITPENCWKLQKWLQIG---KEKKLTQAWES  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  FIYP + +  E+L K   +  +S   LT++I+          G   +FLRD F+  +
Sbjct  250  FDQFIYPCISQKLEELMKKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFLRDTFLNLM  309

Query  345  IAGGDTTASALGSFCSL  395
             AG DTT +AL  F  L
Sbjct  310  FAGRDTTGAALTWFFWL  326


 Score = 26.6 bits (57),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 1/31 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LLA+NP VE KI  +I Q + +L K + L F
Sbjct  326  LLAKNPLVETKIREEI-QQQLHLKKDENLKF  355



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score = 87.4 bits (215),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 77/137 (56%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P+ KA  D + A+L+R+I  E CWKLQK+   G   +EKKL+QA +S
Sbjct  194  DPRSLSID-LPYLPYEKAFGDALDALLHRHITPENCWKLQKWLQIG---KEKKLTQAWES  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  FIYP + +  E+L K   +  +S   LT++I+          G   +FLRD F+  +
Sbjct  250  FDQFIYPCISQKLEELMKKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFLRDTFLNLM  309

Query  345  IAGGDTTASALGSFCSL  395
             AG DTT +AL  F  L
Sbjct  310  FAGRDTTGAALTWFFWL  326


 Score = 26.6 bits (57),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 1/31 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LLA+NP VE KI  +I Q + +L K + L F
Sbjct  326  LLAKNPLVETKIREEI-QQQLHLKKDENLKF  355



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL ID     P  KA  D + A+L+R+I+ E CWKLQK+   G   +EKKLSQA +
Sbjct  192  HDPRSLSID-VPHVPCEKAFTDAIDALLFRHIMPESCWKLQKWLQIG---KEKKLSQAWE  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTF  341
            +F  F+YP +    E+L K   +  D +  L ++IK          G   +FLRD F+  
Sbjct  248  AFDEFLYPCISHKQEELMKKTAKDEDFT-FLAAYIKMYNSWNKGDLGTLQKFLRDTFLNL  306

Query  342  IIAGGDTTASALGSF  386
            ++AG D+T+SAL  F
Sbjct  307  MLAGRDSTSSALTWF  321



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score = 76.6 bits (187),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 76/139 (55%), Gaps = 13/139 (9%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL I      P  KA  D V A+LYR++L + CWKLQ+ W+   I +EKKL QA +
Sbjct  193  HDPKSLSIG-LPHVPCEKAFNDIVDALLYRHVLPKGCWKLQR-WL--QIGKEKKLIQAWE  248

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL--------*GNSMQFLRDIFVT  338
            +F  F+YP +    E+L     +  D   + T++IK           GN  +FLRD F+ 
Sbjct  249  AFDQFLYPCISRQQEELMNKIIKDEDFD-LFTAYIKAYNLWKNGDNTGNVQEFLRDTFLN  307

Query  339  FIIAGGDTTASALGSFCSL  395
             ++AG DTT++A+  F  L
Sbjct  308  LMLAGRDTTSAAITWFFWL  326


 Score = 28.5 bits (62),  Expect(2) = 2e-14, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVFNI  487
            LLA+NP VE KI  +IL+  Q    ++   FNI
Sbjct  326  LLAENPLVETKIREEILEQLQLKEDENLKYFNI  358



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score = 77.4 bits (189),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 76/140 (54%), Gaps = 15/140 (11%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL I      P  KA  D V A+LYR+IL E CWKLQ+ W+   I +EKKL QA +
Sbjct  193  HDPKSLSIG-LPHVPCEKAFNDAVDALLYRHILPEGCWKLQR-WL--QIGKEKKLIQAWE  248

Query  183  SFSNFIYPILEEMTEQ-LNKTQ*QPHDSSGMLTSHIKTL--------*GNSMQFLRDIFV  335
            +F  F+YP +    E+ +NK      +   + T+++K           GN  +FLRD F+
Sbjct  249  AFDRFLYPCISRKQEEWMNKI--IKDEDFDLFTAYVKAYNLWKNGDNTGNVQEFLRDTFL  306

Query  336  TFIIAGGDTTASALGSFCSL  395
              + AG DTT++A+  F  L
Sbjct  307  NLMFAGRDTTSAAITWFFWL  326


 Score = 26.9 bits (58),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 24/41 (59%), Gaps = 10/41 (24%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI---LQLKQ-------NLAKQDKLVF  481
            LLA+NP VE KI  +I   LQLK+       N+ +  KL++
Sbjct  326  LLAENPLVETKIREEIQQKLQLKEDGNLKLFNIEETRKLIY  366



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 12/135 (9%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL ID     P  KA  D + A+L+R+I+ E CWKLQK W+   I +EKKL+QA +
Sbjct  192  HDPRSLSID-FPHVPCEKAFTDAIDALLFRHIIPESCWKLQK-WL--QIGKEKKLTQAWE  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTF  341
            +F  F+YP + +  E+L K   +  + +  L ++IK          G    FLRD F+  
Sbjct  248  AFDEFLYPCISQKQEELMKKTIKDEEFT-FLAAYIKMYNSWNKGDLGTLQNFLRDTFLNL  306

Query  342  IIAGGDTTASALGSF  386
            ++AG D+T+SA+  F
Sbjct  307  MLAGRDSTSSAITWF  321



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I      P  KA  D V A+LYR IL E CWKLQK+   G   REKKL QA ++
Sbjct  181  DPKSLSIG-LPHVPCEKAFNDTVDALLYRYILPECCWKLQKWLRIG---REKKLIQAWEA  236

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  F+YP +    E+L        +    L + IK          G    FLRD F++ +
Sbjct  237  FDQFLYPCISRKQEELMHKSTMKDEEFSFLNAFIKMYDQWKDGDLGTLQTFLRDTFLSLM  296

Query  345  IAGGDTTASALGSFCSL  395
            + G DTT++AL  F +L
Sbjct  297  LGGRDTTSAALTWFFAL  313



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 72/137 (53%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P  KA  D V A++YR+IL E CWKLQK+   G   +EK+L QA ++
Sbjct  195  DPKSLSID-LPHVPCEKAFNDVVDALMYRHILPEGCWKLQKWLRIG---KEKQLIQAWEA  250

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  F+YP +    E+L +      +    L  +IK          G    FLRD F+  +
Sbjct  251  FDQFLYPCISRKQEELMQKSTIKDEEFTFLNEYIKMYNQWKDGDLGTLQTFLRDTFLNLM  310

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT++AL  F  L
Sbjct  311  LAGRDTTSAALTWFFWL  327



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 71/137 (52%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I      P  KA  D V A+LYR++L E CWKLQK+   G   REKKL QA ++
Sbjct  195  DPKSLSIG-LPHVPCEKAFNDTVDALLYRHLLPESCWKLQKWLRIG---REKKLIQAWEA  250

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  F+YP +    E+L        +    L  +IK          G    FLRD F++ +
Sbjct  251  FDQFLYPCISRKQEELLHQSTIKDEEFTFLNEYIKMYNQWKDGDLGTLQTFLRDTFLSLM  310

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT++AL  F  L
Sbjct  311  LAGRDTTSAALTWFFWL  327



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score = 76.3 bits (186),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 73/144 (51%), Gaps = 20/144 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGSL ID   D  F  A +D   AILYR+I+ E CWKLQK+   G   +EKKLSQA ++
Sbjct  201  DPGSLSIDLPTDSLFKNAFQDAGDAILYRHIMPESCWKLQKWLRVG---KEKKLSQAWKA  257

Query  186  FSNFIYPILEEMTEQLNKTQ---*QPHDSSGMLTSHIKTL--------------*GNSMQ  314
            F   IY  +    E++ +      +  +    LT+ +K                  N+ +
Sbjct  258  FDQLIYSCISRKQEEMLRRSGFIEEEDEDFDFLTACMKAYNSLFMKNIVDTDLENNNAKK  317

Query  315  FLRDIFVTFIIAGGDTTASALGSF  386
            FLRD  +  + AG DTT+SAL  F
Sbjct  318  FLRDTCMNLMFAGKDTTSSALTWF  341


 Score = 25.0 bits (53),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 3/25 (12%)
 Frame = +2

Query  389  LLAQNPQVEAKI---LNDILQLKQN  454
            LLA+NP V+  I   + +ILQLK++
Sbjct  344  LLAKNPSVQTTIRDEIQEILQLKED  368



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score = 73.6 bits (179),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (51%), Gaps = 12/138 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P  K   D V A+LYR++L +  W+LQK    G   +EK LSQA ++
Sbjct  191  DPKSLSID-LPHLPCEKGFNDMVDALLYRHVLPDSYWQLQKKLNIG---KEKNLSQAWEA  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL--------*GNSMQFLRDIFVTF  341
            F  FIYP + +  E+L   +    +   +   +IK           GN  +FLRD F+  
Sbjct  247  FDQFIYPAISQKQEKLLLNKTNKDEDFDLFADYIKAYNQWTNGDTSGNVQEFLRDTFLNL  306

Query  342  IIAGGDTTASALGSFCSL  395
            + AG DTT++ L  F  L
Sbjct  307  MFAGRDTTSTTLTWFFWL  324


 Score = 25.8 bits (55),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 1/31 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LLA+NP VE KI  +I Q + +L K + L F
Sbjct  324  LLAKNPLVETKIREEIEQ-QLHLKKDENLKF  353



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 73/139 (53%), Gaps = 15/139 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P  K   D V A+LYR+++ E  W+LQK      I +EK LSQA  +
Sbjct  191  DPKSLFID-LPHLPCEKGFNDMVDALLYRHVVPESYWQLQKKL---NIGKEKNLSQAWVA  246

Query  186  FSNFIYPILEEMTEQL-NKTQ*QPHDSSGMLTSHIKTL*--------GNSMQFLRDIFVT  338
            F  FIYP + +  E+L NKT     +   + + +IK           GN  QFLRD F+ 
Sbjct  247  FDQFIYPAISQKQEKLLNKTN--KDEDFDLFSDYIKAYNQWTIGDTSGNVQQFLRDTFLN  304

Query  339  FIIAGGDTTASALGSFCSL  395
             + AG DTT++AL  F  L
Sbjct  305  LMFAGRDTTSTALTWFFWL  323



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score = 72.8 bits (177),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 68/137 (50%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I      P   A  D + A +YR+ L E CWKLQK+   G   +EKKL QA ++
Sbjct  195  DPKSLSIG-LPHVPCENAFNDSLDAFMYRHFLPESCWKLQKWLRIG---KEKKLIQAWEA  250

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
               FIYP +    E+L  T     +    L ++I+          G    FLRD F++ +
Sbjct  251  IDQFIYPCISRKQEELMHTSRAKDEEFIFLNAYIRMYNQWKDGDLGTLQTFLRDTFLSLL  310

Query  345  IAGGDTTASALGSFCSL  395
             AG DTT++AL  F  L
Sbjct  311  FAGRDTTSAALTWFFWL  327


 Score = 26.2 bits (56),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 1/31 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LLA+NP VE +I  +I Q + NL + + L F
Sbjct  327  LLAKNPSVEKRIREEI-QQQLNLKEGENLKF  356



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score = 73.6 bits (179),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 68/138 (49%), Gaps = 11/138 (8%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL I      P   A  D + A++YR+ L E CWKLQK+   G   +EKKL QA +
Sbjct  180  HDPKSLSIG-LPHVPCENAFNDSLDALMYRHFLPESCWKLQKWLRIG---KEKKLIQAWE  235

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTF  341
            +   F+YP +    E+L        D    L ++IK          G    FLRD F+  
Sbjct  236  AIDQFLYPCISRKQEELMHESTAKDDEFTFLNAYIKMYNQWKDGDLGTLQTFLRDTFLNL  295

Query  342  IIAGGDTTASALGSFCSL  395
            ++AG DTT++AL  F  L
Sbjct  296  MLAGRDTTSAALTWFFWL  313


 Score = 24.3 bits (51),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
             LLA+NP VE KI  +I Q + NL + + L F
Sbjct  312  WLLAENPLVEKKIREEI-QQQFNLKEGENLKF  342



>ref|XP_009778171.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=244

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 70/132 (53%), Gaps = 28/132 (21%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL ID     P+ KA  D + A+L+R+I+ E CWKLQK+   G   +EKKL+QA +
Sbjct  84   HDPRSLSIDLPF-LPYEKAFGDALDAVLHRHIMPESCWKLQKWLQIG---KEKKLTQAWE  139

Query  183  SFSNFIYP-ILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
            +   FIYP IL++  E +NKT              IK           D F+  ++AG D
Sbjct  140  ALDQFIYPCILQKQEELMNKT--------------IKD---------EDTFLNLMLAGRD  176

Query  360  TTASALGSFCSL  395
            TT++AL  F  L
Sbjct  177  TTSAALTWFFWL  188



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score = 72.4 bits (176),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL +D     P+ KA  D + A+L+R+I  +  WKLQ++   G   +EKKL  A ++
Sbjct  192  DPKSLSMD-LPYLPYEKAFGDALDALLHRHITPQRLWKLQQWLRIG---KEKKLMHACEA  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  FIYP +    E+L        +    L ++IK          G    FLRD F+  +
Sbjct  248  FDQFIYPCIARKQEELMHKSRIKEEEFAFLNAYIKVYNQWNGGDLGTLQTFLRDTFLNLM  307

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT++AL  F  L
Sbjct  308  LAGKDTTSAALTWFFVL  324


 Score = 24.3 bits (51),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQ  442
            +LLA+NP VE KI  +I Q
Sbjct  323  VLLAKNPLVEKKIREEIQQ  341



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score = 71.6 bits (174),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL +D     P+ KA  D + A+L+R+I  +  WKLQ++   G   +EKKL QA ++
Sbjct  192  DPRSLSMD-LPYLPYEKAFGDALDALLHRHITPKCLWKLQQWLRIG---KEKKLMQACEA  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL-------*GNSMQFLRDIFVTFI  344
            F  FIYP +    E+L        +    L ++IK          G    FLRD F+  +
Sbjct  248  FDQFIYPCIARKQEELMHKTTIKDEEFAFLNAYIKMYNQWNDGDLGTLQTFLRDTFINLM  307

Query  345  IAGGDTTASALGSFCSL  395
             AG DTT++AL  F  L
Sbjct  308  FAGRDTTSAALTWFFVL  324


 Score = 24.3 bits (51),  Expect(2) = 9e-12, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQ  442
            +LLA+NP VE KI  +I Q
Sbjct  323  VLLAKNPLVEKKIREEIQQ  341



>emb|CDX79038.1| BnaA01g11050D [Brassica napus]
Length=478

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 81/158 (51%), Gaps = 20/158 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA  D   AIL+R+I+    W+LQK     G+ +EKKL++A  +
Sbjct  164  DPQSLSIE-MPEVEFAKAFDDAGEAILFRHIIPRFLWELQKR---MGLGKEKKLTEAGST  219

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I+   EE     N       +S  +LTSHIK        L  +  +FLRD  
Sbjct  220  FDRICTRYIFAKREEKRSTENDHDHSNGESEDLLTSHIKLDTSKYQLLNPSDDKFLRDTI  279

Query  333  VTFIIAGGDTTASALGSFCSL-----HKTLKLKQRSST  431
            +TFI AG D+T+SAL  F  L     H   K++Q  +T
Sbjct  280  LTFIFAGRDSTSSALTWFFGLLSRNPHVEAKIRQEINT  317



>ref|XP_009134418.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=525

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 81/158 (51%), Gaps = 20/158 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA  D   AIL+R+I+    W+LQK     G+ +EKKL++A  +
Sbjct  199  DPQSLSIE-MPEVEFAKAFDDAGEAILFRHIIPRFLWELQKR---MGLGKEKKLTEAGST  254

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I+   EE     N       +S  +LTSHIK        L  +  +FLRD  
Sbjct  255  FDRICTRYIFAKREEKRSTENDHDHSNGESEDLLTSHIKLDTSKYQLLNPSDDKFLRDTI  314

Query  333  VTFIIAGGDTTASALGSFCSL-----HKTLKLKQRSST  431
            +TFI AG D+T+SAL  F  L     H   K++Q  +T
Sbjct  315  LTFIFAGRDSTSSALTWFFGLLSRNPHVEAKIRQEINT  352



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (56%), Gaps = 15/136 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ID   +  F KAI + + AI YR++L E  WKLQ+ W+  GI +EKKL +A ++
Sbjct  190  DPGCLSID-LPEVAFSKAIDNAMEAIFYRHVLPESTWKLQR-WL--GIGKEKKLKKARET  245

Query  186  FSNFIYPILEEMTEQLNK-TQ*QPHDSSG--MLTSHIKTL*GNSM------QFLRDIFVT  338
                I  I+ +  E+L+K  +    D  G  +LTS++      +M      +FLRD  V 
Sbjct  246  LDRIIAEIISKKREELSKGNRLMQEDGEGIDLLTSYMSE--NYNMGFKSDDEFLRDTIVN  303

Query  339  FIIAGGDTTASALGSF  386
            F++AG DT +S L  F
Sbjct  304  FMLAGRDTVSSCLSWF  319



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 79/140 (56%), Gaps = 13/140 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGSL +D   + P  KA  D  + +L+R+IL E  WKLQK W+  GI +EKKLS+A  +
Sbjct  116  DPGSLSLD-LPNIPCEKAFNDLALVLLHRHILPERYWKLQK-WL--GIGKEKKLSKAWDA  171

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLT---SHIKTL*GNSMQ----FLRDIFVTFI  344
            F  FIYP +    E+ +K   +     G+ T   ++ +T   NS++    F+RD  +  +
Sbjct  172  FDQFIYPRISLKQEKRSKMFDEERRFVGLTTLMEAYEET--NNSIRDAKAFIRDNILNLM  229

Query  345  IAGGDTTASALGSFCSLHKT  404
             AG DTT++AL  F  L  T
Sbjct  230  FAGRDTTSTALTWFFWLIAT  249



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 15/140 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++     P  KA  D V A+LYR++L E  WKLQK+   G   +EK L +A +S
Sbjct  193  DPKSLSVN-LPHVPCEKAFNDMVDALLYRHVLPERYWKLQKWLRIG---KEKNLMKAWES  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL----------*GNSMQFLRDIFV  335
            F  FIYP + +  E+L   + +  D   + + ++K             G+  +FLRD F+
Sbjct  249  FDQFIYPAISKRQEKLINNEIK-DDDFDLFSDYVKAYKEWTNEDDKNLGSVEKFLRDTFL  307

Query  336  TFIIAGGDTTASALGSFCSL  395
              + AG DTT+S L  F  L
Sbjct  308  NLMFAGRDTTSSNLTWFFWL  327



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 75/143 (52%), Gaps = 20/143 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++     P  KA  D V A+LYR++L E CWKLQK+   G   +EK L  A ++
Sbjct  190  DPKSLSVN-LPYVPCEKAFNDMVDALLYRHVLPESCWKLQKWLRIG---KEKNLMNAWEA  245

Query  186  FSNFIYPILEEMTEQL--NKTQ*QPHDSSGMLTSHIKTL----------*GNSMQFLRDI  329
               FIYP + +  E+L  NK +    D   + + ++K             G+  +FLRD 
Sbjct  246  LDQFIYPAISKRQEKLMSNKIK---DDDFDLFSDYVKAYNQWTNEDDKNLGSVEKFLRDT  302

Query  330  FVTFIIAGGDTTASALGSFCSLH  398
            F+  + AG DTT++ L ++C  H
Sbjct  303  FLNLMFAGRDTTSTTL-TWCFWH  324



>ref|XP_010911437.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=523

 Score = 67.0 bits (162),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  PT   PF KA+ D   A+L+R+ +    WKLQ+++  G    EKKL+ A +
Sbjct  201  DPGCLSIGFPT--VPFAKAMDDATAALLFRHTVPPAWWKLQRWFRIG---EEKKLALAWE  255

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*G-------NSMQ---FLRDIF  332
                FI   + E  E+ NK++        +L+S+I            N M+   FLRD  
Sbjct  256  VIDQFIAQRIAEKKEERNKSRSHEEAPRDLLSSYIDNCDDLHVVDVENPMELNKFLRDTA  315

Query  333  VTFIIAGGDTTASALGSF  386
            + F+IAG DTT +AL  F
Sbjct  316  MNFMIAGRDTTGAALTWF  333


 Score = 26.9 bits (58),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LL++NP+VE KIL ++  L++  +  D +  
Sbjct  336  LLSKNPRVELKILEELKSLRKERSCSDGMTL  366



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score = 68.2 bits (165),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 73/141 (52%), Gaps = 15/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D+ F KAI D   AI+YR+I   + WKLQ  W+  G+  EKKL +AD  
Sbjct  191  DPISLSIE-MPDNEFAKAITDAGEAIMYRHIKPRLLWKLQS-WM--GLGLEKKLLEADAV  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIK-------TL*GNSMQFLRDIF  332
            F       +    E++       H  +G    +LTS+IK        L  +  QFL+++ 
Sbjct  247  FDRVCAKYISTKREEVRLQGISNHPINGEGEDLLTSYIKLDTTKYELLNPSKDQFLKEVI  306

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + FIIAG DT ASAL  F  L
Sbjct  307  LNFIIAGRDTVASALTWFFWL  327


 Score = 25.8 bits (55),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI-LQLKQNLAKQDKLVFN  484
            LL++NPQV AKI  +I   L ++   Q+KL F+
Sbjct  327  LLSKNPQVVAKIHQEINTVLPRSKYGQEKLSFD  359



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score = 68.2 bits (165),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 73/141 (52%), Gaps = 15/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D+ F KAI D   AI+YR+I   + WKLQ  W+  G+  EKKL +AD  
Sbjct  191  DPISLSIE-MPDNEFAKAITDAGEAIMYRHIKPRLLWKLQS-WM--GLGLEKKLLEADAV  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIK-------TL*GNSMQFLRDIF  332
            F       +    E++       H  +G    +LTS+IK        L  +  QFL+++ 
Sbjct  247  FDRVCAKYISTKREEVRLQGISNHPINGEGEDLLTSYIKLDTTKYELLNPSKDQFLKEVI  306

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + FIIAG DT ASAL  F  L
Sbjct  307  LNFIIAGRDTVASALTWFFWL  327


 Score = 25.8 bits (55),  Expect(2) = 4e-11, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI-LQLKQNLAKQDKLVFN  484
            LL++NPQV AKI  +I   L ++   Q+KL F+
Sbjct  327  LLSKNPQVVAKIHQEINTVLPRSKYGQEKLSFD  359



>emb|CDX82804.1| BnaC01g12540D [Brassica napus]
Length=447

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 74/141 (52%), Gaps = 15/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA  +   AIL+R+I+    W+LQK     G+ +EKKL++A  +
Sbjct  142  DPQSLSIE-MPEVEFAKAFDNAGEAILFRHIIPRFLWELQKR---MGLGKEKKLTEAGST  197

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I+   EE     N       +S  +LTSHIK        L  +  +FLRD  
Sbjct  198  FDRICTRYIFAKREEKRSTENDHDHSNGESEDLLTSHIKLDTSKYQLLNPSDDKFLRDTI  257

Query  333  VTFIIAGGDTTASALGSFCSL  395
            VTFI AG D+T+SAL  F  L
Sbjct  258  VTFIFAGRDSTSSALTWFFGL  278



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            +PG L +D   D PF KA+ D   +I  R++L E  WKLQ++   GG   E++LS+A + 
Sbjct  191  NPGCLSLDLADDVPFSKAMDDVEESIFVRHVLPEKIWKLQRWLGVGG---ERRLSKASEI  247

Query  186  FSNFIYPIL----EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAG  353
              +FI   +     E++ +      +  +   +LT+++     +  +FLRD  +  +IAG
Sbjct  248  LDSFIIKYIAMKRNEISRKNGDWNIENENGEDLLTAYMNLGDRDDDKFLRDTILNLMIAG  307

Query  354  GDTTASALGSFCSLHKT  404
             DTT+SAL  F  L  T
Sbjct  308  RDTTSSALTWFVWLVST  324



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ID   +  F KA+ + + AI YR++L E  W+LQ+ W+  GI +EKKL +A ++
Sbjct  189  DPGCLSID-LPEVAFSKAMDNAMEAIFYRHVLPESTWRLQR-WL--GIGKEKKLKKARET  244

Query  186  FSNFIYPILEEMTEQLNK-TQ*QPHDSSG--MLTSHIKTL*GNSM----QFLRDIFVTFI  344
                I  I+    E+L+K  +    D  G  +LTS++            +FLRD  VTF+
Sbjct  245  LDRIIAEIISMKREELSKGNRLMEEDGEGIDLLTSYMSEDYNMGFKSDDEFLRDTIVTFM  304

Query  345  IAGGDTTASALGSF  386
            +AG DT +S L  F
Sbjct  305  LAGRDTVSSCLSWF  318



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 15/139 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID   D PF KA+ D   AIL R+++ E  W+LQK W+  GI  EKKL +A ++
Sbjct  190  DPGCVSID-FPDVPFSKAMDDAEEAILVRHVMPEAIWRLQK-WL--GIGEEKKLIKAWET  245

Query  186  FSNFIYPILEEMTEQLNKTQ*Q---PHDSSGMLTSHIKTL*GNSM------QFLRDIFVT  338
              N I   + +  ++L KT+ +     +   +LT ++K   G +M      +FLRD  + 
Sbjct  246  MDNVIGNYISKKRDKLLKTESELKLEDEGFDLLTFYLKE--GQNMGVNCDDKFLRDTILN  303

Query  339  FIIAGGDTTASALGSFCSL  395
             +IAG DTT+SAL  F  L
Sbjct  304  LMIAGRDTTSSALTWFIWL  322



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+  GD  F KA+ D   AILYR++     WKLQ  W+  G  +EKKL +A+ +
Sbjct  191  DPRSLSIEMPGDE-FAKALDDVGEAILYRHVKPRFLWKLQN-WM--GFGQEKKLIEANAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH-DSSGMLTSHIKT-------L*GNSMQFLRDIFVTF  341
            F       +    E++ ++Q   + +S  +LTS IK        L  +  +FLRD  + F
Sbjct  247  FDRVCAKYISAKREEIKRSQGVSNGESEDLLTSIIKLDTTKYKLLNPSDDKFLRDNILAF  306

Query  342  IIAGGDTTASALGSF  386
            I+AG DTTA+AL  F
Sbjct  307  ILAGRDTTATALSWF  321



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 52/145 (36%), Positives = 75/145 (52%), Gaps = 18/145 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   D PF KA+ D   AI  R++L +  WKLQ+ W+  G+  E+KLS+A   
Sbjct  191  DPGCLSVD-LPDVPFSKAMDDAEEAIFMRHVLPDRVWKLQR-WL--GVGSERKLSKAWGV  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH---DSSGMLTSHIKTL*GNSM---------QFLRDI  329
              + I   +    E+L + +   H   D + +LTS+I    G+           +FLRD 
Sbjct  247  LDSVIGKYIAMKREELRRGKLMDHEEEDGADLLTSYING--GDDAPSQYLKCDDKFLRDT  304

Query  330  FVTFIIAGGDTTASALGSFCSLHKT  404
             +  +IAG DTT+SAL  F  L  T
Sbjct  305  ILNLMIAGRDTTSSALTWFMWLVST  329



>ref|XP_002868908.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45167.1| hypothetical protein ARALYDRAFT_352944 [Arabidopsis lyrata subsp. 
lyrata]
Length=994

 Score = 63.2 bits (152),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    IL+R++  +  WKLQK W+  G+  EKK+++A+ +
Sbjct  676  DPRSLSIEMHEDE-LAKALDDVAEGILFRHVKPKFLWKLQK-WM--GLGHEKKMTEANAT  731

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIKT-------L*GNSMQFLRDI  329
            F       + +  E++ ++Q     S G     +L+S IK        L  +  +FLRD 
Sbjct  732  FDRVCAKYISDKREEIIRSQRFNDISYGESHEDLLSSFIKLDTTKYKLLNSSEDKFLRDT  791

Query  330  FVTFIIAGGDTTASALGSF  386
             + FI+AG DTTASAL  F
Sbjct  792  IMAFILAGRDTTASALTWF  810


 Score = 27.3 bits (59),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 9/38 (24%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQ-------DKLVF  481
            LL+++PQV  KIL +I+ +  NL+K        DKLV+
Sbjct  813  LLSESPQVVTKILQEIINI--NLSKNGNGQENLDKLVY  848


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (51%), Gaps = 19/163 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  + KA+ D    I YR+I  +  WKLQ  +   G+ +EK++++AD +
Sbjct  190  DPKSLSIE-MPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNRF---GLGQEKRMTEADAT  245

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++ ++Q   H S+G    +LTSHIK        L  +  +FLRD  
Sbjct  246  FDRVSAKYISAKREEI-RSQGIDHHSNGQSEDLLTSHIKLDTTKYELLNPSDDKFLRDTI  304

Query  333  VTFIIAGGDTTASALGSF---CSLHKTLKLKQRSSTISFN*NK  452
            + F +AG DT +SAL  F    S +  +  K R   IS N +K
Sbjct  305  LAFNLAGRDTMSSALSWFFWLLSENPQVVTKIRKEIISKNISK  347



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 76/132 (58%), Gaps = 9/132 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   D  F KA+ D   AI +R+I+ +  WKLQ+ W+  GI  EKK+S+A ++
Sbjct  197  DPGCLSVE-FPDVAFSKALDDVEEAIFFRHIVPKSYWKLQR-WL--GIGEEKKMSRAWKT  252

Query  186  FSNFIYPILEEMTEQLN-KTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIA  350
               +I   +    E+LN +T     +   +LTS+++   G+    S + LRD  + F+IA
Sbjct  253  LDRYIAHCISLKREELNNRTNKNEEEGIDLLTSYMEDDYGSDWLKSDKLLRDTMLNFMIA  312

Query  351  GGDTTASALGSF  386
            G DTT++AL  F
Sbjct  313  GRDTTSAALSWF  324



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 81/154 (53%), Gaps = 18/154 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ID  G  PF KA+ +   AI  R+IL E+  KL++ W+  GI +EKKLS++ + 
Sbjct  169  DPGCLSIDFPGV-PFSKAMDEVEEAIFMRHILPEIVLKLER-WL--GIGQEKKLSKSWKI  224

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKTL*GNSM--------QFLRDIFV  335
                I   +    E+L K     +D  G  +LTS+I  L  N +        +FLRD  +
Sbjct  225  LDEVICKYISVKQEELKKGTKSTNDEEGFDLLTSYI-NLGDNEITTGLKRDDKFLRDTII  283

Query  336  TFIIAGGDTTASALGSF---CSLHKTLKLKQRSS  428
             F+IAG DTT+SAL  F    S H T+  K R  
Sbjct  284  NFMIAGRDTTSSALTWFIWLVSTHPTVLNKIREE  317



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 55/161 (34%), Positives = 82/161 (51%), Gaps = 21/161 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   D PF KA+ D   AI  R+++ E  WKLQ+++   G+  E+KLS+A + 
Sbjct  189  DPGCLSVD-LPDVPFSKALDDAEEAIFMRHVVPEKIWKLQRWF---GVGSERKLSKAREV  244

Query  186  FSNFI--YPILE--EMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ---------FLRD  326
              + I  Y  L+  EM  +      +  D   +LTS++ T+  +  Q         FLRD
Sbjct  245  LDSVIGRYIALKRGEMRSRGISIDCENEDGVDLLTSYM-TVGDDGTQTHDLKCDDKFLRD  303

Query  327  IFVTFIIAGGDTTASALGSF---CSLHKTLKLKQRSSTISF  440
              +  +IAG DTT+SAL  F    S H  ++ + R    SF
Sbjct  304  TILNLMIAGRDTTSSALTWFIWLVSTHAEVEKRIRDELKSF  344



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 18/142 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID     PF KA+ D   AIL+R+++ E  WKLQ+ W+  GI  EKKLS+A ++
Sbjct  190  DPGCVSID-FPHVPFSKALDDAEEAILFRHVIPEPIWKLQR-WL--GIGEEKKLSKAWET  245

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS--------GMLTSHIKTL*GNSM----QFLRDI  329
              + I   + +  ++L K   + HD           +LT ++K   G  +    +FLRD 
Sbjct  246  MDDVIGNYISKKRDELTKI--ETHDDEVEENDEGFDLLTFYLKEGQGLGVNCDDKFLRDT  303

Query  330  FVTFIIAGGDTTASALGSFCSL  395
             +  +IAG DTT+SAL  F  L
Sbjct  304  ILNLMIAGRDTTSSALTWFIWL  325



>ref|XP_006285226.1| hypothetical protein CARUB_v10006585mg [Capsella rubella]
 gb|EOA18124.1| hypothetical protein CARUB_v10006585mg [Capsella rubella]
Length=513

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 9/133 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+      F KA+ D    I+YR++  +  WKLQ+ W+  G  +EKKL +A  +
Sbjct  193  DPRSLSIEMLEVDEFAKALNDIGEGIMYRHVKPKFLWKLQR-WV--GFGQEKKLYEAHAT  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT------L*GNSMQFLRDIFVTFII  347
             +      + +  E++   +    +   +LTSH+K          N  +FLRD  + FI+
Sbjct  250  LNRTCKKFILDKREEVRSKECSSKEGEDLLTSHMKLDSTMYLKYHNDEKFLRDTMLAFIL  309

Query  348  AGGDTTASALGSF  386
            AG DTTAS L  F
Sbjct  310  AGRDTTASGLTWF  322



>gb|KFK22185.1| hypothetical protein AALP_AAs38949U000100 [Arabis alpina]
Length=964

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 17/138 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SLCI+   +  F KA+ D   AI+YR+I     WKLQK WI  GI +EKK+ +AD +
Sbjct  252  DPRSLCIE-MPEVEFAKALDDCGEAIVYRHITPRFLWKLQK-WI--GIGKEKKMMKADAT  307

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +     ++   Q   H+S+G    +LTS +K        L  +  +FL+D  
Sbjct  308  FDRVCATYISAKRYEIK--QGSTHNSNGEIEDLLTSFMKLDATKYEHLNLSDDRFLKDFI  365

Query  333  VTFIIAGGDTTASALGSF  386
            V+F+ AG D+TASAL  F
Sbjct  366  VSFMAAGRDSTASALTWF  383


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 70/141 (50%), Gaps = 14/141 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+      F KA+ +    +LYR+++  + WK    W+  G+ +EKK+++A  +
Sbjct  685  DPRSLSIEMPEVDEFAKALDNAAEVVLYRHLMPRLVWKTLS-WM--GLWQEKKMTEASAT  741

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH--DSSG--MLTSHIKT-------L*GNSMQFLRDIF  332
                    + +  E++       H  + SG  +LTS +K        L     +F RDI 
Sbjct  742  IDRVCAKYISDKREEIRSLGITHHSEEESGEDILTSSMKLDTIKYEHLNTRDDRFFRDII  801

Query  333  VTFIIAGGDTTASALGSFCSL  395
            +TFI+AG DT ASAL  F  L
Sbjct  802  LTFIVAGRDTIASALTWFFWL  822



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score = 63.9 bits (154),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 72/148 (49%), Gaps = 21/148 (14%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SLC+      P  KA    V A+LYR+I  E  WKLQ  W+  GI +EKKL QA +
Sbjct  198  HDPESLCLG-LPYVPCEKAFNHAVDALLYRHIFPESFWKLQN-WL--GIGKEKKLIQAYR  253

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSS-----GMLTSHIKTL*GNS------------M  311
            +F  FIY  L+ + E++        ++S      + T++++                   
Sbjct  254  AFDEFIYSALKRLEERMMMITPNIDNNSDDHHLSLFTAYVQAYKQQEQPQAALLTTTTTT  313

Query  312  QFLRDIFVTFIIAGGDTTASALGSFCSL  395
            +F RD F++ + AG DTT+S L  F  L
Sbjct  314  KFPRDTFLSLMFAGRDTTSSTLTWFFYL  341


 Score = 25.0 bits (53),  Expect(2) = 9e-10, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 3/32 (9%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI---LQLKQNLAKQDKL  475
            LLAQNP V+A   ++I   L LKQ + +  KL
Sbjct  341  LLAQNPLVQANARDEIENKLNLKQEIKRFFKL  372



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 71/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D  F KA+ D    ILYR++     WKLQ  W+  G   EKK+++A+ +
Sbjct  192  DPRSLSIEMPEDE-FSKALDDVGEGILYRHVKPRFLWKLQN-WV--GFGEEKKMTKANAT  247

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I    EEM            +S  +LTS IK        L  +  +FLRD  
Sbjct  248  FDRVCAKYISGKREEMKRSQGVIDKSNVESEDILTSFIKLDTTKYKLLNTSDDKFLRDNI  307

Query  333  VTFIIAGGDTTASALGSF  386
            +TFIIAG DTTASAL  F
Sbjct  308  LTFIIAGRDTTASALSWF  325



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 51/136 (38%), Positives = 73/136 (54%), Gaps = 22/136 (16%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFL---KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA  176
            DP SLC     D P++   KA      A+LYR++L E  WKLQ++   G    E+KLSQA
Sbjct  195  DPRSLC----RDLPYVASEKAFNGTTQALLYRHLLPESIWKLQRWLRVG---EERKLSQA  247

Query  177  DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL---*GNS---MQFLRDIFVT  338
             ++F  FIYPI+ +  E+  K+     D + +L S  K      G+S     FLRD  ++
Sbjct  248  WEAFDEFIYPII-DFNEKNPKS-----DHNNLLASFRKAYEEKNGSSSLTRDFLRDTVLS  301

Query  339  FIIAGGDTTASALGSF  386
             + AG DTT++ L  F
Sbjct  302  LMFAGRDTTSTCLTWF  317



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 73/123 (59%), Gaps = 11/123 (9%)
 Frame = +3

Query  48   FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPIL----E  215
            F KA+ D   AI +R+++ E  WKLQ+ W+  GI  EKKLS+  ++  N I   +    E
Sbjct  201  FAKAMDDVEEAIFFRHVVPESLWKLQR-WL--GIGEEKKLSKGWETIDNVIAEYISMKHE  257

Query  216  EMTEQLNKTQ*QPHDSSGMLTSHIK---TL*GNSMQFLRDIFVTFIIAGGDTTASALGSF  386
            E+++ + K Q +  + + +LTS++    T+   S +FLRD  V F++AG DTT++AL  F
Sbjct  258  ELSKGIAKLQ-EDEEGTDLLTSYMNEDSTMELKSNKFLRDTIVNFLLAGRDTTSAALTWF  316

Query  387  CSL  395
              L
Sbjct  317  FWL  319



>emb|CDY13727.1| BnaA06g31960D [Brassica napus]
Length=463

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP +L ID   ++ F KA+ + +  ILYR I     WKLQ+ W+  GI  EKK+ +A   
Sbjct  187  DPTTLSID-MPENEFYKALTEAIDGILYRKIKPRFLWKLQR-WMRLGI--EKKMLEASDI  242

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIK-------TL*GNSMQFLRDI  329
            F       +    E++ + Q   H S+      +LTS+IK        L  +   FL+D+
Sbjct  243  FYRVCAKYISAKREEVRRLQGISHHSTNEEFKDLLTSYIKLDTTKYKILNPSDDHFLKDV  302

Query  330  FVTFIIAGGDTTASALGSF  386
             +++I+A  DTTASAL  F
Sbjct  303  ILSYIVAARDTTASALTWF  321



>ref|XP_009151941.1| PREDICTED: cytochrome P450 86A7-like [Brassica rapa]
Length=518

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP +L ID   ++ F KA+ + +  ILYR I     WKLQ+ W+  GI  EKK+ +A   
Sbjct  187  DPTTLSID-MPENEFYKALTEAIDGILYRKIKPRFLWKLQR-WMRLGI--EKKMLEASDI  242

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIK-------TL*GNSMQFLRDI  329
            F       +    E++ + Q   H S+      +LTS+IK        L  +   FL+D+
Sbjct  243  FYRVCAKYISAKREEVRRLQGISHHSTNEEFKDLLTSYIKLDTTKYKILNPSDDHFLKDV  302

Query  330  FVTFIIAGGDTTASALGSFCSL  395
             +++I+A  DTTASAL  F  L
Sbjct  303  ILSYIVAARDTTASALTWFFWL  324



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D  F KA+ D    ILYR+      WKLQ  WI  G  +EKKL++A+ +
Sbjct  191  DPRSLSIEMPEDE-FAKALDDVGEGILYRHFKPRFLWKLQN-WI--GFGQEKKLTEANAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-SSGMLTSHIKT-------L*GNSMQFLRDIFVTF  341
            F       +    E++ ++Q   +  S  +LTS IK        L  +  +FLRD  + F
Sbjct  247  FDRVCAKYISAKREEIKRSQGTSNGGSQDLLTSFIKLDTTKYKLLNPSDDKFLRDNILAF  306

Query  342  IIAGGDTTASALGSF  386
            I+AG DTTA+AL  F
Sbjct  307  ILAGRDTTATALSWF  321



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D  F KA+ D    ILYR+      WKLQ  WI  G  +EKKL++A+ +
Sbjct  191  DPRSLSIEMPEDE-FAKALDDVGEGILYRHFKPRFLWKLQN-WI--GFGQEKKLTEANAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-SSGMLTSHIKT-------L*GNSMQFLRDIFVTF  341
            F       +    E++ ++Q   +  S  +LTS IK        L  +  +FLRD  + F
Sbjct  247  FDRVCAKYISAKREEIKRSQGTSNGGSQDLLTSFIKLDTTKYKLLNPSDDKFLRDNILAF  306

Query  342  IIAGGDTTASALGSF  386
            I+AG DTTA+AL  F
Sbjct  307  ILAGRDTTATALSWF  321



>gb|EAZ25521.1| hypothetical protein OsJ_09345 [Oryza sativa Japonica Group]
Length=504

 Score = 63.2 bits (152),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF++A+      +L R+I+    WKL +     G+  E+K+++A +
Sbjct  195  DPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIPLSLWKLARRL---GVGFERKMAEALR  251

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
            + + FIY  +  +  +  K      DS  +L+S++K    N+  FLRD  +T I AG DT
Sbjct  252  TINQFIYETI--VKRRAKKANEGIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDT  309

Query  363  TASALGSFCSL  395
              SAL  F  L
Sbjct  310  IGSALSWFFYL  320


 Score = 24.3 bits (51),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 0/30 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLV  478
            LL +NP V +KIL ++  +++     D +V
Sbjct  320  LLTKNPHVASKILEELDSVERATTTPDGMV  349



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score = 63.9 bits (154),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 69/138 (50%), Gaps = 26/138 (19%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFL---KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA  176
            DP SL +D     P++   KA  D V A+LYR++L E  WKL K+   G   +EKKL +A
Sbjct  198  DPCSLSVD----MPYIPSEKAFNDAVEALLYRHVLPESVWKLLKWLELG---KEKKLVEA  250

Query  177  DQSFSNFIYPIL-----------EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLR  323
             ++F +FIYP++             M     K   +   + G+ TS   T       FLR
Sbjct  251  WKAFDDFIYPLIPSTFEGDKRDDHNMLACFRKAYEEKLSNKGLSTSTTTT-----RDFLR  305

Query  324  DIFVTFIIAGGDTTASAL  377
            D  ++ + AG DTT++ L
Sbjct  306  DTALSLMFAGRDTTSTCL  323


 Score = 23.9 bits (50),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 12/16 (75%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+A+NP  E KIL +I
Sbjct  329  LIAKNPSTETKILEEI  344



>pir||C96517 hypothetical protein F16N3.7 [imported] - Arabidopsis thaliana
 gb|AAD46022.1|AC007519_7 Strong simlarity to gb|286426 F10M6.190 cytochrome p450 homolog 
from Arabidopsis thaliana BAC gb|AL021811. (May be a pseudogene.) 
[Arabidopsis thaliana]
Length=512

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 71/137 (52%), Gaps = 14/137 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ D    I+YR+I     WKLQK WI  GI  EKK+S+A+ +
Sbjct  192  DPRSLSIE-MPEIEFAKALDDVGDVIVYRHITPRFVWKLQK-WI--GIGTEKKMSKANAT  247

Query  186  FSNFIYPILEEMTEQLNK---TQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFV  335
                   ++    E+L           DS  +LTSHI       + L  N  +FLRD  V
Sbjct  248  LDRVCEKLIAAKREELRSQGIIDNANGDSEDLLTSHIMLDATKYELLNPNDDKFLRDFTV  307

Query  336  TFIIAGGDTTASALGSF  386
            +F+ AG D+T+SAL  F
Sbjct  308  SFMAAGRDSTSSALTWF  324



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score = 62.4 bits (150),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 12/137 (9%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I+ P  +  F KA+ D   AI YR++  E+  KLQ+ W+  G   E+KL +A Q
Sbjct  197  DPGCLSIEFPQVE--FSKAMDDAEEAIFYRHLWPEIFLKLQR-WL--GFGHEQKLKEAWQ  251

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKTL*GNSMQ----FLRDIFVTFI  344
            +  + +   +    E+LNK      D  G  +LTS++       ++    FLRD  V F 
Sbjct  252  TLDHMVAEYISRKREKLNKKNTMIEDEDGVDLLTSYMSHPEIMGLKTDDKFLRDTIVNFF  311

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT+SAL  F  L
Sbjct  312  LAGRDTTSSALTWFFWL  328


 Score = 25.0 bits (53),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 19/28 (68%), Gaps = 3/28 (11%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDK  472
            L++QNPQVE+KI     +LK  +  +++
Sbjct  328  LVSQNPQVESKIRE---ELKSTMPAEER  352



>gb|EEC74485.1| hypothetical protein OsI_09945 [Oryza sativa Indica Group]
Length=504

 Score = 62.8 bits (151),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF++A+      +L R+I+    WKL +     G+  E+K+++A +
Sbjct  195  DPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIPLSLWKLARRL---GVGFERKMAEALR  251

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
            + + FIY  +  +  +  K      DS  +L+S++K    N+  FLRD  +T I AG DT
Sbjct  252  TINQFIYETI--VKRRAKKATEGIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDT  309

Query  363  TASALGSFCSL  395
              SAL  F  L
Sbjct  310  IGSALSWFFYL  320


 Score = 24.3 bits (51),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 0/30 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLV  478
            LL +NP V +KIL ++  +++     D +V
Sbjct  320  LLTKNPHVASKILEELDSVERATTTPDGMV  349



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score = 62.0 bits (149),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 71/141 (50%), Gaps = 15/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    +A+ D    ILYR+I  +  WKLQ +   G   +EKK+ +AD +
Sbjct  191  DPRSLSIEMHEDE-LARALDDVGEGILYRHIKPKFLWKLQNWMRIG---QEKKMVEADAT  246

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    S +I    EE+            +S  +L+S IK        L  ++ +FLRD  
Sbjct  247  FDRVCSKYISAKREEIIRSQGILDISNGESEDLLSSFIKLDTTKYKLLNPSNDKFLRDTI  306

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + FI+AG DTTASAL  F  L
Sbjct  307  LAFILAGRDTTASALSWFLWL  327


 Score = 25.4 bits (54),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 11/39 (28%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQL--------KQNLAKQDKLVF  481
            LL++NPQV AKI  +I+          ++NL   DKLV+
Sbjct  327  LLSENPQVVAKIRQEIIDTDLSRTGNGQENL---DKLVY  362



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score = 62.8 bits (151),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 18/131 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ID     P  KA    + A+LYR+IL E  WKLQK W+  G+ +EKKL +A ++
Sbjct  193  DPQSLSID-LPYVPCEKAFNGAIEALLYRHILPESLWKLQK-WL--GVGKEKKLMEAWKA  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM-------QFLRDIFVTFI  344
            F  FIYP        +     +  D + +LT+  K     ++        FLRD  ++ +
Sbjct  249  FDEFIYP-------HITLGNGEQKDDAKLLTTFRKAYEEKNIGSSNGLRVFLRDTALSLM  301

Query  345  IAGGDTTASAL  377
             AG DTT++ L
Sbjct  302  FAGRDTTSTCL  312


 Score = 24.3 bits (51),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 3/26 (12%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI---LQLKQN  454
             L+A+NP  E KIL ++   LQLK++
Sbjct  317  WLIAKNPLTETKILEEMESKLQLKED  342



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ D   AI++R+I     WKLQK WI  GI  EKKL +A  +
Sbjct  200  DPRSLSIE-MPEVEFAKALDDVGDAIVHRHITPRFVWKLQK-WI--GIGTEKKLLEAHAT  255

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHI-------KTL*GNSMQFLRDIF  332
                    +    E+L +TQ   H+++G    +LTSHI       + L     +FLRD  
Sbjct  256  LDRVCAKFIAAKREEL-RTQGTTHNTNGESEDLLTSHIMLDATKYELLNPGDDKFLRDFT  314

Query  333  VTFIIAGGDTTASALGSF  386
            V F+ AG D+TASAL  F
Sbjct  315  VGFMAAGRDSTASALTWF  332



>ref|XP_010447431.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=508

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 71/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   D  F KA+ D    ILYR++     WKLQ  W+  G+  EKK+++A+  
Sbjct  191  DPRSLSVEMPEDE-FAKALDDVGEGILYRHVKPRFLWKLQN-WV--GLGEEKKMTKANAI  246

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I    EEM            +S  +LTS IK        L  +  +FLRD  
Sbjct  247  FDRVCAKYISGKREEMKRSQGVIDKSNVESEDILTSFIKLDTTKYKLLNTSDDKFLRDNI  306

Query  333  VTFIIAGGDTTASALGSF  386
            +TFI+AG DTTASAL  F
Sbjct  307  LTFILAGRDTTASALSWF  324



>emb|CDY13726.1| BnaA06g31970D [Brassica napus]
Length=208

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 14/127 (11%)
 Frame = +3

Query  39   DHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSF----SNFIYP  206
            ++ F KA+ + +  ILYR++     WKLQ+ W+  GI  EKK+ +AD  F    + +I  
Sbjct  3    ENEFDKALTEAIEGILYRHVKPRFLWKLQR-WMGLGI--EKKMLEADDIFYRVCAKYISA  59

Query  207  ILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIFVTFIIAGGDTT  365
              EE+  Q    Q    +   +LTS+IK       TL  +  +FL+D+ +++I+AG DT 
Sbjct  60   KREEVRLQGINHQSPSGEGEDLLTSYIKLDTTQYETLNPSDDRFLKDVILSYIVAGRDTI  119

Query  366  ASALGSF  386
            ASAL  F
Sbjct  120  ASALTWF  126



>gb|ABF93891.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
Length=536

 Score = 63.2 bits (152),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF++A+      +L R+I+    WKL +     G+  E+K+++A +
Sbjct  195  DPGCLAISLPMPKVPFVRAVDYTTRVLLVRHIIPLSLWKLARRL---GVGFERKMAEALR  251

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
            + + FIY  +  +  +  K      DS  +L+S++K    N+  FLRD  +T I AG DT
Sbjct  252  TINQFIYETI--VKRRAKKANEGIEDSEDLLSSYLKDDDENADTFLRDTTMTLIAAGRDT  309

Query  363  TASALGSFCSL  395
              SAL  F  L
Sbjct  310  IGSALSWFFYL  320


 Score = 23.9 bits (50),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 0/30 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLV  478
            LL +NP V +KIL ++  +++     D +V
Sbjct  320  LLTKNPHVASKILEELDSVERATTTPDGMV  349



>ref|XP_010432764.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   D  F KA+ D    ILYR++     WKLQ  W+  G   E+K+++A+  
Sbjct  192  DPRSLSVELPEDE-FAKALDDVGEGILYRHVKPRFLWKLQN-WV--GFGEERKMTKANAI  247

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F    + +I    EEM            +S  +LTS IK        L  +  +FLRD  
Sbjct  248  FDRVCAKYISAKREEMKRSQGVIDISNVESEDILTSFIKLDTTKYKLLNPSDDKFLRDTI  307

Query  333  VTFIIAGGDTTASALGSF  386
            +TFI+AG DTTASAL  F
Sbjct  308  LTFILAGRDTTASALSWF  325



>ref|XP_010680859.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=499

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 69/134 (51%), Gaps = 7/134 (5%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL +D + D P LKA+ D     + R+ +    WKLQ+ W+  G   EKK  Q  +
Sbjct  185  HDPTSLSVD-SPDFPLLKAVADLEHGAIMRHAVPTWIWKLQR-WLNVGY--EKKFRQGWK  240

Query  183  SFSNFIYPILEEMTE-QLNKTQ*QPHDSSGMLTSHIKTL*GNSM--QFLRDIFVTFIIAG  353
               NFIY  ++   E ++NK Q     S  +LT  +     N+   +FLRD    F +AG
Sbjct  241  ILDNFIYNCIDRKRETKVNKDQDFDEVSFDLLTFFMDNEDKNTNDDKFLRDTITNFFLAG  300

Query  354  GDTTASALGSFCSL  395
            G+TT++AL  F  L
Sbjct  301  GETTSTALSWFFYL  314



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 67/134 (50%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F KA+ D   AI +R+I  E  WKLQ Y    G+  EKK+ +A  +
Sbjct  246  DPGCLSLE-MPEIEFAKALDDAEEAIFFRHIKPEFVWKLQNY---VGLGVEKKMRRAQAT  301

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIFVTFI  344
            F       +    E+++       D+  +LTS++         L     +FLRD  +TF+
Sbjct  302  FDRLCAKYISTKREEISLGIHSKGDAKDLLTSYMSVDTTKYELLNPGDDKFLRDTILTFM  361

Query  345  IAGGDTTASALGSF  386
            IAG DTT SAL  F
Sbjct  362  IAGRDTTGSALTWF  375



>ref|XP_006301857.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
 gb|EOA34755.1| hypothetical protein CARUB_v10022327mg [Capsella rubella]
Length=497

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 75/136 (55%), Gaps = 17/136 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA--D  179
            DP SL ++   +  F +A+ DG  A+ YRNI  ++ WKLQ YWI  GI+R+ + + A  +
Sbjct  194  DPMSLSVE-MPEVEFGEAVEDGEEALFYRNIKPKILWKLQ-YWIGIGIERKMRATTATLN  251

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVT  338
            Q  +  I    EE++    +T      S  +LT ++       K L   S +F+RD+ ++
Sbjct  252  QMLAKIISSRREEISRGKRET------SMDVLTYYMNADTTKYKLLKPKSDKFIRDVVLS  305

Query  339  FIIAGGDTTASALGSF  386
             ++AG DTT+SAL  F
Sbjct  306  LMVAGRDTTSSALTWF  321



>ref|XP_010474125.1| PREDICTED: cytochrome P450 86A8-like [Camelina sativa]
Length=314

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 68/138 (49%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGS  I+   +  F  A  D   AI YR+I     WKLQK WI  GI  EKK+ +AD +
Sbjct  41   DPGSFSIE-LPEVEFATAFEDVGEAIFYRHITPRFLWKLQK-WI--GIGAEKKMMKADAT  96

Query  186  FS----NFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIF  332
             +     +I    EE+  Q N  +    D   +LTS IK        L     +FL+D  
Sbjct  97   LTRVCNKYISAKREEVRSQGNNHKSNGEDHEVLLTSFIKLDTTKYDLLNPGDNKFLQDFT  156

Query  333  VTFIIAGGDTTASALGSF  386
            V F+ AG D+TA+A+  F
Sbjct  157  VNFMAAGRDSTAAAITWF  174



>ref|XP_010418988.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=500

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGS+ I+   +  F  A  D   AI YR+I   + WKLQK WI  GI  EKKL +AD +
Sbjct  176  DPGSVSIE-LPEVEFATAFDDVGEAIFYRHITPRLLWKLQK-WI--GIGAEKKLMKADAT  231

Query  186  FS----NFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIF  332
             +     +I    EE+  Q N  +    D   +LTS IK        L     +FL+D  
Sbjct  232  LTRVCNKYISAKREEVRSQGNNHKSNGEDHEVLLTSFIKLDTTKYDLLNPGDNKFLQDFT  291

Query  333  VTFIIAGGDTTASALGSF  386
            V F+ AG D+TA AL  F
Sbjct  292  VNFMAAGRDSTAVALTWF  309



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score = 63.9 bits (154),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 74/139 (53%), Gaps = 15/139 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID   D PF KA+ D    IL R+++ E  W+LQK W+  GI  EKKL +A + 
Sbjct  190  DPGCVSID-FPDVPFSKAMDDAEEVILVRHVMPEAIWRLQK-WL--GIGEEKKLIKAWEI  245

Query  186  FSNFIYPILEEMTEQLNKTQ*Q---PHDSSGMLTSHIKTL*GNSM------QFLRDIFVT  338
              N I   + +  ++L K + +     +   +LT ++K   G  M      +FLRD  + 
Sbjct  246  MDNVIGNYISKKRDKLLKMEPELKLEDEGFDLLTFYLKE--GQYMGVNCDDKFLRDTILN  303

Query  339  FIIAGGDTTASALGSFCSL  395
             +IAG DTT+SAL  F  L
Sbjct  304  LMIAGRDTTSSALTWFIWL  322


 Score = 22.3 bits (46),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+ QNPQVE K+  +I
Sbjct  321  WLVTQNPQVEKKLREEI  337



>emb|CDX72693.1| BnaC07g47150D [Brassica napus]
Length=466

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 66/134 (49%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ D   AI+YR+I     WKLQK WI  GI  EKK+ +A+  
Sbjct  149  DPRSLSIE-MPEVEFAKALDDVGEAIVYRHITPRFLWKLQK-WI--GIGTEKKMMKANAV  204

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIFVTFI  344
                    +    E++   +    +S  +LTSHIK        L     +FLRD  V F+
Sbjct  205  LDRVCAKYISAKREEIRSQENADEESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFM  264

Query  345  IAGGDTTASALGSF  386
             AG D+TA  L  F
Sbjct  265  AAGRDSTACTLTWF  278



>ref|NP_195910.1| cytochrome P450, family 96, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
 emb|CAB86044.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AED90533.1| cytochrome P450, family 96, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
Length=480

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD--  179
            DP SL I+   +  F KA+      I++R++   + WKLQK   C G  +EKK S+AD  
Sbjct  161  DPRSLSIE-MPEVEFAKALDHVGEGIMHRHVRPRLLWKLQK---CVGFGQEKKFSKADAT  216

Query  180  --QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
              Q+ + +I    EE   Q         +S  +LT HIK        L  +  +FLRD  
Sbjct  217  LNQACAKYILEKREETRSQGFDYHSNGSESEDILTYHIKIDTTKYELLNPSDDKFLRDTI  276

Query  333  VTFIIAGGDTTASALGSF  386
            + F++AG DTTASAL  F
Sbjct  277  LAFVLAGRDTTASALTWF  294



>ref|XP_010446497.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=522

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 71/142 (50%), Gaps = 16/142 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D  F+KA+RD  + ILYR+++    WKLQ      G+ +EKKL +AD +
Sbjct  199  DPQSLSIEMPEDE-FMKALRDVEVTILYRHLIPRFIWKLQ---YRMGLGQEKKLREADAT  254

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH-----DSSGMLTSHIK-------TL*GNSMQFLRDI  329
            F       +     ++ K     H     ++  +LT  +K        L     +FLRD+
Sbjct  255  FERMSEKYISAKRNEIRKGFHHDHSDKNGEAEDVLTFFMKLDVTKYELLDPIDDRFLRDV  314

Query  330  FVTFIIAGGDTTASALGSFCSL  395
             + FI+AG DT AS+L  F  L
Sbjct  315  ILGFIVAGRDTIASSLTWFFWL  336



>ref|XP_010275494.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=524

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 71/138 (51%), Gaps = 11/138 (8%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            +DPG L  +  G+    KAI D   AILYRN +  + WKL +    G    EKK+++A +
Sbjct  198  KDPGFLAKELPGN-VVAKAIDDAQEAILYRNFVPMLIWKLMRLLNVGS---EKKMAKAWE  253

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIFVTF  341
               N I  I+ +  EQL     +    + +L+  I++          + M+FLRD+ + F
Sbjct  254  VADNTIIDIILQKKEQLLNGTDESEKINSLLSIFIRSQGQKNEYWSKSRMKFLRDLSLNF  313

Query  342  IIAGGDTTASALGSFCSL  395
            IIAG DTTAS L  F  L
Sbjct  314  IIAGRDTTASGLLWFFWL  331



>ref|XP_010431923.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score = 60.8 bits (146),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 70/141 (50%), Gaps = 15/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  + KA+ D    I YR+I  +  WKLQ  +   G+ +EK++++AD +
Sbjct  191  DPKSLSIE-MPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNLF---GLGQEKRMTEADAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++       H S G    +L+SHIK        L  +  +FLRD  
Sbjct  247  FDRVSAKYISAKREEIRSKGIDHHQSDGESEDLLSSHIKLDTTKYELLKPSEDKFLRDTI  306

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + F +AG DT ASAL  F  L
Sbjct  307  LAFNLAGRDTMASALSWFLWL  327


 Score = 24.6 bits (52),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 20/37 (54%), Gaps = 6/37 (16%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQN------LAKQDKLVF  481
            LL+QNPQV  KI  +I+    +      L   DKLV+
Sbjct  327  LLSQNPQVVTKIRKEIIDKSISKTGSNVLENLDKLVY  363



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 14/141 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG + ID   D PF KA+ D   AIL+R+ L E+ WKLQ++   G    EKKL +A   
Sbjct  189  DPGCVSID-FPDVPFSKAMDDAEEAILFRHALPEIIWKLQRWLRIG---EEKKLIRARET  244

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTF  341
             D + S +I    E++ E  N    +  +   +LT ++K      +    ++LRD  +  
Sbjct  245  LDYTLSKYISKKREKLKEGENVK--ESEEGIDLLTFYLKEEENLGVKCDDKYLRDTILNL  302

Query  342  IIAGGDTTASALGSFCSLHKT  404
            +IAG DTT+SAL  F  L  T
Sbjct  303  MIAGRDTTSSALTWFIWLVST  323



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score = 59.7 bits (143),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 73/139 (53%), Gaps = 17/139 (12%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  PT   PF KA+ D   A+L R+ +    WKLQ+ W+  G+  EKK++ A +
Sbjct  203  DPGCLSIGFPT--IPFAKAMDDATGALLVRHTVPPAWWKLQR-WLRVGV--EKKMALAWE  257

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDS-SGMLTSHIKTL*G-------NSMQF---LRDI  329
                FI   + E  E+ N+++    ++   +L+S++            N M+F   LRD 
Sbjct  258  VMDQFIAQRIAEKKEERNRSRSHEEEAPRDLLSSYVDVCDDLHLVDAENPMEFDKFLRDT  317

Query  330  FVTFIIAGGDTTASALGSF  386
             + F+IAG DTT +AL  F
Sbjct  318  AMNFMIAGRDTTGAALTWF  336


 Score = 25.8 bits (55),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            LL++NP VE+KIL ++  L++  +  D +  
Sbjct  339  LLSKNPLVESKILEELKSLRKKSSCFDNMTL  369



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    ILYR++     WKLQ  W+  G   EKK+++A+ +
Sbjct  191  DPRSLSIEMPEDE-LAKALDDVGEGILYRHVKPRFLWKLQN-WV--GFGEEKKMTRANAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*----QPHDSSGMLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++ ++Q        +S  +LTS IK        L  +  +FLRD  
Sbjct  247  FDRVCAKYISAKREEIKRSQVVTDISVAESGDLLTSFIKLNTTKYKLLNPSDDKFLRDTI  306

Query  333  VTFIIAGGDTTASALGSF  386
            +T I+AG DTTASAL  F
Sbjct  307  LTLILAGRDTTASALSWF  324



>ref|XP_002894062.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70321.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 76/138 (55%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ D   AI++R+I     WKLQK WI  G+  EKK+ +A+ +
Sbjct  200  DPRSLSIE-MSEVEFAKALDDVGDAIVHRHITPRFMWKLQK-WI--GVGTEKKMMEANAT  255

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F      ++    E+L+ +Q   H+++G    +LTS IK        L  +  +FLRD  
Sbjct  256  FDRVCEKLIAAKKEELS-SQVITHNTNGESEDLLTSFIKLDATKYELLNPSDDKFLRDFT  314

Query  333  VTFIIAGGDTTASALGSF  386
            + F+ AG D+TASAL  F
Sbjct  315  IGFMAAGRDSTASALTWF  332



>emb|CDY53178.1| BnaA06g40570D [Brassica napus]
Length=469

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   +  F KA+ D   AI+YR+I     WKLQK++   GI  EKK+ +A+  
Sbjct  152  DPRSLSVE-MPEVEFAKALDDVGEAIVYRHITPRFLWKLQKWF---GIGTEKKMVKANAV  207

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIFVTFI  344
                    +    E++   +    +S  +LTSHIK        L     +FLRD  V F+
Sbjct  208  LDRVCAKYISAKREEIRSQEIADEESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFM  267

Query  345  IAGGDTTASALGSF  386
             AG D+TA  L  F
Sbjct  268  AAGRDSTACTLTWF  281



>ref|XP_006411750.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
 gb|ESQ53203.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
Length=509

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 76/155 (49%), Gaps = 20/155 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    + YR++  +  WKLQ  W+  G+ +EKK+ +A  +
Sbjct  192  DPKSLSIEMHEDE-LAKALNDVGEGVFYRHVKPKFLWKLQN-WM--GLGQEKKMIEASAT  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++N +Q     S G    +LTS +K        L  +  +FLRD  
Sbjct  248  FDRVCAKYISAKREEINSSQGILDTSDGVTEDLLTSFMKLDTTKYKLLNPSDDKFLRDTI  307

Query  333  VTFIIAGGDTTASALGSFCSL-----HKTLKLKQR  422
            + FI+AG DTTASAL  F  L     H   K++Q 
Sbjct  308  LAFILAGRDTTASALSWFFWLLSENPHVVAKIRQE  342



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score = 60.5 bits (145),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 74/137 (54%), Gaps = 12/137 (9%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I+ P  +  F KA+ D   AI YR++  E+  KLQ+ W+  G  +E+KL +A Q
Sbjct  189  DPGCLSIEFPQVE--FSKAMDDAEEAIFYRHLWPEIFLKLQR-WL--GFGQEQKLKEAWQ  243

Query  183  SFSNFIYPILEEMTEQLNK--TQ*QPHDSSGMLTSHIKTL*GNSMQ----FLRDIFVTFI  344
            +  + +   +    E+L+K  T  +  D   +LTS++       ++    FLRD  V F 
Sbjct  244  TLDHMVAEYISRKREKLSKKTTTIEDEDGVDLLTSYMSHPEIMGLKTDDKFLRDTIVNFF  303

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT+SAL  F  L
Sbjct  304  LAGRDTTSSALTWFFWL  320


 Score = 23.9 bits (50),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L++QNPQVE+KI  ++
Sbjct  319  WLVSQNPQVESKIRQEL  335



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    + YR+I     WKLQ  W+  G+ +EKK+SQA+ +
Sbjct  191  DPKSLSIEMHEDE-LAKALEDVGEGVFYRHIKPRFMWKLQN-WM--GLGQEKKMSQANAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH-DSSGMLTSHIKT-------L*GNSMQFLRDIFVTF  341
            F       +    E++ ++Q   + +   +LTS +K        L  +  +FLRD  + F
Sbjct  247  FDRVCSRYISAKREEIIRSQGVLNGEGEDLLTSFMKLDTAKYKLLKPSDDKFLRDTILAF  306

Query  342  IIAGGDTTASALGSF  386
            I+AG DTTASAL  F
Sbjct  307  ILAGRDTTASALSWF  321



>ref|XP_010482535.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=520

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 70/140 (50%), Gaps = 18/140 (13%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL ID P  +    KA+ D V  I YR++     WKLQK+    G+  EKK+++A  
Sbjct  193  DPRSLSIDMPEVESA--KALDDIVEGIKYRHVKPRFLWKLQKW---TGVGIEKKMTEAGA  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRD  326
             F       +    E++ ++Q   HD     S  +LTSHIK        L   + +FLRD
Sbjct  248  IFDRVCAKYISARREEIKRSQGIDHDHCDGESEDLLTSHIKLDTTKYQLLDPINDKFLRD  307

Query  327  IFVTFIIAGGDTTASALGSF  386
              +  I+AG DT ASAL  F
Sbjct  308  NVLALILAGRDTIASALTWF  327



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 72/139 (52%), Gaps = 10/139 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID   D PF KA+ D   AIL+R+ L E+ WKLQ++   G    EKKL +A ++
Sbjct  189  DPGCVSID-FPDVPFSKAMDDAEEAILFRHALPEIIWKLQRWLRIG---EEKKLIRARET  244

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKTL*GNSMQ----FLRDIFVTFII  347
                I   + +  ++L +         G  +LT ++K      ++    +LRD  +  +I
Sbjct  245  LDYTISKYISKKRDELKEGDKLKESEEGFDLLTFYLKEEENLGVKCDDNYLRDTILNLMI  304

Query  348  AGGDTTASALGSFCSLHKT  404
            AG DTT+SAL  F  L  T
Sbjct  305  AGRDTTSSALTWFIWLVST  323



>ref|XP_004237152.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=516

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 50/141 (35%), Positives = 73/141 (52%), Gaps = 20/141 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPGSL +D   +  F+KA+ D    ++ RN+L    WKLQK W+  GI  EKKL  A   
Sbjct  195  DPGSLSVD-LNNIAFMKAMNDMGEVMVIRNLLPRCVWKLQK-WL--GIGPEKKLRDAREV  250

Query  177  -DQSFSNFIYPILEEMT---EQLNKTQ*QPHDSSGMLTSHIKTL*GNSM-------QFLR  323
             D+    +I    +E+    ++LNK +    +   +L S+I    G +        +FLR
Sbjct  251  IDRVIGKYITMKRDELRAKGKKLNKNE--EEEGVDLLASYIANDDGETKTGLMFDDKFLR  308

Query  324  DIFVTFIIAGGDTTASALGSF  386
            D  + F+IAG DTT+S L  F
Sbjct  309  DTILNFMIAGRDTTSSGLTWF  329



>ref|XP_010437072.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=522

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D  F+KA+RD  + ILYR+++    WKLQ      G+ +EKKL +AD +
Sbjct  199  DPQSLSIEMPEDE-FMKALRDVEVTILYRHLIPRFIWKLQ---YRMGLGQEKKLIEADAT  254

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH-DSSG----MLTSHIK-------TL*GNSMQFLRDI  329
            F       +     ++ +     H DS+G    +LT  +K        L     +FLRD+
Sbjct  255  FERLSEKYISAKRNEIRQGLHHDHSDSNGEAEDVLTFFMKLDATKYELLDPIDDRFLRDV  314

Query  330  FVTFIIAGGDTTASALGSFCSL  395
             + FI++G DT AS+L  F  L
Sbjct  315  ILGFIVSGRDTIASSLTWFFWL  336



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 71/135 (53%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ID   D  F +A+ +   AI +R++  EM WK+Q+ WI  GI  E K+ +A  +
Sbjct  193  DPGCLSID-LPDIEFARALNEAEEAIFFRHVKPEMVWKMQR-WI--GIGDELKMKKAHST  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-MLTSHI-------KTL*GNSMQFLRDIFVTF  341
            F       +    +++ +       SS  +L S+I       K L  +  +FLRD+ ++F
Sbjct  249  FDRVCSKCIASKRDEITRGVINIDSSSKDLLMSYINVDTTKYKLLNPSDEKFLRDMILSF  308

Query  342  IIAGGDTTASALGSF  386
            ++AG DTT SAL  F
Sbjct  309  MLAGRDTTGSALTWF  323



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = +3

Query  45   PFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA----DQSFSNFIYPIL  212
            PF  A+ D   AIL+R++L E  W+LQ+ W+  GI +EKK  +A    D + + +I    
Sbjct  216  PFATALEDAEEAILHRHVLPETLWRLQR-WL--GIGKEKKHQKAWETLDHTIAEYISKKR  272

Query  213  EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTFIIAGGDTTASALG  380
            +E+++ +   Q +  D   +LTS++       +    +FLRD  + F+IAG DTT+SAL 
Sbjct  273  DELSKGIINLQ-EEEDGVDLLTSYMSEDITMGLKCDHKFLRDTILNFMIAGRDTTSSALT  331

Query  381  SF  386
             F
Sbjct  332  WF  333



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 71/141 (50%), Gaps = 13/141 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L  +   D PF KA+ +   AIL R+ L E  W+L K     GI  EKKLS+A   
Sbjct  190  DPGCLSTE-FPDVPFSKAMDEAEEAILMRHCLPESLWRLGK---LLGIGPEKKLSRAWTV  245

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ----FLRDIFVTF  341
             D     ++    EEM++  NK      +   +LTS+I       ++    FLRD  + F
Sbjct  246  LDDVIGKYVSMKREEMSKS-NKCNEDDDEGLDLLTSYINGDESTGLECNDKFLRDTILNF  304

Query  342  IIAGGDTTASALGSFCSLHKT  404
            +IAG DTT+SAL  F  L  T
Sbjct  305  MIAGRDTTSSALTWFLWLVST  325



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 81/165 (49%), Gaps = 19/165 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR+I  EM WK+Q+ WI  G+  E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHIKPEMVWKMQR-WI--GVGDELKLKRAHAV  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG---MLTSHI-------KTL*GNSMQFLRDIFV  335
            F       +    +++++ +     SS    +L S I       K L  +  +FLRD  +
Sbjct  248  FDRVCSECIASKRDEISRGRTDNISSSSSKDLLMSSINVDTTKYKLLNPSDDRFLRDTIL  307

Query  336  TFIIAGGDTTASALGSFCSL-----HKTLKLKQRSSTISFN*NKT  455
            +F++AG DTT SAL  F  L         K++Q  +T  F  NKT
Sbjct  308  SFMLAGRDTTGSALTWFFWLLCKNQEAVAKIRQEINTNLFPGNKT  352



>ref|XP_009101869.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Brassica rapa]
Length=479

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 65/134 (49%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   +  F KA+ D   AI+YR+I     WKLQK++   GI  EKK+ +A+  
Sbjct  162  DPRSLSVE-MPEVEFAKALDDVGEAIVYRHITPRFLWKLQKWF---GIGTEKKMVKANAV  217

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIFVTFI  344
                    +    E +   +    +S  +LTSHIK        L     +FLRD  V F+
Sbjct  218  LDRVCAKYISAKREDIRSQEIADEESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFM  277

Query  345  IAGGDTTASALGSF  386
             AG D+TA  L  F
Sbjct  278  AAGRDSTACTLTWF  291



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score = 57.4 bits (137),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = +3

Query  54   KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPIL--EEMTE  227
            KA  D + A+LYR++L E  WK  K     GI +EK+L+ A + F +FIYP L   +   
Sbjct  196  KAFNDVIDALLYRHVLPEFLWKAMKNL---GIGKEKRLTAAKEVFDSFIYPKLGGGDRDC  252

Query  228  QLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASAL  377
             + +T     D +  +   ++   G+S +FLRD  ++ + AG DTT++ L
Sbjct  253  TMLRTFTAAVDENDAVLGPLE---GSSAKFLRDTALSLMFAGRDTTSTCL  299


 Score = 26.6 bits (57),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 1/30 (3%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKL  475
             LL QNP  E KIL +I + K NL   D+ 
Sbjct  304  WLLTQNPSAEGKILGEI-EEKLNLRPGDRW  332



>ref|XP_002870817.1| hypothetical protein ARALYDRAFT_916433 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47076.1| hypothetical protein ARALYDRAFT_916433 [Arabidopsis lyrata subsp. 
lyrata]
Length=533

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 74/150 (49%), Gaps = 24/150 (16%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+ +    F KA+ D   AI+YR++  +  WKLQ+     G  +EKKLS+AD +
Sbjct  195  DPRSLSIEMSEVDEFAKALNDVGEAIMYRHVKPKFLWKLQRRI---GFGQEKKLSKADAT  251

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIF  332
                 + FI    EE+  Q + T     +   +LTSH+K        L  N  +FLRD  
Sbjct  252  LNRMCAKFILDKREEIRSQ-DFTHNFNDEGDDLLTSHMKLDATKYELLNPNDDKFLRDTM  310

Query  333  VTFIIAG---------GDTTASALGSFCSL  395
            + FI+ G          DTTASAL  F  L
Sbjct  311  LAFILVGRDTGPDRPWRDTTASALTWFFWL  340



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 65/134 (49%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   +  F KA+ D   AI+YR+I     WKLQK++   GI  EKK+ +A+  
Sbjct  200  DPRSLSVE-MPEVEFAKALDDVGEAIVYRHITPRFLWKLQKWF---GIGTEKKMVKANAV  255

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIFVTFI  344
                    +    E +   +    +S  +LTSHIK        L     +FLRD  V F+
Sbjct  256  LDRVCAKYISAKREDIRSQEIADEESEDLLTSHIKLDASKYELLNPEDDKFLRDFTVGFM  315

Query  345  IAGGDTTASALGSF  386
             AG D+TA  L  F
Sbjct  316  AAGRDSTACTLTWF  329



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 70/124 (56%), Gaps = 16/124 (13%)
 Frame = +3

Query  45   PFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA----DQSFSNFIYPIL  212
            PF  A+ D   A+ YR+ L E  W+L + W+  GI +EKKL +     D + + +I    
Sbjct  164  PFATALEDVEEAVFYRHALPETLWRLLR-WL--GIGKEKKLRKGWKTLDHTIAEYISMKR  220

Query  213  EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM------QFLRDIFVTFIIAGGDTTASA  374
            EE+++ + K + +  D + +LTS++     N++      +FLRD  + F+IAG DTT+SA
Sbjct  221  EELSKGITKLR-EDEDGADLLTSYMTE--DNAIGLKCDGKFLRDTILNFMIAGRDTTSSA  277

Query  375  LGSF  386
            L  F
Sbjct  278  LTWF  281



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 16/127 (13%)
 Frame = +3

Query  45   PFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA----DQSFSNFIYPIL  212
            PF  A+ D   A+ YR+ L E  W+L + W+  GI +EKKL +     D + + +I    
Sbjct  200  PFATALEDVEEAVFYRHALPETLWRLLR-WL--GIGKEKKLRKGWKTLDHTIAEYISMKR  256

Query  213  EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM------QFLRDIFVTFIIAGGDTTASA  374
            EE+++ + K + +  D + +LTS++     N++      +FLRD  + F+IAG DTT+SA
Sbjct  257  EELSKGITKLR-EDEDGADLLTSYMTE--DNAIGLKCDGKFLRDTILNFMIAGRDTTSSA  313

Query  375  LGSFCSL  395
            L  F  L
Sbjct  314  LTWFFWL  320



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFL---KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA  176
            DPGSL    +   P++   KA    +  ++YR++L E+ WK+QK W+   I  EKKLS++
Sbjct  152  DPGSL----SAALPYIPCEKAFSIALQPLMYRHVLPEIIWKMQK-WL--NIGNEKKLSES  204

Query  177  DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
             ++F +FIYPI+    E++N        ++    ++     G+S +FLRD  +  + AG 
Sbjct  205  WKAFDDFIYPIISS-KEKINLDVFTAFRNA--YENNNNNFSGDSRKFLRDSLLGLLFAGR  261

Query  357  DTTASAL  377
            DTT++ L
Sbjct  262  DTTSTCL  268



>gb|EYU43136.1| hypothetical protein MIMGU_mgv1a007195mg [Erythranthe guttata]
Length=415

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 70/139 (50%), Gaps = 7/139 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SLC +     P  KA  D   A+LYR++L E+ WKLQ +   G   +E KL++A   
Sbjct  116  DPVSLCKE-LPHLPHEKAFADAEEAVLYRHVLPEILWKLQSWLRIG---KENKLTKAKDV  171

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTT  365
               F+   +    +  N T   P+D   MLTS +++   + + + +D  ++ I AG DT 
Sbjct  172  IHRFLSECISVKHQHFNLT--GPNDGLDMLTSCMRSSLADEVIW-KDTLLSLIFAGKDTI  228

Query  366  ASALGSFCSLHKTLKLKQR  422
            ++AL  F  L  T   +Q 
Sbjct  229  SAALAWFFWLVATNPAEQE  247



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score = 58.5 bits (140),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 6/125 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SLC++     P  KA    V  +L R+I+ E  WKLQK    G    EK+L +A Q+
Sbjct  182  DPSSLCVE-LPHIPCEKAFSHSVEPLLLRHIVPESIWKLQKRLKIGS---EKQLMEASQN  237

Query  186  FSNFIYPILE-EMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
            F +FIYP++  +  EQ N T             H+    G    FL+D  ++ I AG DT
Sbjct  238  FDDFIYPLISLKNGEQENDTNLLTVFRKVYEEKHVGPSSG-LRDFLKDTSLSLIFAGRDT  296

Query  363  TASAL  377
            T++ L
Sbjct  297  TSTCL  301


 Score = 23.9 bits (50),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 23/42 (55%), Gaps = 10/42 (24%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI---LQLKQ-------NLAKQDKLVF  481
             L+A+NP  E KIL +I   L LK+       N+ +  KL++
Sbjct  306  WLIARNPLTETKILEEIHTVLHLKEDKKWRRFNVEESHKLIY  347



>ref|XP_002868909.1| CYP96A12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45168.1| CYP96A12 [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 16/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  + KA+ D    I YR+I  +  WKLQ  +   G+ +EK++++AD +
Sbjct  190  DPKSLSIE-MPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNRF---GLGQEKRMTEADAT  245

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++ ++Q   H S+G    +LTSHIK        L  +  +FLRD  
Sbjct  246  FDRVSAKYISAKREEI-RSQGIDHHSNGQSEDLLTSHIKLDTTKYELLNPSDDKFLRDTI  304

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + F +AG DT +SAL  F  L
Sbjct  305  LAFNLAGRDTMSSALSWFFWL  325



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 15/142 (11%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
             DP SL +D + D P LKA+ D       R+ +    WKLQ+ W+  G   EKK  Q  +
Sbjct  182  HDPTSLSVD-SPDFPLLKAVADMAHGAFIRHAVPTWIWKLQR-WLNVG--EEKKFRQGWK  237

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSG----------MLTSHIKTL*GNSM-QFLRDI  329
               NFIY  ++   E   K    P  ++           +LT  +     N+  +FLRD 
Sbjct  238  ILDNFIYKCIDRKREAKAKGASIPSKTNNKDQDFEVSYDLLTFFMDNEDKNTNDKFLRDT  297

Query  330  FVTFIIAGGDTTASALGSFCSL  395
               F +AGG+TT++AL  F  L
Sbjct  298  ITNFFLAGGETTSTALSWFFYL  319



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score = 59.3 bits (142),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (50%), Gaps = 10/139 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID   D PF KA+ D   AIL+R+ L E+ WKLQ++   G    EKK+  A + 
Sbjct  189  DPGCVSID-FPDVPFSKAMDDVEEAILFRHALPEIVWKLQRWLRIG---EEKKMINAQEV  244

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKTL*GNSM----QFLRDIFVTFII  347
                I   + +  E L +         G  +LT ++K      +    +FLRD  +  +I
Sbjct  245  LDYTIDKYISKKREDLKEGDDLKESEEGFDLLTFYLKDEKSLGVKCDDKFLRDNILNLMI  304

Query  348  AGGDTTASALGSFCSLHKT  404
            AG DTT+SAL  F  L  T
Sbjct  305  AGRDTTSSALTWFIWLVST  323


 Score = 22.7 bits (47),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLVFNI  487
             L++ NPQVE KI ++I  +  N   +   +FN+
Sbjct  319  WLVSTNPQVEKKIRDEINFVIPNEEVEKFKLFNV  352



>gb|EPS57870.1| hypothetical protein M569_16947 [Genlisea aurea]
Length=505

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 76/148 (51%), Gaps = 15/148 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   + PF  A+ D   AI  R++L E  WK++++    GI  E+KL +A  +
Sbjct  184  DPGCLTLD-LPEVPFSSAMDDAEEAIFMRHVLPEFVWKIERFL---GIGHEEKLRRARAT  239

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM------QFLRDIFVTFII  347
                +   ++   +++++       +  +LT++I    G S+      +FLRD  +  +I
Sbjct  240  LDAAVQGYIDMKRDEISRKVSGETPAVDLLTAYIDE--GESITNERDDKFLRDSILNLMI  297

Query  348  AGGDTTASALGSF---CSLHKTLKLKQR  422
            AG DTT+SAL  F    S H  ++ K R
Sbjct  298  AGRDTTSSALTWFTWLVSTHPEVRRKIR  325



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score = 58.5 bits (140),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 69/140 (49%), Gaps = 11/140 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + ID   D PF KA+ D   AIL+R+ L E+ WKLQ++   G    EKK+  A + 
Sbjct  189  DPGCVSID-FPDVPFSKAMDDAEEAILFRHALPEIVWKLQRWLRIG---EEKKMINAQEV  244

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS---GMLTSHIKTL*GNSM----QFLRDIFVTFI  344
                I   +    E L +      +S     +LT ++K      +    +FLRD  +  +
Sbjct  245  LDYTIDKYISMKREDLKEVDHDLKESEEGFDLLTFYLKDEKELGVKCDDKFLRDNILNLM  304

Query  345  IAGGDTTASALGSFCSLHKT  404
            IAG DTT+SAL  F  L  T
Sbjct  305  IAGRDTTSSALTWFIWLVST  324


 Score = 23.1 bits (48),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLVFNI  487
             L++ NPQVE KI ++I  +  N   +   +FN+
Sbjct  320  WLVSTNPQVEKKIRDEINFVIPNEEGEKFRLFNV  353



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 84/165 (51%), Gaps = 21/165 (13%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  ++   KA+ D    I YR+I  +  WKLQ  W+  G+ +EK++++AD 
Sbjct  191  DPKSLTIEMPAVEYA--KALDDLGEGIFYRHIKPKFLWKLQN-WM--GLGQEKRMAKADA  245

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDI  329
            +F       +    E++ ++Q   H S G    +L+SHIK        L  +  +FLRD 
Sbjct  246  TFDRVSAKYITAKREEI-RSQGIDHHSDGESEDLLSSHIKLDTTKYELLKPSDDKFLRDT  304

Query  330  FVTFIIAGGDTTASALGSF---CSLHKTLKLKQRSSTISFN*NKT  455
             + F +AG DT ASAL  F    S +  +  K R   I  N +KT
Sbjct  305  ILAFNLAGRDTMASALSWFFWLLSENPQVVTKIRKEIIDKNISKT  349



>ref|NP_195661.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
 emb|CAB44686.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80614.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAL24225.1| AT4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AAO23590.1| At4g39510/F23K16_140 [Arabidopsis thaliana]
 gb|AEE87080.1| cytochrome P450, family 96, subfamily A, polypeptide 12 [Arabidopsis 
thaliana]
Length=508

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 75/141 (53%), Gaps = 16/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  + KA+ D    I YR+I  +  WKLQ  +   G+ +EK++++AD +
Sbjct  191  DPKSLSIE-MPEVEYAKALDDLGEGIFYRHIKPKFFWKLQNRF---GLGQEKRMTEADAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++ ++Q   H ++G    +LTSHIK        L  +  +FLRD  
Sbjct  247  FDRVSAKYILAKREEI-RSQGIDHHANGESEDLLTSHIKLDTTKYELLNPSDDKFLRDTI  305

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + F +AG DTT+SAL  F  L
Sbjct  306  LAFNLAGRDTTSSALSWFFWL  326



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI +R++  E+ WK++ +    G+  EKK+++A  +
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFFRHVKPEILWKMESFI---GLGDEKKMTKARAT  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
            F       +    +++      P  S  +LTS++       K L  +  +FLRD  +TF+
Sbjct  248  FDRVCSKYIASKRDEVITNIDSPPASQDLLTSYMNLETTKYKLLDPSDDRFLRDTILTFM  307

Query  345  IAGGDTTASAL  377
            +AG DTT S L
Sbjct  308  LAGRDTTGSGL  318



>gb|EPS67771.1| hypothetical protein M569_06997, partial [Genlisea aurea]
Length=490

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 64/127 (50%), Gaps = 11/127 (9%)
 Frame = +3

Query  6    DPGSLCIDPT-GDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP  LC+ P   + PF  A+     +I  R+IL E  WKLQ+ WI  GI  EK+L QA Q
Sbjct  183  DP--LCLSPELPEVPFSAAMDAAEDSIFMRHILPETIWKLQR-WI--GIGSEKRLKQAKQ  237

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM--QFLRDIFVTFIIAGG  356
                 I   +    E+L          S +LTS+I     N    +FLRD  +  +IAG 
Sbjct  238  ILDTVIAEYITRKREELLTGN---SGGSDLLTSYILDSENNDPDDKFLRDTILNLMIAGR  294

Query  357  DTTASAL  377
            DTT+SAL
Sbjct  295  DTTSSAL  301



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 8/127 (6%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SLC+D P    P +KA  D + A+ +R+IL E  WKLQK     GI RE+KL +  +
Sbjct  198  DPKSLCVDLPVI--PSMKAFCDSIEAVFHRHILPEFVWKLQKRL---GIGRERKLLEGRK  252

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM--QFLRDIFVTFIIAGG  356
                FIYP+L    +  N         +    +    L G+S   +F+RD  +  ++AG 
Sbjct  253  IVDEFIYPLLAINNDDDNLNLLTNFTKAYEEKNVSSLLRGDSSRNKFMRDTVLGLLLAGR  312

Query  357  DTTASAL  377
            DT+++ L
Sbjct  313  DTSSTCL  319



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 79/154 (51%), Gaps = 17/154 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   D+PF KA+ +    +  R++L E  WKLQK W+  G   EKKLS+A Q 
Sbjct  194  DPGCLSLE-FPDNPFSKAMDEAEEVLFIRHLLPESVWKLQK-WL--GFGHEKKLSKAWQV  249

Query  186  FSNFIYPILEEMTEQL-NKTQ*QPHDSSG--MLTSHIKTL*GNSMQF----LRDIFVTFI  344
                I   +    ++L N T+ +  +  G  +LTS+I     + + F    LRD  +  +
Sbjct  250  LDQVIGKYISMKRDELSNGTKLKEDNEEGFDLLTSYIL---DDGLNFDDKSLRDTILNLM  306

Query  345  IAGGDTTASALGSF---CSLHKTLKLKQRSSTIS  437
            IAG DTT+S L  F    S H  ++ K R   ++
Sbjct  307  IAGRDTTSSGLTWFIWLVSTHPEVEKKIREELMA  340



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 15/161 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR++  EM WK+Q+     G+  E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHVKPEMVWKIQRLI---GVGDELKLKRAHAV  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML------TSHIKTL*GNSMQFLRDIFVTFII  347
            F+      +    +++N+       +  ++      T+  K L  +  +FLRD  ++F++
Sbjct  248  FNRVCSECIASKRDEINRGDGSSSSNDLLMSSLNVDTTKYKLLNPSDDRFLRDTILSFML  307

Query  348  AGGDTTASALGSF----CSLHKTL-KLKQRSSTISFN*NKT  455
            AG DTT SAL  F    C   + + K++Q  +T  F  NK 
Sbjct  308  AGRDTTGSALTWFFWLLCKNQEAMAKIRQEINTNLFPRNKN  348



>ref|XP_010446498.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 15/135 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  + KA+ D    I YR+I  +  WKLQ  +   G+ +EK++++AD +
Sbjct  191  DPKSLSIE-MPEVEYAKALDDLGEGIFYRHIKPKFLWKLQNLF---GLGQEKRMTKADAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
            F       +    E++       H S G    +L+SHIK        L  +  +FLRD  
Sbjct  247  FDRVSAKYISAKREEIRSKGIAHHHSDGESEDLLSSHIKLDTTKYELLKPSEDKFLRDTI  306

Query  333  VTFIIAGGDTTASAL  377
            + F +AG DT ASAL
Sbjct  307  LAFNLAGRDTMASAL  321



>ref|NP_175193.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 gb|AAD46023.1|AC007519_8 Strong simlarity to gb|286426 F10M6.190 cytochrome p450 homolog 
from Arabidopsis thaliana BAC gb|AL021811 [Arabidopsis thaliana]
 gb|AAQ89636.1| At1g47620 [Arabidopsis thaliana]
 dbj|BAD44042.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44086.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32195.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=520

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 73/138 (53%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ D   AI++R+I     WKLQK WI  GI  EKK+ +A  +
Sbjct  200  DPRSLSIE-MPEVEFSKALDDVGDAIVHRHITPRFVWKLQK-WI--GIGTEKKMLKAHAT  255

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIK-------TL*GNSMQFLRDIF  332
            F      I+    E+L  +Q   ++S+G    +LTS IK        L  +  +FLRD  
Sbjct  256  FDRVCEKIIAAKREELG-SQGITYNSNGEREDLLTSFIKLDATKYEVLKPSHDKFLRDFT  314

Query  333  VTFIIAGGDTTASALGSF  386
            + F+ AG D+TAS L  F
Sbjct  315  IGFMAAGRDSTASTLTWF  332



>ref|XP_006404465.1| hypothetical protein EUTSA_v10010970mg [Eutrema salsugineum]
 gb|ESQ45918.1| hypothetical protein EUTSA_v10010970mg [Eutrema salsugineum]
Length=509

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 68/136 (50%), Gaps = 15/136 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL +    D  F+ A+ D  +AI+YR+++    WKLQK     G+ +EKKL +AD  
Sbjct  199  DPKSLSVQMANDE-FVNALEDVEVAIIYRHMMPRFLWKLQKKM---GLGQEKKLIEADAV  254

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIK--TL*GNSMQFLRDIFVTFII  347
            F       + +  +++       H ++G    +LT  IK   L     + LRD+ V FI+
Sbjct  255  FDRLCGKYVTDKRDEIRH-----HSNNGDFVDLLTFFIKFGLLEPIDDKLLRDVIVGFIL  309

Query  348  AGGDTTASALGSFCSL  395
            A  DT AS L  F  L
Sbjct  310  AARDTIASTLTWFFWL  325



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score = 53.5 bits (127),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA  +   +I YR+++    WK+Q+ W+   I +EKK+++A ++
Sbjct  152  DPNCLSID-FSEVAIEKAFNEAEESIFYRHVVPRCVWKIQR-WL--QIGQEKKMTEACKT  207

Query  186  FSNFIYPILEEMTEQL---NKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
               FI+  +    E+L   N+ +        +LT+ ++    +  +FLRD      +AG 
Sbjct  208  LDQFIHARIASKREELSKYNENEMGEAHHVDLLTALMREGKAHDDKFLRDAVFNLFVAGR  267

Query  357  DTTASALGSFCSLHKT  404
            DT  SAL  F  L  T
Sbjct  268  DTITSALTWFFWLVAT  283


 Score = 26.9 bits (58),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDK  472
             L+A NP VEAKIL    ++K+ L  ++K
Sbjct  279  WLVATNPSVEAKILE---EMKEKLGTKEK  304



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 14/120 (12%)
 Frame = +3

Query  48   FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTE  227
            F KA+ D   A+ YR+I+ E  WK Q+ W+  GI +EKK+++A++   +     +    E
Sbjct  201  FSKALDDAEEALFYRHIIPEFIWKFQR-WL--GIGQEKKMAKAEKVLDDTSRKYISRKRE  257

Query  228  QLNKTQ*QPHDSSGMLTSHIKTL*GNSM-------QFLRDIFVTFIIAGGDTTASALGSF  386
            QL K      +   MLTS++    G  +       +FLRD  +  ++AG DTT+SAL  F
Sbjct  258  QLVKN--NKGEGVDMLTSYMNE--GEKILESKPDEKFLRDTIINLLLAGRDTTSSALTWF  313



>gb|EMS45869.1| Cytochrome P450 86B1 [Triticum urartu]
Length=508

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 47/142 (33%), Positives = 74/142 (52%), Gaps = 10/142 (7%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF +A+ D +  ++ R+I+   CW+L   +  G    EKK++ A +
Sbjct  191  DPGCLQIGLPV--VPFARAMDDVLATVILRHIIPPACWRLMYRYELG---PEKKMAVARR  245

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN-SMQFLRDIFVTFIIAGGD  359
            +   F   ++ +   + N       +SS ML+S I    G+ S +FLRD  V  ++AG D
Sbjct  246  TIDQFAADMIAKRKSEHNLCGESVSESSDMLSSFISN--GDASDEFLRDTAVNLLLAGRD  303

Query  360  TTASALGSFCSLH-KTLKLKQR  422
            TT +AL  F  L  K  +++QR
Sbjct  304  TTGTALSWFFYLLCKNPRVEQR  325



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score = 53.5 bits (127),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 66/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA  +   +I YR++L    WK+Q+ W+   I +EKK+++A ++
Sbjct  189  DPNCLSID-FSEVAIEKAFNEVEESIFYRHVLPRCVWKIQR-WL--QIGQEKKMTEACKT  244

Query  186  FSNFIYPILEEMTEQL---NKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
               FI+  +    E+L   N+ +         LT+ ++    +  +FLRD      +AG 
Sbjct  245  LDQFIHACIASKREKLSKYNENEMGEAHHVDFLTALMREETAHDDKFLRDAVFNLFVAGR  304

Query  357  DTTASALGSFCSLHKT  404
            DT  SAL  F  L  T
Sbjct  305  DTITSALTWFFWLVAT  320


 Score = 26.9 bits (58),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDK  472
             L+A NP VEAKIL    ++K+ L  ++K
Sbjct  316  WLVATNPSVEAKILE---EMKEKLGTKEK  341



>ref|XP_010442700.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=419

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 71/140 (51%), Gaps = 18/140 (13%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  +    KA+ D V  I YR++     WKLQ  WI  GI  EKK+++A  
Sbjct  193  DPRSLSIEMPEVESA--KALDDIVDGIKYRHVKPRFLWKLQN-WIGVGI--EKKMTEAGA  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRD  326
             F       +    E++ ++Q   +D     S  +LTSHIK        L   + +FLRD
Sbjct  248  IFDRVCAKYISARREEIKRSQGSNNDNFSGESEDLLTSHIKLDTTKYQLLDPINDKFLRD  307

Query  327  IFVTFIIAGGDTTASALGSF  386
              +  ++AG D+TASAL  F
Sbjct  308  NVLALLLAGRDSTASALTWF  327



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score = 53.1 bits (126),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA  +   +I YR+++    WK+Q+ W+   I +EKK+++A ++
Sbjct  192  DPNCLSID-FSEVAIEKAFNEAEESIFYRHVVPRCVWKIQR-WL--QIGQEKKMTEACKT  247

Query  186  FSNFIYPILEEMTEQL---NKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
               FI+  +    E+L   N+ +        +LT+ ++    +  +FLRD      +AG 
Sbjct  248  LDQFIHARIASKREELSKYNENEMGEAHHVDLLTALMREGKAHDDKFLRDAVFNLFVAGR  307

Query  357  DTTASALGSFCSLHKT  404
            DT  SAL  F  L  T
Sbjct  308  DTITSALTWFFWLVAT  323


 Score = 26.9 bits (58),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 3/29 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDK  472
             L+A NP VEAKIL    ++K+ L  ++K
Sbjct  319  WLVATNPSVEAKILE---EMKEKLGTKEK  344



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 77/162 (48%), Gaps = 17/162 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR++  EM WK+Q+    GG   E KL +A   
Sbjct  193  DPGCLSVE-MPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLIGVGG---ELKLKRAHAI  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML--------TSHIKTL*GNSMQFLRDIFVTF  341
                    +    E++++       SS  L        TS  K L  +  +FLRD  ++F
Sbjct  249  LDRVCSECIASKREEISRGSDNISSSSKDLLMSSIHVDTSKYKLLNPSDDRFLRDTILSF  308

Query  342  IIAGGDTTASALGSF----CSLHKTL-KLKQRSSTISFN*NK  452
            ++AG DTT SAL  F    C   + + K++Q  +T  F  NK
Sbjct  309  MLAGRDTTGSALTWFFWLLCKNQEAMAKIRQEINTNLFPGNK  350



>ref|XP_002894061.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70320.1| CYP96A8 [Arabidopsis lyrata subsp. lyrata]
Length=521

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 74/138 (54%), Gaps = 16/138 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP +L I+   +  F KA+ D   AI++R+I     WKLQK WI  G+  EKK+ +A  +
Sbjct  200  DPRNLSIE-MPEVEFAKALDDVGDAIVHRHITPRFVWKLQK-WI--GVGTEKKMMEAHAT  255

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHIKT-------L*GNSMQFLRDIF  332
                   ++    E+L+ +Q   H+++G    +LTS IK        L  +  +FLRD  
Sbjct  256  LDRVCEKLIAAKKEELS-SQVITHNTNGESEDLLTSFIKLDATKYELLNPSDDKFLRDFT  314

Query  333  VTFIIAGGDTTASALGSF  386
            + F+ AG D+TASAL  F
Sbjct  315  IGFMAAGRDSTASALTWF  332



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI +R++  E+ WK++ +    G+  EKK+++A  +
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFFRHVKPEILWKMESFI---GLGDEKKMTKARAT  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
            F       +    +++      P  S  +LTS++       K L  +  +FLRD  +TF+
Sbjct  248  FDRVCSKYIASKRDEVITNIDSPPASQDLLTSYMNLETTKYKLLDPSDDRFLRDTILTFM  307

Query  345  IAGGDTTASAL  377
            +AG DTT S L
Sbjct  308  LAGRDTTGSGL  318



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 73/138 (53%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI +R+I  E+ WK+Q      G+  EKK+++A  +
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFFRHIKPEILWKMQSLI---GLGDEKKMTKARAT  247

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
            F    S +I    +E++  ++        S  +LTS++       + L  +  +FLRD  
Sbjct  248  FDRVCSKYIASKRDEISRGISNVD---SPSQDLLTSYMNLDTTKYRLLNPSDERFLRDTI  304

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT SAL  F
Sbjct  305  LTFMLAGRDTTGSALTWF  322



>gb|KEH40921.1| cytochrome P450 family protein [Medicago truncatula]
Length=555

 Score = 55.8 bits (133),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 10/132 (8%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P   + PF  A  D   A L+R ++    WK  ++   G    E+KL ++ Q
Sbjct  225  DPG--CLQPHLPEIPFAAAFEDATEATLFRFVMPVCVWKAMRFLNLG---MERKLKKSIQ  279

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIA  350
                F   ++    ++L+       + S +LT  ++    N    S +FLRDI V FI+A
Sbjct  280  KVDEFAENVIRARKKELSLQNEDNKEKSDLLTVFMRLKDENGKSYSDKFLRDICVNFILA  339

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  340  GRDTSSVALSWF  351


 Score = 23.9 bits (50),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVFN  484
            L+ QN +VE KIL +I ++       +K VFN
Sbjct  354  LVDQNHEVEEKILEEICRVVCQREDINKEVFN  385



>gb|KFK30508.1| hypothetical protein AALP_AA7G271100 [Arabis alpina]
Length=438

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   +  F +A+ D   AI +R+I  E+ WK+Q      G   EKK+++A  +
Sbjct  114  DPGCLSVD-MPEIGFARALDDAEEAIFFRHIKPEILWKMQSLI---GFGDEKKMTKARAT  169

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
            F       +    + +++       S  +LTS++       K L  +  +FLRD  +TF+
Sbjct  170  FDRVCSKYIASKKDMVSREVDSSSPSQDLLTSYMNLDTTKYKLLNPSDDRFLRDTILTFM  229

Query  345  IAGGDTTASAL  377
            +AG DTT S L
Sbjct  230  LAGRDTTGSGL  240



>ref|XP_006280314.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
 gb|EOA13212.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
Length=515

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 69/137 (50%), Gaps = 15/137 (11%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  +    KA  D V  + YR++   + WKLQK     G+  EKK+++A  
Sbjct  193  DPRSLSIEMPEVESA--KAFDDIVEGVFYRHVKPRLLWKLQK---LIGVGIEKKMTEAGA  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*--QPHDSSGMLTSHIKT-------L*GNSMQFLRDIFV  335
             F       +    E++ ++Q      +S  +LTSHIK        L   + +FLRD  +
Sbjct  248  VFDRVCAKYVSARKEEIKRSQGINSSVESEDLLTSHIKLDTTKYQLLDPINDKFLRDNVL  307

Query  336  TFIIAGGDTTASALGSF  386
              ++AG DTTASAL  F
Sbjct  308  ALLLAGRDTTASALTWF  324



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score = 52.4 bits (124),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA  +   +I YR+++    WK+Q+ W+   I +EKK+++A ++
Sbjct  152  DPNCLSID-FSEVAIEKAFNEVEESIFYRHVVPRCVWKIQR-WL--QIGQEKKMTEACKT  207

Query  186  FSNFIYPILEEMTEQL---NKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
               FI+  +    E+L   N+ +         LT+ ++    +  +FLRD      +AG 
Sbjct  208  LDQFIHACIASKREKLSKYNENEMGEAHHVDFLTALMREETAHDDKFLRDAVFNLFVAGR  267

Query  357  DTTASALGSFCSLHKT  404
            DT  SAL  F  L  T
Sbjct  268  DTITSALTWFFWLVAT  283


 Score = 27.3 bits (59),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 3/29 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDK  472
             L+A NP VEAKIL+   ++K+ L  ++K
Sbjct  279  WLVATNPSVEAKILD---EMKEKLGTKEK  304



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 66/140 (47%), Gaps = 14/140 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+     PF KA  D   A+LYR ++    WKLQK    G   +EKKL  A  +
Sbjct  188  DPDSLSIE-FPHVPFAKAFDDIEEAVLYRYLVPSSIWKLQKRLRIG---KEKKLRNAWDT  243

Query  186  FSNFIYPILEEMTEQLNKTQ*QP---HDSSGMLTSHIKTL*G-------NSMQFLRDIFV  335
            F  F+   +    EQ+ +++ Q     D   +LT +   + G        S + LRD   
Sbjct  244  FDRFLEQCITRKREQVRRSKNQKERDQDYFDLLTYYFMEVEGGDVNVPVKSNKLLRDTAT  303

Query  336  TFIIAGGDTTASALGSFCSL  395
              +IAG DT ++AL  F  L
Sbjct  304  ALLIAGRDTVSAALAWFFWL  323



>ref|XP_010436205.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=450

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 82/164 (50%), Gaps = 18/164 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR++  E+ WK+Q+    GG   E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHLKPELVWKMQRLIGVGG---ELKLKRAHAI  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHI-------KTL*GNSMQFLRDIFVT  338
            F       +    +++++ +     SS   +L S I       K L  +  +FLRD  ++
Sbjct  248  FDRVCSECIASKRDEISRGRDNISSSSSKDLLMSSINVDTTKYKLLNPSDDRFLRDTILS  307

Query  339  FIIAGGDTTASALGSF----CSLHKTL-KLKQRSSTISFN*NKT  455
            F++AG DTT SAL  F    C   +T+ +++Q  +T  F  NKT
Sbjct  308  FMLAGRDTTGSALTWFFWLLCKNQETVARIRQEINTNLFPGNKT  351



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score = 54.3 bits (129),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 66/135 (49%), Gaps = 6/135 (4%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA      +I YR I+    WKLQK W+   I +EKK+++A ++
Sbjct  191  DPSCLSID-FPEVEIEKAFNQAEESIFYRQIVPICFWKLQK-WL--QIGQEKKMTEACKT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS--GMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
             + FI+  +    E+LNK +      +   +LT+ ++    +   FLRD      +AG D
Sbjct  247  LNQFIHACIASKREELNKYKENEMGEAHKDLLTALMREGKAHDDGFLRDSVFNLFVAGRD  306

Query  360  TTASALGSFCSLHKT  404
            T  SAL  F  L  T
Sbjct  307  TITSALTWFFWLVAT  321


 Score = 25.4 bits (54),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 3/31 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLV  478
             L+A NP VEAKIL +I   K+     +K++
Sbjct  317  WLVATNPLVEAKILEEI---KEQFETNEKML  344



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 79/154 (51%), Gaps = 17/154 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   + PF KA+ +    +  R++L E  WKLQK W+  GI  EKKLS+A Q 
Sbjct  194  DPGCLSLE-FPNVPFSKAMDEAEEVLFIRHLLPESVWKLQK-WL--GIGHEKKLSKAWQV  249

Query  186  FSNFIYPILEEMTEQL-NKTQ*QPHDSSG--MLTSHIKTL*GNSMQF----LRDIFVTFI  344
                I   +    ++L N T+ +  +  G  +LTS+I     + + F    LRD  +  +
Sbjct  250  LDQVIGKYISMKRDELSNGTKLKEDNEEGFDLLTSYIL---DDGLNFDDKSLRDTILNLM  306

Query  345  IAGGDTTASALGSF---CSLHKTLKLKQRSSTIS  437
            IAG DTT+S L  F    S H  ++ K R   ++
Sbjct  307  IAGRDTTSSGLTWFIWLVSTHPEVEKKIREELMA  340



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 69/139 (50%), Gaps = 10/139 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +    D PF +A+ +   AI  R+ L E  WKLQ++    G   EK+LS+A   
Sbjct  193  DPGCLSVG-LPDVPFSRALDEAEEAIFMRHCLPESLWKLQRFL---GFGHEKQLSRARVV  248

Query  186  FSNFIYPILEEMTEQLNKTQ*Q-PHDSS-----GMLTSHIKTL*GNSMQFLRDIFVTFII  347
              + I   +    E++   +   PH+        +L+S+I     ++   LRD  + F+I
Sbjct  249  LDSVIEKYISAKREEIMAGKSGGPHELGQENDLDLLSSYINESENDNDSSLRDTILNFMI  308

Query  348  AGGDTTASALGSFCSLHKT  404
            AG DTT+SAL  F  L  T
Sbjct  309  AGRDTTSSALTWFVWLVST  327



>ref|XP_011092582.1| PREDICTED: cytochrome P450 86A8-like [Sesamum indicum]
Length=521

 Score = 51.6 bits (122),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 8/130 (6%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICG-GIDREKKLSQAD  179
            +DP +L +    D+ F  A      A L R I  E+ WKL+K+   G  +   + L   D
Sbjct  194  KDPETLALG-LPDNSFASAFDRATEASLQRFIFPEVIWKLKKWLRLGMEVSLSRSLVHVD  252

Query  180  QSFSNFIYP-ILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
            +  S  I    LE MT+Q +     PHD   +L+  +K     S +FLR + + FI+AG 
Sbjct  253  EYLSGVICTRKLELMTQQKDA---NPHDD--LLSRFMKKKESYSDEFLRYVALNFILAGR  307

Query  357  DTTASALGSF  386
            DT++ AL  F
Sbjct  308  DTSSVALSWF  317


 Score = 27.7 bits (60),  Expect(2) = 7e-07, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+ QNP+VE KILN+I
Sbjct  320  LVIQNPRVETKILNEI  335



>gb|KFK38027.1| hypothetical protein AALP_AA3G060700 [Arabis alpina]
Length=466

 Score = 55.5 bits (132),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 70/139 (50%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    ++YR+I  +  WKLQ +   G   +EKK+ +A+ +
Sbjct  148  DPRSLSIEMLEDE-LAKALDDVGEGLVYRHIKPKFLWKLQNWMRIG---QEKKMVEANAT  203

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIKT-------L*GNSMQFLRDI  329
                    +    E++ ++Q     S+G     +LTS IK        L  +  +FLRD 
Sbjct  204  IDRVCAKHISAKREEIIRSQEILDISNGKSHEDILTSFIKLDTTKYKLLNPSDDKFLRDT  263

Query  330  FVTFIIAGGDTTASALGSF  386
             V FI+AG +TTASAL  F
Sbjct  264  IVAFIVAGRETTASALSWF  282


 Score = 23.9 bits (50),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDIL  439
             LL++NPQV AKI  +I+
Sbjct  284  WLLSENPQVVAKIRQEII  301



>ref|XP_009109465.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=525

 Score = 54.7 bits (130),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 76/144 (53%), Gaps = 19/144 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA  +   AIL+R+++ +  WK Q+ W+  G+ +EK L +A  +
Sbjct  199  DPQSLSIE-MPEVEFAKAFDNAGEAILFRHVIPKFLWKFQR-WM--GLGQEKMLLEAGAT  254

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-------SSGMLTSHIK-------TL*GNSMQFLR  323
            F       ++   E++ ++Q   HD       S  +LTS+IK        L  ++ +F+ 
Sbjct  255  FDRICAKYIDAKREEI-RSQGIDHDHDHSNGESEDVLTSYIKLDTSKYELLDPSNDKFIG  313

Query  324  DIFVTFIIAGGDTTASALGSFCSL  395
            +  ++FI AG DTTA+A+  F  L
Sbjct  314  ETLLSFIFAGRDTTATAITWFFGL  337


 Score = 24.6 bits (52),  Expect(2) = 8e-07, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDIL  439
            LL +NP VEAKI  +I+
Sbjct  337  LLTKNPNVEAKIRQEII  353



>gb|KHN27470.1| Cytochrome P450 86B1 [Glycine soja]
Length=412

 Score = 54.3 bits (129),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 66/135 (49%), Gaps = 6/135 (4%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    KA      +I YR I+    WKLQK W+   I +EKK+++A ++
Sbjct  101  DPSCLSID-FPEVEIEKAFNQAEESIFYRQIVPICFWKLQK-WL--QIGQEKKMTEACKT  156

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS--GMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
             + FI+  +    E+LNK +      +   +LT+ ++    +   FLRD      +AG D
Sbjct  157  LNQFIHACIASKREELNKYKENEMGEAHKDLLTALMREGKAHDDGFLRDSVFNLFVAGRD  216

Query  360  TTASALGSFCSLHKT  404
            T  SAL  F  L  T
Sbjct  217  TITSALTWFFWLVAT  231


 Score = 25.0 bits (53),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 3/31 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLV  478
             L+A NP VEAKIL +I   K+     +K++
Sbjct  227  WLVATNPLVEAKILEEI---KEQFETNEKML  254



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score = 53.5 bits (127),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 18/134 (13%)
 Frame = +3

Query  39   DHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYP-ILE  215
            + PFLKA+ D    I  R+++    WK  + W+  G+ +E+K  +A +    FIY  I E
Sbjct  197  NEPFLKALDDIEEVIFRRHVVPMSVWKFFR-WL--GVGKERKYKEAWEILDEFIYKRISE  253

Query  216  EMTEQLNKTQ*QPHDSSG----MLT---------SHIKTL*GN-SMQFLRDIFVTFIIAG  353
            + +E+L K +   H  +     +LT         S I  +  N S + LRD  + F IAG
Sbjct  254  KRSEELFKQEELKHKEASVGVDLLTLYMDEAQGLSSINNVKNNLSDKLLRDTILNFFIAG  313

Query  354  GDTTASALGSFCSL  395
             DTT++AL  F  L
Sbjct  314  RDTTSTALAWFFYL  327


 Score = 25.8 bits (55),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 6/34 (18%)
 Frame = +2

Query  389  LLAQNPQVEAKI---LNDILQLKQNLAKQDKLVF  481
            LL++NP+VE+KI   L+ I+ + Q+    DKLV+
Sbjct  327  LLSKNPRVESKIREELDTIMDINQD---HDKLVY  357



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 68/134 (51%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR++  EM WK+Q+ +   G+  E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLF---GLGDELKLKRAHNI  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
                 +  +    + +++       S  +LT+++       K L  N  +FLRD  ++F+
Sbjct  248  LDRACFKCISSKRDDISRGT-NNSGSKDLLTAYLNVDTTKYKLLNPNDDRFLRDTVLSFM  306

Query  345  IAGGDTTASALGSF  386
            +AG DTT SAL  F
Sbjct  307  LAGRDTTGSALTWF  320



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 68/134 (51%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ++   +  F +A+ D   AI YR++  EM WK+Q+ +   G+  E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLF---GLGDELKLKRAHNI  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
                 +  +    + +++       S  +LT+++       K L  N  +FLRD  ++F+
Sbjct  248  LDRACFKCISSKRDDISRGT-NNSGSKDLLTAYLNVDTTKYKLLNPNDDRFLRDTVLSFM  306

Query  345  IAGGDTTASALGSF  386
            +AG DTT SAL  F
Sbjct  307  LAGRDTTGSALTWF  320



>ref|XP_010444065.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=516

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 79/158 (50%), Gaps = 20/158 (13%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  +    KA+ D +  I YR++     WKLQ  W+  GI  EKK+++A  
Sbjct  193  DPRSLSIEMPEVESA--KALDDILEGIKYRHVKPRFLWKLQN-WLGVGI--EKKMTEAGA  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHD--SSGMLTSHIKT-------L*GNSMQFLRDIFV  335
             F       +    E++ +++   HD  S  +LTSHIK        L   + +FLRD  +
Sbjct  248  IFDRVCAKYISARREEIKRSKGIDHDGESEDLLTSHIKLDTTKYQLLDPINDKFLRDNVL  307

Query  336  TFIIAGGDTTASALGSFCSL----HKTL-KLKQRSSTI  434
              ++AG DT ASAL  F  L    HK + K++Q    I
Sbjct  308  ALLLAGRDTIASALTWFFWLLSENHKAMTKIRQEIDKI  345



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (51%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +    +  F +A+ D   AI YR++  EM WK+Q+ +   G+  E KL +A   
Sbjct  192  DPGCLSVG-MPEIEFARALDDAEEAIFYRHVKPEMVWKMQRLF---GLGDELKLKRAHNI  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
                 +  +    +++++       S  +LTS++       K L  N  +FLRD  ++F+
Sbjct  248  LDRACFKCISSKRDEISRGT-NNIGSKDLLTSYLNVDTTKYKLLNPNDDRFLRDTVLSFM  306

Query  345  IAGGDTTASALGSF  386
            +AG DTT SAL  F
Sbjct  307  LAGRDTTGSALTWF  320



>ref|XP_010270999.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score = 54.7 bits (130),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 10/129 (8%)
 Frame = +3

Query  3    RDPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            RD G L  + PT +  F++A+ +   AILYR  +    WKL ++   G   REKK ++A 
Sbjct  189  RDSGYLSPEFPTNE--FVEAVDNAEEAILYRFAVPAFVWKLMRWLKVG---REKKYAEAW  243

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
             +   F+   + +  E+L     Q  +++ +L  +IK+    S +FLRD  +TF +AG D
Sbjct  244  ATADAFLGEFISQTREELL----QGVETNTILAIYIKSPKQISDKFLRDSMLTFNLAGRD  299

Query  360  TTASALGSF  386
            TT   L  F
Sbjct  300  TTTVGLSWF  308


 Score = 24.3 bits (51),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+ +NP VEAKIL ++
Sbjct  311  LVCKNPHVEAKILEEL  326



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI +R+I  E+ W+LQ      G+  EKK+++A   
Sbjct  192  DPGCLSVE-MPEVEFARALDDAEEAIFFRHIKPEILWRLQGLL---GLGDEKKMTKARAT  247

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S +I    +E++   N        S  +LTS++       K L  +  +FLRD  
Sbjct  248  LDRVCSKYIATKRDEVSRGTNNVD---SHSKDLLTSYMNLDTTKYKLLNPSDERFLRDTI  304

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  305  LTFMLAGRDTTGSGLTWF  322



>gb|KFK30522.1| hypothetical protein AALP_AA7G273500 [Arabis alpina]
Length=506

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (48%), Gaps = 14/140 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL  D   +  + +A+ D    I YR+++ +  WKLQ      G  +EK++++AD +
Sbjct  191  DPKSLSTD-FPEVEYAQALDDLGEGIFYRHVIPKFLWKLQNRI---GFGKEKRMTEADAT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPH---DSSGMLTSHIKT-------L*GNSMQFLRDIFV  335
            F       +    ++L       H   D   +LTSHIK        L  +  +FLRD  +
Sbjct  247  FDRVSAKYISAKRKELRSQGLDHHSNRDKEDLLTSHIKLDTTKYQLLNPSDDKFLRDTIL  306

Query  336  TFIIAGGDTTASALGSFCSL  395
             F +AG DTT SAL  F  L
Sbjct  307  AFNLAGRDTTGSALSWFFWL  326



>ref|XP_010513571.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=499

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 65/138 (47%), Gaps = 15/138 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            D GS+ I+   +  F  A  D   AI YR+I     WKLQK WI  GI  EKK+ +AD +
Sbjct  176  DLGSVSIE-LPEVEFATAFDDVGEAIFYRHITPRFLWKLQK-WI--GIGAEKKMMKADAT  231

Query  186  FSNF----IYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIF  332
             +      I    EE+  Q N       D   +LTS IK        L     +FL+D  
Sbjct  232  LTRVCNKHISATREEVRSQRNTHNSNGEDHEVLLTSFIKLDTTKYDLLNPGDNKFLQDFT  291

Query  333  VTFIIAGGDTTASALGSF  386
            V F+ AG D+TA AL  F
Sbjct  292  VNFMAAGRDSTAVALTWF  309



>ref|XP_007052012.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96169.1| Cytochrome P450 family protein [Theobroma cacao]
Length=508

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 6/127 (5%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F  A  D   AIL+R +  ++ WK++++   G    E KL ++ +   N
Sbjct  197  SVCGSNLEGKEFTAAFDDSSAAILFRYV--DIFWKIKRFLNIGS---EAKLKKSTKVVDN  251

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            F+Y ++    EQ+  +         +L+  ++ L      ++RDI + FIIAG DTTA+ 
Sbjct  252  FVYKLIHNKIEQMRNSNDSSMKKEDILSRFLQ-LNDTDPTYMRDIILNFIIAGKDTTATT  310

Query  375  LGSFCSL  395
            L  F  +
Sbjct  311  LSWFIYM  317



>gb|KEH21495.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=446

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 65/132 (49%), Gaps = 10/132 (8%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P   + PF  A  D   AIL+R ++    WK  ++   G    E+KL ++ Q
Sbjct  207  DPG--CLQPHLPEIPFAGAFEDATEAILFRFVVPICVWKAMRFLNLG---MERKLKKSIQ  261

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIA  350
                F   ++    ++L+       + S +LT  ++    N    S +FLRDI V FI+A
Sbjct  262  KVDEFAENVIRARKKELSLQNEDDKEKSDLLTVFMRLKDENGKSYSDKFLRDICVNFILA  321

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  322  GRDTSSVALSWF  333



>gb|EYU41727.1| hypothetical protein MIMGU_mgv1a023193mg, partial [Erythranthe 
guttata]
Length=401

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 65/145 (45%), Gaps = 30/145 (21%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGSLC+D     P ++A  D + A+ YR+ L E+ WKLQ+    G    E+KL +A + 
Sbjct  175  DPGSLCVD-LPFIPSMQAFCDSIGAVFYRHTLPEVVWKLQRRLQIGT---ERKLLEARKV  230

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM------------------  311
               FIYP++       N TQ        +LT+  K     S+                  
Sbjct  231  VDKFIYPLVNN-----NITQDDDDRRLNLLTTFRKAYKEKSVSSLLLLGGNGGGGGGASS  285

Query  312  ---QFLRDIFVTFIIAGGDTTASAL  377
                F+RD  +  + AG DT+AS L
Sbjct  286  RETNFMRDTVLGLMFAGRDTSASCL  310



>ref|XP_003533692.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=554

 Score = 51.6 bits (122),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 14/132 (11%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C  P   D PF  A  D     + R I     WK  ++   G    EK+L ++ +
Sbjct  226  DPG--CSQPHLPDIPFATAFEDATETSMRRFITPVWMWKFMRHLNVG---VEKRLKESIE  280

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTFIIA  350
                F   ++    ++L       HD S +LT  ++    N M    +FLRDI V FI+A
Sbjct  281  KVDEFAESVIMTRKKELALQ----HDKSDLLTVFMRLKDENGMAYSDKFLRDICVNFILA  336

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  337  GRDTSSVALSWF  348


 Score = 26.9 bits (58),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 4/34 (12%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI----LQLKQNLAKQDKLV  478
            LL  NPQVE KIL +I    L  ++ L K++ +V
Sbjct  351  LLHMNPQVEEKILAEICRVVLSQREGLKKEEVVV  384



>ref|XP_007052011.1| Cytochrome P450 family protein isoform 3 [Theobroma cacao]
 gb|EOX96168.1| Cytochrome P450 family protein isoform 3 [Theobroma cacao]
Length=370

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 6/127 (5%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F  A  D   AIL+R +  ++ WK++++   G    E KL ++ +   N
Sbjct  197  SVCGSNLEGKEFTAAFDDSSAAILFRYV--DIFWKIKRFLNIGS---EAKLKKSTKVADN  251

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            F+Y ++    EQ+  +         +L+  ++ L      ++RDI + FIIAG DTTA+ 
Sbjct  252  FVYKLIHNKIEQMRNSNDSSMKKEDILSRFLQ-LNDTDPTYVRDIILNFIIAGKDTTATT  310

Query  375  LGSFCSL  395
            L  F  +
Sbjct  311  LSWFIYM  317



>ref|XP_009123569.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
 emb|CDY41980.1| BnaA01g05520D [Brassica napus]
Length=503

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 17/141 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP +L ++   D  + KA+      I +R+++ +  WKLQK WI  G  +EK+  +A  +
Sbjct  191  DPKTLSVEMPEDE-YAKALDVLGDGIFFRHVVPKFLWKLQK-WI--GFGQEKRTMEAGAT  246

Query  186  F----SNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-------TL*GNSMQFLRDIF  332
            F    + +I    +EM  Q  ++  + H+   +LTSH+K        L  +  +FLRD  
Sbjct  247  FDRVSAKYISAKRKEMRTQDQQSNGECHED--LLTSHMKLDTTKYEILNPSDDKFLRDTI  304

Query  333  VTFIIAGGDTTASALGSFCSL  395
            + F +AG DTTASAL  F  L
Sbjct  305  LAFNLAGRDTTASALSWFFWL  325



>ref|XP_004985762.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=517

 Score = 50.8 bits (120),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 39/132 (30%), Positives = 64/132 (48%), Gaps = 11/132 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I    D PF +A+ D +  +L R+++    WKL +    G    E+K+  A ++
Sbjct  194  DPGCLSIG-LPDVPFARAMDDAMHVLLLRHVVPMTWWKLARRLRIG---HERKMETARRT  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-----KTL*GNSMQFLRDIFVTFIIA  350
               F+   + +   +  K +     S+ +L+S+I     +   G    FLRD  +  ++A
Sbjct  250  IDRFVADTIAK--RRAEKARGGVEASADLLSSYIDDDGEEGAGGTVDAFLRDTTINLMLA  307

Query  351  GGDTTASALGSF  386
            G DTT SAL  F
Sbjct  308  GRDTTGSALSWF  319


 Score = 27.3 bits (59),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQ  451
            LL QNP+V AKIL ++  +KQ
Sbjct  322  LLTQNPRVVAKILEELETVKQ  342



>ref|XP_006282428.1| hypothetical protein CARUB_v100285721mg, partial [Capsella rubella]
 gb|EOA15326.1| hypothetical protein CARUB_v100285721mg, partial [Capsella rubella]
Length=312

 Score = 55.1 bits (131),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 12/120 (10%)
 Frame = +3

Query  54   KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQL  233
            KA  D V  + YR++   + WKLQK     G+  EKK+++A   F       +    E +
Sbjct  5    KAFDDIVEGVFYRHVKPRLLWKLQK---LIGVGIEKKMTEAGAVFDRVCAKYVSARKEDI  61

Query  234  NKTQ*--QPHDSSGMLTSHIKT-------L*GNSMQFLRDIFVTFIIAGGDTTASALGSF  386
             ++Q      +S  +LTSHIK        L   + +FLRD  +  ++AG DTTASAL  F
Sbjct  62   KRSQGINSSGESEDLLTSHIKLDTTKYQLLDPINDKFLRDNVLALLLAGRDTTASALTWF  121


 Score = 23.1 bits (48),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             LL++NP V AKIL +I
Sbjct  123  WLLSENPIVAAKILQEI  139



>dbj|BAK06287.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score = 49.7 bits (117),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 5/127 (4%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            D G L  D   D PF +A        L R +     WK +++    G   E++L++A +S
Sbjct  207  DAGCLA-DGLPDVPFARAFEHATELSLARFVTPPFVWKAKRFLCVAG---ERRLAEAARS  262

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTT  365
               F    + E   +L K          +L+  + +  G+S +FLRD  ++FI+AG DT+
Sbjct  263  VREFAERTVSERRTELRKIG-SLQGRCDLLSRLMSSSTGHSDEFLRDFCISFILAGRDTS  321

Query  366  ASALGSF  386
            + AL  F
Sbjct  322  SVALVWF  328


 Score = 28.5 bits (62),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKL  475
            LLA +P VEA++L+D+     ++ K D L
Sbjct  331  LLASHPDVEARVLDDVRAAHGDVGKMDYL  359



>gb|KEH24774.1| cytochrome P450 family protein [Medicago truncatula]
Length=476

 Score = 54.7 bits (130),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 10/129 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   D    KA       I YR+I+ +  WKLQK W+   I  EKK+++A + 
Sbjct  153  DPNCLSID-FPDVACEKAFNQIEECIFYRHIVPKSVWKLQK-WL--QIGEEKKMTKACKV  208

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM-----QFLRDIFVTFIIA  350
            F  F+Y  +E   + + K   +  +   +LT+ +K   G+ +     +FLRD+     +A
Sbjct  209  FDQFVYANIESRRKDIRKCS-KNMEMVDLLTTLMKEEKGSQVVVHDDKFLRDVAFNLFVA  267

Query  351  GGDTTASAL  377
            G DT  SAL
Sbjct  268  GRDTITSAL  276


 Score = 23.1 bits (48),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 3/24 (13%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLA  460
            L+A +P VEAKIL    Q+K+N  
Sbjct  282  LIATHPLVEAKILE---QIKENFG  302



>ref|XP_007031595.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY02521.1| Cytochrome P450, putative [Theobroma cacao]
Length=494

 Score = 52.4 bits (124),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 65/134 (49%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++   + P   A       +LYR+++    WKLQ+ W+   I  EKKLS+A ++
Sbjct  191  DPSSLSVE-LSEVPIKTAFTQAEERLLYRHLMPVRLWKLQR-WL--QIGEEKKLSKALKT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTS-------HIKTL*GNSMQFLRDIFVTFI  344
               F+Y  +    E+L        D    +T+        + ++ G S + LRD+ V  +
Sbjct  247  VDTFLYQCIASKREKLRCKFLAEEDKYDFVTAFMVQEEGEMTSVDGKSDKLLRDVAVNIM  306

Query  345  IAGGDTTASALGSF  386
             AG DT +++L  F
Sbjct  307  SAGKDTISASLSWF  320


 Score = 25.8 bits (55),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (59%), Gaps = 0/34 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKLVFNI  487
             LLA NP VE+KIL ++     ++  +  + F++
Sbjct  322  WLLAMNPSVESKILQEMRANSPSINDEKNMFFSV  355



>ref|XP_002320802.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE99117.1| cytochrome P450 family protein [Populus trichocarpa]
Length=565

 Score = 51.6 bits (122),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 5/129 (4%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICG-GIDREKKLSQAD  179
            +DP + C     ++ F  A      A L R IL E+ WKL+K+   G  +   + L+Q D
Sbjct  194  KDPQT-CAPGLPENSFASAFDRATEASLQRFILPEVLWKLKKWLRLGLEVSLNRSLTQLD  252

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
               +N I    +E+  Q  K +  PHD   +L+  +K     S  FL+ + + FI+AG D
Sbjct  253  DYLTNVIDARKKELLNQ-QKDRNIPHDD--LLSRFMKKKESYSDTFLQHVALNFILAGRD  309

Query  360  TTASALGSF  386
            T++ AL  F
Sbjct  310  TSSVALSWF  318


 Score = 26.6 bits (57),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            LL QNP VE KIL++I
Sbjct  321  LLTQNPSVEEKILHEI  336



>ref|XP_003521880.1| PREDICTED: cytochrome P450 86A8-like [Glycine max]
Length=533

 Score = 53.1 bits (126),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 8/130 (6%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICG-GIDREKKLSQAD  179
            RDP + C+    D+ F  A      A L R IL E+ WK++K+   G  +   + L+  D
Sbjct  193  RDPQT-CVSSLPDNRFATAFDRATEATLQRFILPEVLWKVKKWLRLGMEVSLSRSLAHVD  251

Query  180  QSFSNFIYP-ILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGG  356
               SN I    +E +T+Q + T    HD   +LT  ++     S +FL+ + + FI+AG 
Sbjct  252  DHLSNVIEKRKVELLTQQKDGTL---HDD--LLTRFMRKKESYSDKFLQQVALNFILAGR  306

Query  357  DTTASALGSF  386
            DT++ AL  F
Sbjct  307  DTSSVALSWF  316


 Score = 24.6 bits (52),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+ QNP+VE KIL +I
Sbjct  319  LVIQNPKVEEKILREI  334



>ref|NP_195658.3| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 emb|CAB44683.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80611.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE87077.1| cytochrome P450, family 96, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=516

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 84/161 (52%), Gaps = 15/161 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI YR+   E+ WK+Q+     G+  E KL +A   
Sbjct  192  DPGCLSVE-MPEIEFARALDDAEEAIFYRHFKPEVVWKMQRLI---GVGAELKLKRAHAI  247

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QP--HDSSGMLTSHIKTL*GNSMQFLRDIFVTFII  347
             D+  S  I    +E+++ ++ +  +     S  + T+  K L  +  +FLRD  ++F++
Sbjct  248  FDRVCSKCIASKRDEISQGIDSSSSKDLLMSSINVDTTKYKLLNPSDDRFLRDTILSFML  307

Query  348  AGGDTTASALGSF----CSLHKTL-KLKQRSSTISFN*NKT  455
            AG DTT SAL  F    C+  + + K++Q  +T  F  NKT
Sbjct  308  AGRDTTGSALTWFFWLLCNNQEAMTKIRQEINTNLFPRNKT  348



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 24/151 (16%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL +D   +  +  A  D   A+ YR+I+ E  WKLQK W+   +  EKKLSQA  +
Sbjct  189  DPQSLSVD-LPEIAYKTAFDDVEEAVFYRHIVPESIWKLQK-WL--NVGEEKKLSQAMDT  244

Query  186  FSNFIYPILEEMTEQLNKTQ*Q--------PHDSSGMLTSHIKTL*GNSMQ---------  314
              NF+   +    E++ + + Q          D   ++T+ IK   G + +         
Sbjct  245  IDNFLEQCISSKKEEIRQRKAQNMVQVEDNDQDDYDLITACIKE--GEAAEQMDASKRTD  302

Query  315  -FLRDIFVTFIIAGGDTTASALGSFCSLHKT  404
             +LRDI   FI AG DT  +AL  F  L  T
Sbjct  303  KYLRDIGFNFIAAGKDTVNAALTWFFWLVAT  333



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score = 55.5 bits (132),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 13/129 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFL---KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA  176
            DPGSL    +   P++   KA    +  ++YR++L E  WKLQK+   G    EKKL+++
Sbjct  144  DPGSL----SAALPYIPCEKAFSVALQPLMYRHVLPERIWKLQKWLKIGN---EKKLTES  196

Query  177  DQSFSNFIYPIL--EEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIA  350
             ++F +F+YPI+  +E   +L+       ++     ++     G+  +FLRD  +  + A
Sbjct  197  WKAFDDFLYPIISSKEKNNRLDVFT-AFENAYENNNNNNVNFSGDLRKFLRDSLLGLLFA  255

Query  351  GGDTTASAL  377
            G DTT++ +
Sbjct  256  GRDTTSTCI  264


 Score = 22.3 bits (46),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+A NP  E+KIL++I
Sbjct  270  LIATNPLSESKILDEI  285



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score = 55.5 bits (132),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 9/132 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    +A  +   +I YR+ +    WK QK W+   I +EKK+++A ++
Sbjct  191  DPKCLSID-FPEVAIERAFNESEESIFYRHTVPSSVWKFQK-WL--QIGQEKKMTEACKT  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG---MLTSHIKTL*GNSM--QFLRDIFVTFIIA  350
            F  FIY  +    ++L+K   +  D+     +LT+ I    G     +FLRD    F +A
Sbjct  247  FDEFIYSCIASKRQELSKCSREEMDNEAPFDLLTALITEERGRVHDDKFLRDAAFNFFVA  306

Query  351  GGDTTASALGSF  386
            G +T  SAL  F
Sbjct  307  GRETMTSALTWF  318


 Score = 22.3 bits (46),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+ ++P VEAKIL +I
Sbjct  320  WLVTKHPLVEAKILEEI  336



>gb|KHN19678.1| Cytochrome P450 86B1 [Glycine soja]
Length=427

 Score = 55.5 bits (132),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 9/132 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   +    +A  +   +I YR+ +    WK QK W+   I +EKK+++A ++
Sbjct  116  DPKCLSID-FPEVAIERAFNESEESIFYRHTVPSSVWKFQK-WL--QIGQEKKMTEACKT  171

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG---MLTSHIKTL*GNSM--QFLRDIFVTFIIA  350
            F  FIY  +    ++L+K   +  D+     +LT+ I    G     +FLRD    F +A
Sbjct  172  FDEFIYSCIASKRQELSKCSREEMDNEAPFDLLTALITEERGRVHDDKFLRDAAFNFFVA  231

Query  351  GGDTTASALGSF  386
            G +T  SAL  F
Sbjct  232  GRETMTSALTWF  243


 Score = 21.9 bits (45),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+ ++P VEAKIL +I
Sbjct  245  WLVTKHPLVEAKILEEI  261



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score = 52.4 bits (124),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 11/134 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L +D   +    KA  +    I +R+++ +  WKLQK W+   I +EKK+ +A ++
Sbjct  192  DPNCLSLD-FPEVEIEKAFNEAEETIFHRHVVPKCVWKLQK-WL--QIGQEKKMREACKT  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG---MLTSHIKTL*GNSMQ----FLRDIFVTFI  344
               FIY  +E   E L+K      + S    +LT  ++   G        FLRD      
Sbjct  248  LDEFIYACIESKREDLSKYDENEKEESSHVDLLTVLLREGKGKGEAHDDIFLRDAVFNLF  307

Query  345  IAGGDTTASALGSF  386
            +AG DT  SAL  F
Sbjct  308  VAGRDTITSALTWF  321


 Score = 25.4 bits (54),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 3/28 (11%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDK  472
            L+A NP VEAKIL    ++K+   + +K
Sbjct  324  LVATNPLVEAKILE---EMKEKFGRNEK  348



>ref|XP_007052009.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 ref|XP_007052010.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96166.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96167.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
Length=508

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 6/127 (5%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F  A  D   AIL+R +  ++ WK++++   G    E KL ++ +   N
Sbjct  197  SVCGSNLEGKEFTAAFDDSSAAILFRYV--DIFWKIKRFLNIGS---EAKLKKSTKVADN  251

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            F+Y ++    EQ+  +         +L+  ++ L      ++RDI + FIIAG DTTA+ 
Sbjct  252  FVYKLIHNKIEQMRNSNDSSMKKEDILSRFLQ-LNDTDPTYVRDIILNFIIAGKDTTATT  310

Query  375  LGSFCSL  395
            L  F  +
Sbjct  311  LSWFIYM  317



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 68/144 (47%), Gaps = 22/144 (15%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP  L I+ P   H   KA      AI YR+I+ E  WK QK W+   I  EKKLS+A Q
Sbjct  193  DPNCLTIEFPEVAHA--KAFDIMEEAIFYRHIVPEFYWKFQK-WL--QIGEEKKLSRALQ  247

Query  183  SFSNFIYPILEEMTEQL---------NKTQ*QPHDSSGMLTSHIKTL---*GNSM----Q  314
            +F  F+Y  +    EQ+         N  + +      +LT++IK      GNS     +
Sbjct  248  TFDQFMYKCISTRCEQVLNENKAKMENLVEEKEAADFDLLTAYIKVQMKEHGNSAASSNK  307

Query  315  FLRDIFVTFIIAGGDTTASALGSF  386
            FLRD     ++AG DT  + L  F
Sbjct  308  FLRDTATNLLVAGRDTPGAGLVWF  331



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score = 52.4 bits (124),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 45/142 (32%), Positives = 68/142 (48%), Gaps = 20/142 (14%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP  L I+ PT   PF +A+ D + A+  R+I+    WKL + W+  GI  EKKL+ A +
Sbjct  195  DPCCLSIEFPT--IPFARALDDAMGALFLRHIVPPAWWKLMR-WL--GIGEEKKLAMAWK  249

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSS---GMLTSHIKTL*GNSM-----------QFL  320
                FI     E  +Q +  + + HD      +L+S+I                   +FL
Sbjct  250  EMDRFIAERTAEKKKQRSLDKNRIHDGEEKVDLLSSYIDDHDDEEQHMSQQESSKFDKFL  309

Query  321  RDIFVTFIIAGGDTTASALGSF  386
            RD  + F++AG DTT + L  F
Sbjct  310  RDTTMNFMLAGRDTTGAGLTWF  331


 Score = 25.0 bits (53),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 18/33 (55%), Gaps = 3/33 (9%)
 Frame = +2

Query  389  LLAQNPQVEAKILND---ILQLKQNLAKQDKLV  478
            LL  NP VE+KIL +   +  L+   +  D LV
Sbjct  334  LLCNNPMVESKILEELKKVASLRNERSSSDDLV  366



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI +R++  E+ W+LQ      G+  EKK+++A   
Sbjct  152  DPGCLSVE-MPEVEFARALDDAEEAIFFRHVKPEIFWRLQGLL---GLGDEKKMTKARST  207

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S +I    +E++   N        S  +LTS++       K L  +  +FLRD  
Sbjct  208  LDRVCSKYIAIKRDEVSRGTNNVD---SHSKDLLTSYMNLDTTKYKLLNPSDERFLRDTI  264

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  265  LTFMLAGRDTTGSGLTWF  282



>ref|XP_010479164.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=522

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 71/139 (51%), Gaps = 18/139 (13%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I  P  +  F KA+ D   AI++R+I     WKLQ+ WI  GI  EK L +A  
Sbjct  202  DPRSLSIGMPEAE--FSKALDDVGDAIVHRHITPRFVWKLQQ-WI--GIGTEKTLLKAHA  256

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSG----MLTSHI-------KTL*GNSMQFLRDI  329
            +        +    E+L ++    H+++G    +LTSHI       + L     +FLRD 
Sbjct  257  TLDRVCAKFIAAKREEL-RSHGVTHNTNGESEDLLTSHIMLDATKYELLNPGDDKFLRDF  315

Query  330  FVTFIIAGGDTTASALGSF  386
             V F+ AG D+TASAL  F
Sbjct  316  TVGFMAAGRDSTASALTWF  334



>ref|XP_010482588.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010482589.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=517

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +     A+ D    I+YR+      WKLQ ++   G+  EKK+++A   
Sbjct  193  DPRSLSIE-MPEIESATALNDIGEGIIYRHAKPRFLWKLQNWF---GVGIEKKMTEAGVV  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRDI  329
            F       +    E++ ++Q   HD     S  +LTSH+K        L   + +FLRD 
Sbjct  249  FDRVCAEYISTNREEIKRSQGISHDHLDGESEDLLTSHMKLDPTKYQLLNPINDKFLRDT  308

Query  330  FVTFIIAGGDTTASALGSF  386
             V F++AG DT ASAL  F
Sbjct  309  IVGFLLAGRDTIASALTWF  327



>gb|EAY88476.1| hypothetical protein OsI_09947 [Oryza sativa Indica Group]
Length=508

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/130 (32%), Positives = 68/130 (52%), Gaps = 9/130 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGS+ ID   + PF +A+ D +  +L R+I+    W+L +     GI  E+K+  A ++
Sbjct  195  DPGSVAID-LPEVPFARAMDDAMTVLLLRHIVPLSWWRLARRL---GIGYERKMPVAWRT  250

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI---KTL*GNSMQFLRDIFVTFIIAGG  356
               F+   + +   +  +T     DS+ +L+S+I   +   G    FLRD  +  ++AG 
Sbjct  251  MDRFVADTIAKRRAEKARTG--IDDSADLLSSYINDDEEDAGTVDAFLRDTTINLMLAGR  308

Query  357  DTTASALGSF  386
            DTT SAL  F
Sbjct  309  DTTGSALSWF  318



>ref|XP_010482590.1| PREDICTED: cytochrome P450 86B1-like isoform X3 [Camelina sativa]
Length=524

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +     A+ D    I+YR+      WKLQ ++   G+  EKK+++A   
Sbjct  193  DPRSLSIE-MPEIESATALNDIGEGIIYRHAKPRFLWKLQNWF---GVGIEKKMTEAGVV  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRDI  329
            F       +    E++ ++Q   HD     S  +LTSH+K        L   + +FLRD 
Sbjct  249  FDRVCAEYISTNREEIKRSQGISHDHLDGESEDLLTSHMKLDPTKYQLLNPINDKFLRDT  308

Query  330  FVTFIIAGGDTTASALGSF  386
             V F++AG DT ASAL  F
Sbjct  309  IVGFLLAGRDTIASALTWF  327



>ref|XP_010444711.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=518

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 68/141 (48%), Gaps = 20/141 (14%)
 Frame = +3

Query  6    DPGSLCID--PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            DP SL I+         L  I +GVI   YR+      WKLQ  WI  GI  EKK+++A 
Sbjct  193  DPRSLSIEMPEIESATALNNIGEGVI---YRHAKPRFLWKLQN-WIGVGI--EKKMTEAG  246

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLR  323
              F       +    E++ ++Q   HD     S  +LTSH+K        L   + +FLR
Sbjct  247  VIFDRVCAEYISANREEIKRSQGISHDHLDGESGDLLTSHMKLDPTKYQLLNPINDKFLR  306

Query  324  DIFVTFIIAGGDTTASALGSF  386
            D  V F++AG DT ASAL  F
Sbjct  307  DTIVGFLLAGRDTIASALTWF  327



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score = 54.3 bits (129),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 56/124 (45%), Gaps = 39/124 (31%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SLC+D     P  KA  D + A+LYR++L E  WKLQK+   G   +E KL +A ++
Sbjct  180  DPCSLCVD-MPLIPCEKAFNDAIEALLYRHVLPESIWKLQKWLRIG---KEGKLIEAWKA  235

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTT  365
            F  FIYP                                    FLRD  ++ + AG DTT
Sbjct  236  FDEFIYP-----------------------------------DFLRDTTLSLMFAGRDTT  260

Query  366  ASAL  377
            ++ L
Sbjct  261  STCL  264


 Score = 22.7 bits (47),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 9/17 (53%), Positives = 11/17 (65%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+A NP  E KIL +I
Sbjct  269  WLIATNPSTEMKILEEI  285



>gb|KFK22353.1| hypothetical protein AALP_AAs42226U000100 [Arabis alpina]
Length=466

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 13/138 (9%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP  L ID P  ++    AI      I YR+      WKLQ YW+  G+  EKK+ ++  
Sbjct  159  DPKCLSIDMPKVEYG--DAIDGAADGIFYRHFKPVFLWKLQ-YWLGVGV--EKKMRRSLA  213

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTF  341
              +NF+  I+++   +L        ++  +LT +I       K L  ++ +FLRD  + F
Sbjct  214  VANNFLENIIKDRRAELKTNHDSKEENLDVLTYYITVDTTKYKHLKPSNDKFLRDAILGF  273

Query  342  IIAGGDTTASALGSFCSL  395
            ++AG DTT+SAL  F  L
Sbjct  274  LLAGRDTTSSALTWFFWL  291



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 49/144 (34%), Positives = 69/144 (48%), Gaps = 22/144 (15%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP  L I+ P   H   KA      A+ YR+I+ E  WK QK W+   I  EKKLS+A Q
Sbjct  193  DPNCLTIEFPEVAHA--KAFDIMEEAVFYRHIVPEFYWKFQK-WL--QIGEEKKLSRALQ  247

Query  183  SFSNFIYPILEEMTEQL---------NKTQ*QPHDSSGMLTSHIKTL---*GNSM----Q  314
            +F  F+Y  +    EQ+         N  + +      +LT++IK      GNS     +
Sbjct  248  TFDQFMYKCISTRCEQVLNENKAKMENIVEEKEAADFDLLTAYIKVQMKEHGNSAASSNK  307

Query  315  FLRDIFVTFIIAGGDTTASALGSF  386
            FLRD     ++AG DT ++ L  F
Sbjct  308  FLRDTATNLLVAGRDTPSAGLVWF  331



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI +R++  E+ W+LQ      G+  EKK+++A   
Sbjct  192  DPGCLSVE-MPEVEFARALDDAEEAIFFRHVKPEIFWRLQGLL---GLGDEKKMTKARST  247

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S +I    +E++   N        S  +LTS++       K L  +  +FLRD  
Sbjct  248  LDRVCSKYIAIKRDEVSRGTNNVD---SHSKDLLTSYMNLDTTKYKLLNPSDERFLRDTI  304

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  305  LTFMLAGRDTTGSGLTWF  322



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L  +      F +A+ +   AI +R++  EM WK+Q+ WI  G   E K+++A  +
Sbjct  193  DPGCLSTE-MPKIEFARALDEAEEAIFFRHVKPEMVWKMQR-WI--GFGDELKMTKAHST  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML--------TSHIKTL*GNSMQFLRDIFVTF  341
            F       +    +++++       SS  L        TS  K L  +  +FLRD+ ++F
Sbjct  249  FDRVCSKCIASKRDEISRGVINTDSSSKDLLMSYMNVDTSKYKLLNPSDDKFLRDMILSF  308

Query  342  IIAGGDTTASALGSF  386
            ++AG DTT SAL  F
Sbjct  309  MLAGRDTTGSALTWF  323



>ref|XP_004158225.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN45084.1| hypothetical protein Csa_7G420770 [Cucumis sativus]
Length=551

 Score = 48.9 bits (115),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L      + PF KA  D     + R I     WK  +Y     I  EKKL Q+ ++
Sbjct  219  DPGCL-RSGLPEIPFAKAFEDATEVTVIRFITPTFIWKFMRYL---NIGIEKKLKQSIKA  274

Query  186  FSNFIYPILEEMTEQLN---KTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFI  344
               F   +++    +L+   ++Q   +  S +LT  +K         S +FLRDI V FI
Sbjct  275  VDEFAEDVIQTRKRELSTPAESQ-AENQRSDLLTVFMKLRDEQGRPFSDKFLRDICVNFI  333

Query  345  IAGGDTTASALGSF  386
            +AG DT++ AL  F
Sbjct  334  LAGRDTSSVALSWF  347


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 2/35 (6%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQL--KQNLAKQDKLVFN  484
            LLL QNP VE KIL +I ++  ++  AK  +L F+
Sbjct  349  LLLDQNPDVEDKILEEICRIVGEREEAKTRELRFD  383



>ref|XP_004135954.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=550

 Score = 48.9 bits (115),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 12/134 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L      + PF KA  D     + R I     WK  +Y     I  EKKL Q+ ++
Sbjct  218  DPGCL-RSGLPEIPFAKAFEDATEVTVIRFITPTFIWKFMRYL---NIGIEKKLKQSIKA  273

Query  186  FSNFIYPILEEMTEQLN---KTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFI  344
               F   +++    +L+   ++Q   +  S +LT  +K         S +FLRDI V FI
Sbjct  274  VDEFAEDVIQTRKRELSTPAESQ-AENQRSDLLTVFMKLRDEQGRPFSDKFLRDICVNFI  332

Query  345  IAGGDTTASALGSF  386
            +AG DT++ AL  F
Sbjct  333  LAGRDTSSVALSWF  346


 Score = 28.1 bits (61),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 2/35 (6%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQL--KQNLAKQDKLVFN  484
            LLL QNP VE KIL +I ++  ++  AK  +L F+
Sbjct  348  LLLDQNPDVEDKILEEICRIVGEREEAKTRELRFD  382



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 14/122 (11%)
 Frame = +3

Query  48   FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTE  227
            F KA+ D   A+ YR++  E  WKLQ+ W+  GI +EKK+++A +   +     +    E
Sbjct  201  FSKAMDDAEEALFYRHLTPEFVWKLQR-WL--GIGQEKKMAKARKVLDDTSRNYISRKRE  257

Query  228  QLNKTQ*QPHDSSG--MLTSHIKTL*GNSM-------QFLRDIFVTFIIAGGDTTASALG  380
            QL K      +  G  +LTS++    G+ +       +FLRD  +  ++AG DTT+S L 
Sbjct  258  QLVKNNNIQENGEGVDLLTSYMNE--GDKILGTIPDEKFLRDTIINLLLAGRDTTSSGLS  315

Query  381  SF  386
             F
Sbjct  316  WF  317



>ref|NP_001048917.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|ABF93893.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10831.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|EAZ25523.1| hypothetical protein OsJ_09347 [Oryza sativa Japonica Group]
Length=508

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 41/130 (32%), Positives = 68/130 (52%), Gaps = 9/130 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGS+ ID   + PF +A+ D +  +L R+I+    W+L +     GI  E+K+  A ++
Sbjct  195  DPGSVAID-LPEVPFARAMDDAMTMLLLRHIVPLSWWRLARRL---GIGYERKMPVAWRT  250

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI---KTL*GNSMQFLRDIFVTFIIAGG  356
               F+   + +   +  +T     DS+ +L+S+I   +   G    FLRD  +  ++AG 
Sbjct  251  MDRFVADTIAKRRAEKARTG--IDDSADLLSSYINDDEEDAGTVDAFLRDTTINLMLAGR  308

Query  357  DTTASALGSF  386
            DTT SAL  F
Sbjct  309  DTTGSALSWF  318



>gb|KCW78253.1| hypothetical protein EUGRSUZ_D02440 [Eucalyptus grandis]
 gb|KCW78254.1| hypothetical protein EUGRSUZ_D02440 [Eucalyptus grandis]
Length=336

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 8/137 (6%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F +A  D     L+R +  ++ WK++K+   G    E  L +  +   N
Sbjct  24   SMCGTSEEGAEFSRAFDDASAMTLWRYV--DVSWKIKKFLNIGS---EAALKKNIRIMDN  78

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            F+Y +++   EQ++ +   P      + S    +      +LRDI + FIIAG DTTA+ 
Sbjct  79   FVYKLIKRKIEQMHNSTDDPSMKKEDILSRFLQVTETDQTYLRDIILNFIIAGKDTTAAT  138

Query  375  LGSFCSL---HKTLKLK  416
            L  F  +   H T++ K
Sbjct  139  LSWFIYMLCKHPTIQEK  155



>gb|KHN29577.1| Cytochrome P450 86B1 [Glycine soja]
Length=505

 Score = 51.2 bits (121),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 60/132 (45%), Gaps = 14/132 (11%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C  P   D PF  A  D     + R I     WK  ++   G    EK+L ++ +
Sbjct  177  DPG--CSQPHLPDIPFATAFEDATETSMRRFITPVWMWKFMRHLNVGV---EKRLKESIE  231

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTFIIA  350
                F   ++    ++L       HD S +LT  ++    N M    +FLRDI V FI+A
Sbjct  232  KVDEFAESVIMTRKKELALQ----HDKSDLLTVFMRLKDENGMAYSDKFLRDICVNFILA  287

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  288  GRDTSSVALSWF  299


 Score = 25.8 bits (55),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 4/35 (11%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI----LQLKQNLAKQDKLV  478
             LL  NPQVE KIL +I    L  ++ L K++ +V
Sbjct  301  WLLHMNPQVEEKILAEICRVVLSQREGLKKEEVVV  335



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (50%), Gaps = 20/131 (15%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SLC+D   D P  KA       +L+R+++ +  WKL ++   G    E+KL +  ++
Sbjct  191  DPCSLCLD-MPDLPCEKAFSVAAEPLLHRHVIPQRIWKLLRWLNVGS---ERKLLECSRA  246

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI------KTL*GNSMQ-FLRDIFVTFI  344
            FS FIYP +    EQ N+         G L          K + G S++ FL+D  +  +
Sbjct  247  FSEFIYPRIVTGEEQKNE---------GSLLRAFEDVYKQKNMNGRSLRDFLKDTSLNLM  297

Query  345  IAGGDTTASAL  377
             AG DTT++ L
Sbjct  298  FAGRDTTSTCL  308



>ref|XP_010474120.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=594

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 38/133 (29%), Positives = 65/133 (49%), Gaps = 10/133 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L  +      F +A+ +   AILYR++  EM W++Q+++   G   E K+ +A  +
Sbjct  277  DPGCLSFE-MPHMEFARALDEAEEAILYRHVKPEMVWEMQRWF---GFGDELKIKKAHST  332

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS------GMLTSHIKTL*GNSMQFLRDIFVTFII  347
            F       +    +++ +                + T+  K L  ++ +FLRDI V F++
Sbjct  333  FDRICSKCIVSKRDEIARGDIDSFSKDLSMSYMNLDTTKYKLLNPSNEKFLRDIIVNFMV  392

Query  348  AGGDTTASALGSF  386
            AG D+T SAL  F
Sbjct  393  AGRDSTGSALTWF  405



>ref|XP_006379954.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP57751.1| cytochrome P450 family protein [Populus trichocarpa]
Length=503

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (48%), Gaps = 13/147 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   D PF KA       IL+R ++    WK  K++   GI  EK L +A   
Sbjct  181  DPGCLALD-IPDVPFAKAFEKATELILFRFLMPPFIWKTMKFF---GIGYEKTLKEAVGI  236

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK---TL*GNSMQF----LRDIFVTFI  344
               F    ++   +++ K     H S  +L+  I+   T  G  MQF     RD+ V FI
Sbjct  237  VHEFAEKTVKGRRDEIRKHGSLCHQSD-LLSRLIEIEYTGRGKEMQFPDKYFRDLCVNFI  295

Query  345  IAGGDTTASALGSFCSL-HKTLKLKQR  422
            +AG DTT+ AL  F  L H   +++ R
Sbjct  296  LAGRDTTSVALAWFFWLVHSNPQVENR  322



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 14/137 (10%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + I+   D PF +A+     AI  RNI  E  WKLQ+      I  EKK S+A ++
Sbjct  152  DPGCVSIN-FPDVPFARALDRAEEAIAARNIQPESTWKLQRLL---NIGEEKKYSEAWKT  207

Query  186  FSNFIYPILEEMTEQLNKT-----Q*QPHDSSGMLTSHIKT-----L*GNSMQFLRDIFV  335
                I   + +  E+L+       +    D   +LTS+I       L  +   FLRD  +
Sbjct  208  LDRVIGEYISKKREELSSKSSSKSRTDDQDGIDLLTSYITEAKTMELPSDDDTFLRDTIL  267

Query  336  TFIIAGGDTTASALGSF  386
              +IAG DTT+SAL  F
Sbjct  268  NLMIAGRDTTSSALTWF  284



>gb|KHM99063.1| Cytochrome P450 86B1 [Glycine soja]
Length=528

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 68/145 (47%), Gaps = 15/145 (10%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C  P   + PF  A  D     + R I     WK  +Y   G    EK+L ++ +
Sbjct  201  DPG--CSQPHLPEIPFATAFEDATETSMRRFITPVWMWKFMRYLDVGA---EKRLRESIE  255

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTFIIA  350
                F   ++    ++L       H+ S +LT  ++    N M    +FLRDI V FI+A
Sbjct  256  KVDEFAESVIRTRKKELALQ----HEKSDLLTVFMRLKDENGMAYSDRFLRDICVNFILA  311

Query  351  GGDTTASALG-SFCSLHKTLKLKQR  422
            G DT++ AL   F  LHK  K+++R
Sbjct  312  GRDTSSVALSWFFWLLHKNPKVEER  336



>ref|XP_003556602.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=547

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 68/145 (47%), Gaps = 15/145 (10%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C  P   + PF  A  D     + R I     WK  +Y   G    EK+L ++ +
Sbjct  220  DPG--CSQPHLPEIPFATAFEDATETSMRRFITPVWMWKFMRYLDVGA---EKRLRESIE  274

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM----QFLRDIFVTFIIA  350
                F   ++    ++L       H+ S +LT  ++    N M    +FLRDI V FI+A
Sbjct  275  KVDEFAESVIRTRKKELALQ----HEKSDLLTVFMRLKDENGMAYSDRFLRDICVNFILA  330

Query  351  GGDTTASALG-SFCSLHKTLKLKQR  422
            G DT++ AL   F  LHK  K+++R
Sbjct  331  GRDTSSVALSWFFWLLHKNPKVEER  355



>ref|XP_010431922.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1 [Camelina 
sativa]
Length=259

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 15/124 (12%)
 Frame = +3

Query  51   LKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQ  230
            +KA+RD  + ILYR+++    WKLQ      G+ +EKKL +AD +F       +     +
Sbjct  1    MKALRDVEVTILYRHLIPRFIWKLQYRM---GLGQEKKLIEADATFERLSEKYISAKRNE  57

Query  231  LNKTQ*QPH-DSSG----MLTSHIK-------TL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            + +     H DS+G    +LT  +K        L     +FLRD+ + FI++G DT AS+
Sbjct  58   IRQALHHDHSDSNGEADDVLTFFMKLDATKYELLDPIDDRFLRDVILGFIVSGRDTIASS  117

Query  375  LGSF  386
            L  F
Sbjct  118  LTWF  121



>emb|CDP11007.1| unnamed protein product [Coffea canephora]
Length=554

 Score = 50.4 bits (119),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 39/132 (30%), Positives = 63/132 (48%), Gaps = 10/132 (8%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P   + PF +A  D   A L+R +   + W+  +      I  EKKL+ + +
Sbjct  225  DPG--CLRPGLPEIPFARAFEDATEATLFRFVTPTLTWRALRSL---NIGTEKKLNDSIR  279

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIA  350
                F   +++   ++L+         S +LT  ++         S +FLRDI V FI+A
Sbjct  280  EVDKFAEEVIQTRKKELSLPTESEKQRSDLLTVFMRLKDEQERPFSDKFLRDICVNFILA  339

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  340  GRDTSSVALSWF  351


 Score = 26.2 bits (56),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQL  445
            LL +NP+VE KIL +I Q+
Sbjct  354  LLNRNPEVEQKILAEICQI  372



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score = 52.8 bits (125),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 58/130 (45%), Gaps = 16/130 (12%)
 Frame = +3

Query  42   HPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEM  221
            +P+ +A  D   A+L R++     WKLQ+    G   +EKKLS A +S   FIY  L + 
Sbjct  204  NPYSEAFTDSEEAVLLRHVTPPFLWKLQQILRVG---KEKKLSDAWKSLDQFIYKCLAQK  260

Query  222  TEQLNKTQ*QPHDSSGM---------LTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
                N      H++            L  HI T   +  +FLRD F     AG DT +SA
Sbjct  261  EMDYNNMN---HEAEKFTFFDAIMRELKDHIDTS-MDCTKFLRDTFFNLTAAGKDTISSA  316

Query  375  LGSFCSLHKT  404
            L  F  L  T
Sbjct  317  LCWFFYLLAT  326


 Score = 23.9 bits (50),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (61%), Gaps = 7/38 (18%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI---LQL----KQNLAKQDKLVF  481
            LLA NP VE KIL ++   L++    + N  + DK+V+
Sbjct  323  LLATNPTVEDKILEEMQTHLEVSALKRWNATELDKMVY  360



>gb|KFK44487.1| hypothetical protein AALP_AA1G263300 [Arabis alpina]
Length=479

 Score = 45.8 bits (107),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (47%), Gaps = 16/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPGSL ID   + PF KA  +     L R ++    WK  +++   GI  E+KL +A + 
Sbjct  159  DPGSLGID-LPEVPFAKAFEEATEYTLTRFLMPYFVWKPMRFF---GIGFERKLKKAVRL  214

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK---------TL*GN--SMQFLRDIF  332
               F    + E   ++ K     +D   +L+  ++         T  GN  S ++ R+  
Sbjct  215  VHAFANKTVRERRNKMRKLG-NLNDLDDLLSRLMQREYEKEEEDTPRGNYYSDKYFREFC  273

Query  333  VTFIIAGGDTTASALGSFCSL  395
             +FIIAG DTT+ AL  F  L
Sbjct  274  TSFIIAGRDTTSVALTWFFWL  294


 Score = 30.8 bits (68),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQD  469
             L+ QNP+VE +ILN+I +++  L  Q+
Sbjct  293  WLVQQNPEVEKRILNEIREIRGRLVTQE  320



>ref|XP_010442757.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=517

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 68/141 (48%), Gaps = 20/141 (14%)
 Frame = +3

Query  6    DPGSLCID--PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            DP SL I+         L  I +GVI   YR+      WKLQ  WI  GI  EKK+++A 
Sbjct  193  DPRSLSIEMPEIESATALNNIGEGVI---YRHAKPRFLWKLQN-WIGVGI--EKKMTEAG  246

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLR  323
              F       +    E++ ++Q   HD     S  +LTSH+K        +   + +FLR
Sbjct  247  VVFDRVCAEYISTNREEIKRSQGINHDHLDGESEDLLTSHMKLDPTKYQLMNPINDKFLR  306

Query  324  DIFVTFIIAGGDTTASALGSF  386
            D  V F++AG DT ASAL  F
Sbjct  307  DTIVGFLLAGRDTIASALTWF  327



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 12/135 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L  +   +  F +A+ +   AI +R++  EM WK+Q+ WI  G   E K+++A  +
Sbjct  193  DPGCLSTE-MPEIKFARALDEAEEAIFFRHVKPEMVWKMQR-WI--GFGDELKMTKAHLT  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML--------TSHIKTL*GNSMQFLRDIFVTF  341
            F       +    +++ +       SS  L        TS  K L  +  +FLRD+ ++F
Sbjct  249  FDRVCSKCIASKRDEITRGVINIDSSSKDLLISYMNVDTSKYKLLNPSDDKFLRDMILSF  308

Query  342  IIAGGDTTASALGSF  386
            ++AG DTT SAL  F
Sbjct  309  MLAGRDTTGSALTWF  323



>gb|KEH24775.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score = 53.5 bits (127),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 68/129 (53%), Gaps = 10/129 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L ID   D    KA       I YR+ + +  WKLQK W+   I  EK +++A ++
Sbjct  193  DPNCLSID-FPDVACEKAFNQIEEGIFYRHKVPKSVWKLQK-WL--QIGEEKNMTKACKT  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM-----QFLRDIFVTFIIA  350
            +  F+Y  ++   E+L+K + + ++   +LT+ +K   G+ +     +FLRD+     +A
Sbjct  249  YDQFVYANIKSKREELSKCR-KNNEMVDLLTTLMKEEKGSQVVMHDDKFLRDVAFNLFVA  307

Query  351  GGDTTASAL  377
            G DT  SAL
Sbjct  308  GRDTITSAL  316


 Score = 23.1 bits (48),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 3/24 (13%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLA  460
            L+A +P VEAKIL +I   K+N  
Sbjct  322  LIATHPLVEAKILEEI---KENFG  342



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 10/115 (9%)
 Frame = +3

Query  54   KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQL  233
            +A+ D   AI+YR++  +  W++Q  WI  G   EKK+ +A ++F       +    E++
Sbjct  223  RALDDAEEAIVYRHVKPKFLWRMQN-WI--GFGSEKKIRRARETFDRVCRRYISVKREEI  279

Query  234  NKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFIIAGGDTTASAL  377
                    +S  +LTS++       K L     QFL+DI +TF++AG +T ASAL
Sbjct  280  RTGFHSEGESMDLLTSYMNLDTTKYKLLNPKEDQFLQDIILTFMVAGTNTIASAL  334



>ref|XP_006301880.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
 gb|EOA34778.1| hypothetical protein CARUB_v10022359mg [Capsella rubella]
Length=456

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 74/147 (50%), Gaps = 16/147 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F +A+     AI YR++   + WKLQK WI  G+  EKKL  +  +
Sbjct  152  DPMSLSIE-MPEVEFAEAVDISEEAIFYRHLKPVILWKLQK-WI--GVGLEKKLRDSMVA  207

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
                +  I+    E+L + + +   S  +LT +I       K L   S +F+RD+  + +
Sbjct  208  VDEMLAKIISSRREELGRGKRE--TSMNVLTYYINVDTTKYKLLKPRSDKFIRDVVFSLL  265

Query  345  IAGGDTTASALGSF---CSLHKTLKLK  416
            IA  DTT+SAL  F    S+H  +  K
Sbjct  266  IAARDTTSSALTWFFWLLSMHPNVMAK  292



>ref|XP_010054891.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=391

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 64/137 (47%), Gaps = 8/137 (6%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F +A  D     L+R +  ++ WK++K+   G    E  L +  +   N
Sbjct  79   SMCGTSEEGAEFSRAFDDASAMTLWRYV--DVSWKIKKFLNIGS---EAALKKNIRIMDN  133

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTTASA  374
            F+Y +++   EQ++ +   P      + S    +      +LRDI + FIIAG DTTA+ 
Sbjct  134  FVYKLIKRKIEQMHNSTDDPSMKKEDILSRFLQVTETDQTYLRDIILNFIIAGKDTTAAT  193

Query  375  LGSFCSL---HKTLKLK  416
            L  F  +   H T++ K
Sbjct  194  LSWFIYMLCKHPTIQEK  210



>ref|XP_011036497.1| PREDICTED: cytochrome P450 86A8-like [Populus euphratica]
Length=565

 Score = 50.1 bits (118),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 5/129 (4%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICG-GIDREKKLSQAD  179
            +DP + C     ++ F  A      A L R IL E+ WKL+K+   G  +   + L+Q D
Sbjct  194  KDPQT-CAPGLPENSFASAFDRATEASLQRFILPEVLWKLKKWLRLGLEVSLNRSLTQLD  252

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
               ++ I    +E+ +Q  K +  PHD   +L+  +K     S  FL+ + + FI+AG D
Sbjct  253  DYLTSVIDARKKELLDQ-QKDRNIPHDD--LLSRFMKKKESYSDTFLQHVALNFILAGRD  309

Query  360  TTASALGSF  386
            T++ AL  F
Sbjct  310  TSSVALSWF  318


 Score = 26.6 bits (57),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            LL QNP VE KIL++I
Sbjct  321  LLTQNPSVEEKILHEI  336



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 6/132 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            D GSL ID     PF KA+ D    ILYR+++    WK+ ++   G   +E+K  +A + 
Sbjct  186  DVGSLSID-WPHVPFSKALDDVEEVILYRHVVPMSVWKILRWLRIG---KERKYKRAWEI  241

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD--SSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
               FIY  + +   +L K +    D  +  M  S    +   S +FLRD  +++ IAG D
Sbjct  242  LDEFIYKCIAKKRAELGKNEGVGVDLLTLYMDKSQNVNVKDASDKFLRDTILSYFIAGRD  301

Query  360  TTASALGSFCSL  395
            TT+ AL  F  L
Sbjct  302  TTSLALSWFFYL  313



>ref|XP_010470317.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=497

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 13/137 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F +A+  G  AI YR+    + WKLQ YWI  GI  E+K+     +
Sbjct  194  DPMSLSIE-MPEVEFGEAVDHGEEAIFYRHFKPVILWKLQ-YWI--GIGLERKMRATMVT  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFI  344
             +  +  I+    E++++ + +   S  +LT ++       K L   S +F+RD+ ++ +
Sbjct  250  INQMLGKIISSRREEISRGKRE--TSMDVLTYYMNVDTTKYKLLKPRSDRFIRDVVLSLL  307

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTT+SAL  F  L
Sbjct  308  VAGRDTTSSALTWFFWL  324



>ref|XP_010666951.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=408

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 78/153 (51%), Gaps = 18/153 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL ++     P L A+ D    I YR++L    WKL + W+  G +++ KL  A  +
Sbjct  116  DPQSLSLN-LPHFPLLTAVADITQVIYYRHLLPTRIWKLLR-WLNIGYEKKNKL--AWNT  171

Query  186  FSNFIYPILE-EMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRD  326
              NF+Y  ++ +  E+ N+T  Q        S  +LT  + T          N+ +FLR+
Sbjct  172  LDNFVYNCIDRKREERRNRTSKQKDQDMIEVSVDLLTLFMDTDEIAKTPTHQNNDKFLRE  231

Query  327  IFVTFIIAGGDTTASALG-SFCSLHKTLKLKQR  422
                F +AGG+TT++AL   FC L K+ ++ ++
Sbjct  232  TISNFFLAGGETTSTALSWFFCLLSKSPQVVKK  264



>ref|XP_002865881.1| hypothetical protein ARALYDRAFT_331566 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42140.1| hypothetical protein ARALYDRAFT_331566 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 70/139 (50%), Gaps = 14/139 (10%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  +    KA+   V  I+YR++     WKLQ  W+  GI  EKK+ +A  
Sbjct  172  DPRSLSIEMPVIESA--KALDTIVEGIVYRHVKPRFLWKLQS-WVGVGI--EKKMIEAGA  226

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPH-DSSGMLTSHIKT-------L*GNSMQFLRDIFVT  338
             F       +    E++ ++Q   + +S  +LTSHIK        +   + +FLRD    
Sbjct  227  IFDRVCAKYISARREEIKRSQGINNGESEHLLTSHIKLDTTKYQLMDPINDKFLRDNVFA  286

Query  339  FIIAGGDTTASALGSFCSL  395
             ++AG DTTASAL  F S 
Sbjct  287  LLLAGRDTTASALTWFFSF  305



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 17/155 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I+      F KA+ +   AI +R+   E+ WK+Q+     G   E K+S+A  +
Sbjct  193  DPGCLSIE-MPKIEFAKALDEAEEAIFFRHFKPEIVWKMQRLL---GFGDELKMSRAHST  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML--------TSHIKTL*GNSMQFLRDIFVTF  341
            F       +    +++ +     H SS  L        T+  K L     +FLRD+ ++F
Sbjct  249  FDRVCSECIASKRDEITRGVTSIHSSSKDLLMSYMDVDTTKYKLLNPGDDKFLRDMILSF  308

Query  342  IIAGGDTTASALGSFCSL-----HKTLKLKQRSST  431
            ++AG DTT SAL  F  L       T K++Q  +T
Sbjct  309  MLAGRDTTGSALTWFFWLLSKNPEVTTKIRQEINT  343



>ref|XP_002862576.1| hypothetical protein ARALYDRAFT_920522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38834.1| hypothetical protein ARALYDRAFT_920522 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 70/139 (50%), Gaps = 14/139 (10%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DP SL I+ P  +    KA+   V  I+YR++     WKLQ  W+  GI  EKK+ +A  
Sbjct  193  DPRSLSIEMPVIESA--KALDTIVEGIVYRHVKPRFLWKLQS-WVGVGI--EKKMIEAGA  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPH-DSSGMLTSHIKT-------L*GNSMQFLRDIFVT  338
             F       +    E++ ++Q   + +S  +LTSHIK        +   + +FLRD    
Sbjct  248  IFDRVCAKYISARREEIKRSQGINNGESEHLLTSHIKLDTTKYQLMDPINDKFLRDNVFA  307

Query  339  FIIAGGDTTASALGSFCSL  395
             ++AG DTTASAL  F S 
Sbjct  308  LLLAGRDTTASALTWFFSF  326



>ref|XP_006430501.1| hypothetical protein CICLE_v10011533mg [Citrus clementina]
 gb|ESR43741.1| hypothetical protein CICLE_v10011533mg [Citrus clementina]
Length=504

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 12/129 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVI--AILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            DPG L  D T    F++A  D     +  +R   R M W ++K++  G    E+KL  + 
Sbjct  194  DPGCLGGDGTAGSEFMRAFEDAATLSSGRFRYAFRRM-WSVKKFFDIGS---ERKLKNSI  249

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
                 F   I+    E+  KT+    D       + K    NS +FLRDI ++FI+AG D
Sbjct  250  AIVHEFANNIIRSRMEE--KTENMEDDLLSRFIGNGK----NSTEFLRDIVISFILAGRD  303

Query  360  TTASALGSF  386
            TT+SAL  F
Sbjct  304  TTSSALSWF  312



>ref|XP_004489211.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 66/141 (47%), Gaps = 16/141 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFL---KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA  176
            DP  L ID     P++   KA       I YR++  +  WKLQK+    GI  EKK+++A
Sbjct  193  DPKCLSID----FPYVVCEKAFDQIEEGIFYRHVTPKFIWKLQKFL---GISHEKKMTKA  245

Query  177  DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM-----QFLRDIFVTF  341
             + F  FIY  +E   E+L K   +  +   +LT  ++   G+       +FLRD     
Sbjct  246  CKEFDQFIYASIESKKEELRKGS-KNIELVDLLTHFMRKDNGSQHIIHDDKFLRDSAFNL  304

Query  342  IIAGGDTTASALGSFCSLHKT  404
            I AG DT  S L  F  L  T
Sbjct  305  IAAGRDTITSGLTWFFYLVST  325



>gb|EYU32135.1| hypothetical protein MIMGU_mgv1a003916mg [Erythranthe guttata]
Length=555

 Score = 48.9 bits (115),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 42/131 (32%), Positives = 64/131 (49%), Gaps = 10/131 (8%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICG---GIDREKKLSQ  173
            +DP +L      ++ F  A      A L R I  E+ WKL+K+   G   G++R   L Q
Sbjct  194  KDPQTLA-PGLPENGFASAFDRATEASLQRFIFPEVIWKLKKWLRLGMEAGLNRS--LVQ  250

Query  174  ADQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAG  353
             D+  S  I     E+T Q       PHD   +L+  +K     S +FL+++ + FI+AG
Sbjct  251  VDEYLSGVINTRKLELTSQHKDAN--PHDD--LLSRFMKKKESYSDKFLQEVALNFILAG  306

Query  354  GDTTASALGSF  386
             DT++ AL  F
Sbjct  307  RDTSSVALSWF  317


 Score = 27.3 bits (59),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 11/16 (69%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            L+ QNP+VE KILN+I
Sbjct  320  LVMQNPRVENKILNEI  335



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 69/150 (46%), Gaps = 21/150 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL +D   +  +  A  D   A  YR+I+ E  WKLQK W+   +  EKKLSQA  +
Sbjct  189  DPQSLSVD-LPEIAYKTAFDDVEEAAFYRHIVPESIWKLQK-WL--NVGEEKKLSQAMDT  244

Query  186  FSNFIYPILEEMTEQLNKTQ*Q--------PHDSSGMLTSHIKTL*GNSMQ---------  314
              NF+   +    E++ + + Q          D   ++T+ IK     + Q         
Sbjct  245  IDNFLEQCISSKKEEIRQRKVQNMVQVEDNDQDDYDLITACIKEEGEAAEQMDASKKTDK  304

Query  315  FLRDIFVTFIIAGGDTTASALGSFCSLHKT  404
            +LRDI   FI AG DT  +AL  F  L  T
Sbjct  305  YLRDIGFNFIAAGKDTVNAALTWFFWLVAT  334



>ref|XP_010431920.1| PREDICTED: cytochrome P450 86B1-like, partial [Camelina sativa]
Length=424

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI YR++  E+ W++Q  +   G+  EKK+++A   
Sbjct  102  DPGCLSVE-MPEVEFARALDDAEEAIFYRHVKPEILWRMQGLF---GLGDEKKMTKARMT  157

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S  I    +E++  ++        S  +LTS++       K L  +  +FLRD  
Sbjct  158  LDRVCSECIASRRDEISRGIDNVD---SPSKDLLTSYMNLDTNKYKFLNPSDDRFLRDTV  214

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  215  LTFMLAGRDTTGSGLTWF  232



>ref|XP_006282055.1| hypothetical protein CARUB_v10028299mg [Capsella rubella]
 gb|EOA14953.1| hypothetical protein CARUB_v10028299mg [Capsella rubella]
Length=516

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 70/144 (49%), Gaps = 20/144 (14%)
 Frame = +3

Query  6    DPGSLCID-PTGDHP-FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            DP SL I+ P  +    L  I +G+I   YR+      WKLQK WI  GI  EKK+++  
Sbjct  194  DPRSLSIEMPENESATALNNIGEGLI---YRHAKPIFLWKLQK-WIGFGI--EKKMTEGG  247

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLR  323
              F       +    E++ K+Q    D     +  +L SHIK        L   + +FLR
Sbjct  248  AIFDRVCAEYISAKREEIKKSQENNQDHVDGENEDILASHIKLDTTKYQLLNPINDKFLR  307

Query  324  DIFVTFIIAGGDTTASALGSFCSL  395
            D  V F++AG DTTASAL  F  L
Sbjct  308  DTIVGFLLAGRDTTASALTWFFWL  331



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 67/137 (49%), Gaps = 21/137 (15%)
 Frame = +3

Query  21   CIDPTGDHP-----------FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKL  167
            CI  TG +P           F KAI D   A+ YR+   E  WKLQ+ W+  G  +E K+
Sbjct  181  CILVTGYNPKCLSIAFPEVEFSKAIDDAEEALFYRHFCPEYTWKLQR-WL--GFGQEWKM  237

Query  168  SQADQSFSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKT-L*GNSMQ----FLRD  326
             +A +   +     +    EQL +      D  G  +LTS++ + +  N  Q    FLRD
Sbjct  238  EKAWKVLDDVSARFVSRKREQLKEGSILREDGEGVDLLTSYMSSEVESNGPQPEDKFLRD  297

Query  327  IFVTFIIAGGDTTASAL  377
              + F++AG DTT+SAL
Sbjct  298  TIINFLLAGRDTTSSAL  314



>gb|EMT05588.1| Cytochrome P450 86A2 [Aegilops tauschii]
Length=508

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 72/142 (51%), Gaps = 10/142 (7%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF +A+ D +  ++ R+I+   CW+L   +  G    EKK++ A +
Sbjct  191  DPGCLQIGLPV--VPFARAMGDVLATVVLRHIIPPACWRLMYRYELG---PEKKMAVARR  245

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN-SMQFLRDIFVTFIIAGGD  359
            +   F   ++ +             +SS ML+S I    G+ S +FLRD  V  ++AG D
Sbjct  246  TIDQFAADMIAKRKSDHKLCGESVSESSDMLSSFISN--GDASDEFLRDTAVNLLLAGRD  303

Query  360  TTASALGSFCSLH-KTLKLKQR  422
            TT +AL  F  L  K  +++QR
Sbjct  304  TTGTALSWFFYLLCKNPRVEQR  325



>ref|XP_009397609.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=543

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/132 (32%), Positives = 63/132 (48%), Gaps = 10/132 (8%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P   + PF KA  D   A   R I+    WK  +Y   G    E+ L ++ +
Sbjct  216  DPG--CLRPGLPEIPFAKAFEDATEATTMRFIMPTGVWKALRYLDLGS---ERWLRRSIE  270

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIA  350
                F Y ++    E+L+ ++      S +LT   K    +    S +FLRD+ V FI+A
Sbjct  271  VVDEFAYEVIRARREELSSSEQTRTARSDLLTVFTKLTDEDGKPYSDKFLRDVCVNFILA  330

Query  351  GGDTTASALGSF  386
            G DT++ AL  F
Sbjct  331  GRDTSSVALAWF  342



>ref|XP_006482030.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 12/129 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVI--AILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
            DPG L  D T    F++A  D     +  +R   R M W ++K++  G    E+KL  + 
Sbjct  194  DPGCLGGDGTAGSEFMRAFEDAATLSSGRFRYAFRHM-WSVKKFFDIGS---ERKLKNSI  249

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
                 F   I+    E+  KT+    D       + K    NS +FLRDI ++FI+AG D
Sbjct  250  AIVHEFANNIIRSRMEE--KTENMEDDLLSRFIGNGK----NSTEFLRDIVISFILAGRD  303

Query  360  TTASALGSF  386
            TT+SAL  F
Sbjct  304  TTSSALSWF  312



>dbj|BAJ86572.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 6/128 (5%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I    + PF +A+ D +  +L RN+L    WKL + W+  G+  E+K++ A + 
Sbjct  194  DPGCLAIG-FPEVPFARAMDDAMDVLLVRNVLPPSWWKLVR-WL--GVGYERKMAVAWRD  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIK-TL*GNSMQFLRDIFVTFIIAGGDT  362
               FI   + +  E + K +    DS+ +L+S+I          FLRD  +  ++AG DT
Sbjct  250  IDRFIGDTIAKRREVV-KARGGIDDSADLLSSYIHDDDDDVVDAFLRDTTMNLMLAGRDT  308

Query  363  TASALGSF  386
            T S L  F
Sbjct  309  TGSGLSWF  316



>emb|CDX72690.1| BnaC07g47120D [Brassica napus]
Length=507

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 68/143 (48%), Gaps = 16/143 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   D    KA+ D    IL R++     WK+Q  W+  G+ +EKK+SQA+ +
Sbjct  208  DPSSLSIEMHEDE-LAKALDDTGKGILSRHVKPRFLWKMQN-WM--GLGQEKKMSQANAT  263

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDTT  365
            F   +     E  + L            + T+  K L  +  +FLRD  +TFIIAG DT 
Sbjct  264  FDRLLDMTNGEGEDLLTSLM-------KLDTTKYKLLNPSDDKFLRDTILTFIIAGRDTI  316

Query  366  ASALGSFCSL-----HKTLKLKQ  419
            A  L  F  L     H   K++Q
Sbjct  317  AFTLSWFFWLLSENPHVVAKIRQ  339



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 78/155 (50%), Gaps = 17/155 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I+   +  F +A+ +   AI +R++  EM WK+Q+     G+  E K+ +A  +
Sbjct  193  DPGCLSIE-MPEIEFSRALDEAEEAIFFRHVKPEMFWKMQR---LIGVGDELKMKKAHST  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSS-GMLTSHI-------KTL*GNSMQFLRDIFVTF  341
            F       +    +++ +       SS  +LTS++       K L  +  +FLRD+ ++F
Sbjct  249  FDRVCSKCIASKRDEITRGAVNIDPSSEDLLTSYMHVDTIKYKLLNPSDDRFLRDMILSF  308

Query  342  IIAGGDTTASALGSFCSL-----HKTLKLKQRSST  431
            ++AG DTT SAL  F  L       T K++Q  +T
Sbjct  309  MLAGRDTTGSALTWFFWLLSKNPKATTKIRQEFNT  343



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score = 50.8 bits (120),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 8/132 (6%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            RDP  L ID   +    KA       I YR+I+ +  WK+Q+ W+   I +E+K+++A +
Sbjct  190  RDPECLSID-FPEVAVEKAFNQAEECIFYRHIVPKSVWKVQQ-WL--QIGQERKMTEACK  245

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ----FLRDIFVTFIIA  350
            +   FIY  +    E L + +        +LT+ ++   G        FLRD      +A
Sbjct  246  TLDEFIYSCIASKREDLMENETGKTFQVDLLTTLMREGKGKGEAHDDTFLRDAVFNLFVA  305

Query  351  GGDTTASALGSF  386
            G DT  SAL  F
Sbjct  306  GRDTITSALTWF  317


 Score = 25.0 bits (53),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+A NP VEAKIL +I
Sbjct  319  WLVATNPLVEAKILEEI  335



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score = 50.1 bits (118),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 5/128 (4%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L +D   +    KA  +   +I YR+ + +  WKLQK W+   I +EKK+++A ++
Sbjct  191  DPNCLSVD-IPEVAIEKAFNEAEESIFYRHTVPKCVWKLQK-WL--QIGQEKKMTEACKT  246

Query  186  FSNFIYP-ILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
               FI+  I  +  E  N  +        ++T+ ++    +  +F+RD      +AG DT
Sbjct  247  LDQFIHACIASKRVELSNDNEMGEAHHVDLITALMREKQTHDDRFIRDAVFNLFVAGRDT  306

Query  363  TASALGSF  386
              SAL  F
Sbjct  307  ITSALTWF  314


 Score = 25.8 bits (55),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 3/28 (11%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDK  472
            L+A NP VEAKIL +I   K+ L   +K
Sbjct  317  LVATNPLVEAKILEEI---KEKLETNEK  341



>ref|XP_010682470.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=894

 Score = 50.4 bits (119),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 65/139 (47%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG + +D   + PF KA  +     L+R ++  + WK  +++    I  E+KL  A + 
Sbjct  202  DPGCVALD-LPEIPFAKAFEEATEYSLFRFLVPPIVWKTMRFF---NISNERKLKDAVKI  257

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT----L*GNSM--------QFLRDI  329
               F    ++     LNK     H+   +L+  IK     L  NS         +FL+D 
Sbjct  258  VHEFAETTVKNRKADLNKPGKLDHEPCDLLSRLIKMQDHQLHKNSHDITTVFSDKFLKDF  317

Query  330  FVTFIIAGGDTTASALGSF  386
             ++FI+AG DT++ AL  F
Sbjct  318  CISFILAGRDTSSVALVWF  336


 Score = 25.4 bits (54),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQ-LKQNLAKQDKL  475
            LL +NP VE KIL++I + L +  A +D+L
Sbjct  339  LLHENPNVENKILHEINEILTKRGATKDEL  368



>gb|EMT10522.1| Cytochrome P450 86A1 [Aegilops tauschii]
Length=514

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 46/145 (32%), Positives = 71/145 (49%), Gaps = 13/145 (9%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L ID P    PF +A+ D +  +  R+I+   CWKL   +  G    E+K++ A +
Sbjct  193  DPGCLQIDLPV--VPFARAMDDVLETLFLRHIISPACWKLMYRYEVG---TERKMAAARR  247

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ----FLRDIFVTFIIA  350
            +   F    + +             DSS ML+S I    G++ +    FLRD  V  ++A
Sbjct  248  TIDRFAADTIAKRRADHKLGDEGVTDSSDMLSSFICN--GDASEYSDDFLRDTTVNLLLA  305

Query  351  GGDTTASALGSFCS-LHKTLKLKQR  422
            G DTT +AL  F   L K  +++Q+
Sbjct  306  GRDTTGAALSWFFYLLSKNPRVEQK  330



>ref|XP_006287519.1| hypothetical protein CARUB_v10000726mg [Capsella rubella]
 gb|EOA20417.1| hypothetical protein CARUB_v10000726mg [Capsella rubella]
Length=518

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 68/139 (49%), Gaps = 16/139 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   ++    A+ +    ++YR+      WKLQK WI  GI  EKK+ +A   
Sbjct  194  DPRSLSIE-MPENESATALNNIGQGLVYRHAKPRFLWKLQK-WIGVGI--EKKMIEAGAV  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHD-----SSGMLTSHIKT-------L*GNSMQFLRDI  329
            F       +    E++  +Q   HD     +  +L SH+K        L   + +FLRD 
Sbjct  250  FDRVCAKYISTKREEIKTSQGMTHDHLDGDNEDILASHMKLDTTKYQLLNPINDKFLRDT  309

Query  330  FVTFIIAGGDTTASALGSF  386
             + F++AG DTTASAL  F
Sbjct  310  IIGFLLAGRDTTASALTWF  328



>ref|XP_004985761.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=503

 Score = 51.6 bits (122),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  6    DPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG L I  P    PF +A+ D +  +  R+I    CWKL      G   +EKK++ A +
Sbjct  192  DPGCLAIGLPVV--PFARAMDDALETLFLRHITPMPCWKLMNRLKVG---QEKKMAAARR  246

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTS---HIKTL*GNSMQFLRDIFVTFIIAG  353
            +   F+   + +   + +K +    +S+ +L+S   H K    N   FLRD  V  ++AG
Sbjct  247  TIDCFVAATVAK--RRADKIEQGITESADLLSSFICHEKDSSHNDDVFLRDTTVNLLLAG  304

Query  354  GDTTASALGSF  386
             DTT +AL  F
Sbjct  305  RDTTGAALSWF  315


 Score = 23.9 bits (50),  Expect(2) = 9e-06, Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 0/26 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQ  466
            LL +NP+VE KIL+++  +    A +
Sbjct  318  LLCKNPRVEQKILDELAPVASRKASE  343



>gb|AJD25224.1| cytochrome P450 CYP96A84 [Salvia miltiorrhiza]
Length=485

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 17/125 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDH-PFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P   H PF +A+     +I  R++L E  WKLQ+ WI  G+  E+KL +A +
Sbjct  187  DPG--CLSPDLPHVPFAEAMDAAEESIFMRHVLPERVWKLQR-WI--GVGSERKLMRARK  241

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
                    IL+ +   L  ++ + ++   +L+S++        +FLRD  +  +IAG DT
Sbjct  242  --------ILDGVIGNLIASK-RNNEGDDLLSSYMNM--NQDSRFLRDTVLNLMIAGRDT  290

Query  363  TASAL  377
            T+SAL
Sbjct  291  TSSAL  295



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F +A+ D   AI YR+I  E+ W++Q      G+  EKK+++A   
Sbjct  192  DPGCLSVE-MPEVEFARALDDAEEAIFYRHIKPEILWRMQGL---VGLGDEKKMTKARTT  247

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S  I     E++  +N        S  +LTS++       K L  +  +FLRD  
Sbjct  248  LDRVCSECISSRRGEVSRGINNVD---SPSKDLLTSYMNLDTTKYKLLDPSDDRFLRDTI  304

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  305  LTFMLAGRDTTGSGLTWF  322



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 17/155 (11%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I+   +  F +A+ +   A+ +R++  EM WK+Q+     G   E K+ +A  +
Sbjct  193  DPGCLSIE-MPEIEFARALDEAEEALFFRHVKPEMVWKMQR---LIGFGDELKMKRAHST  248

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGML--------TSHIKTL*GNSMQFLRDIFVTF  341
            F       +    +++++       SS  L        T+  K L  +  +FLRD+ ++F
Sbjct  249  FDRVCSKCIASKRDEVSRGLINIDSSSKDLLMSYMDVDTTKYKLLNPSDEKFLRDMILSF  308

Query  342  IIAGGDTTASALGSFCSL-----HKTLKLKQRSST  431
            +IAG DTT SAL  F  L       T K++Q  +T
Sbjct  309  MIAGRDTTGSALTWFFWLLSKNPQATAKIRQEINT  343



>ref|XP_002523775.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38624.1| cytochrome P450, putative [Ricinus communis]
Length=550

 Score = 53.1 bits (126),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 63/133 (47%), Gaps = 10/133 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   + PF +A  D   A + R +     WK  KY   G    EKKL  + ++
Sbjct  223  DPGCLNLD-LPEIPFARAFEDATEATVLRFVTPTCIWKAMKYLDLGA---EKKLKGSIKA  278

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG--MLTSHIKTL*GN----SMQFLRDIFVTFII  347
               F   ++    ++++ T        G  +LT  ++    N    S +FLRDI V FI+
Sbjct  279  VDEFAEKVIRTRKKEMSSTTSDDDKKHGSDILTVFMRLKDENGKPFSDKFLRDICVNFIL  338

Query  348  AGGDTTASALGSF  386
            AG DT++ AL  F
Sbjct  339  AGRDTSSVALSWF  351


 Score = 22.3 bits (46),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 9/19 (47%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQL  445
            LL ++P+VE KIL +I ++
Sbjct  354  LLDKHPKVEEKILAEIYKI  372



>ref|XP_006279822.1| hypothetical protein CARUB_v10028124mg [Capsella rubella]
 gb|EOA12720.1| hypothetical protein CARUB_v10028124mg [Capsella rubella]
Length=514

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 78/160 (49%), Gaps = 21/160 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+   +  F KA+ +    ++YR+      WKLQ  W+  GI  EKK+++A   
Sbjct  192  DPRSLSIE-MPEIEFAKALDNIGEGLIYRHAKPRFLWKLQN-WLGVGI--EKKMTEAGVI  247

Query  186  FSNFIYPILEEMTEQLNKTQ*--QPH---DSSGMLTSHIKT-------L*GNSMQFLRDI  329
            F       +    E++ ++Q   Q H   +S  +LTS IK        L   + +FLRD 
Sbjct  248  FDRVCAKYISTKREEIKRSQGINQDHFEGESEDILTSFIKLDMTKHQLLNPINDKFLRDT  307

Query  330  FVTFIIAGGDTTASALGSFCSL-----HKTLKLKQRSSTI  434
             V F+IAG DTTA+AL  F  L         K++Q   TI
Sbjct  308  VVFFMIAGRDTTAAALTWFFWLLSENPRVVTKIRQEIDTI  347



>gb|KFK25188.1| hypothetical protein AALP_AA8G078400 [Arabis alpina]
Length=557

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 75/145 (52%), Gaps = 12/145 (8%)
 Frame = +3

Query  6    DPGSLCIDPT-GDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+DP   + PF KA  D   A + R ++    WK+ ++ + G    EKKL ++ +
Sbjct  222  DPG--CLDPNLPEIPFAKAFEDATEATVLRFVMPTFVWKILRFLVLGT---EKKLKESIK  276

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSH--IKTL*GNSM--QFLRDIFVTFIIA  350
                F   ++    ++L+  + +    S +LT    ++   G +   +FLRDI V FI+A
Sbjct  277  CVDGFADEVIRTRKKELS-LETEIAKRSDLLTIFMGLRDEIGENFSDKFLRDICVNFILA  335

Query  351  GGDTTASALG-SFCSLHKTLKLKQR  422
            G DT++ AL   F  L K  ++++R
Sbjct  336  GRDTSSVALSWFFWILEKNPEVEER  360



>ref|XP_009613728.1| PREDICTED: cytochrome P450 704C1-like [Nicotiana tomentosiformis]
Length=231

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +3

Query  114  WKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT  293
            WK++++   G    E  L +  +  + F+Y I+   TEQ+NK+Q     S   + S    
Sbjct  111  WKVKRFLNVGS---EANLKKCIKVVAEFVYKIISSKTEQMNKSQDDRVMSKSDILSRFLE  167

Query  294  L*GNSMQFLRDIFVTFIIAGGDTTASALGSF  386
            +     ++L+DI ++FIIAG DT AS L  F
Sbjct  168  MNERDPKYLKDIILSFIIAGKDTPASTLSCF  198



>ref|XP_001782495.1| predicted protein [Physcomitrella patens]
 gb|EDQ52714.1| predicted protein [Physcomitrella patens]
Length=528

 Score = 46.2 bits (108),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 64/137 (47%), Gaps = 12/137 (9%)
 Frame = +3

Query  6    DPGSLCIDP-TGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQ  182
            DPG  C+ P     PF +A        L R ++ E+ W++ +     G   E +L++A  
Sbjct  195  DPG--CLAPGLPTVPFAQAFDLATEGTLTRMVVPEIFWRITR---ALGWGMEGRLAKAIS  249

Query  183  SFSNFIYPILEEMTEQLN--KTQ*QPHDSSGMLTSHIKTL*--GNSM--QFLRDIFVTFI  344
            +   F   ++ E   +LN  KT         +L+  ++T    GN    +FLRD+   FI
Sbjct  250  TIDKFAADVITERRRELNMLKTLNATEYPCDLLSRFMQTTDHEGNPYTDRFLRDVTTNFI  309

Query  345  IAGGDTTASALGSFCSL  395
            +AG DTTA AL  F  L
Sbjct  310  LAGRDTTAIALSWFFYL  326


 Score = 29.3 bits (64),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQN  454
            L+ QNP VE KILN+I ++ Q+
Sbjct  326  LITQNPAVEEKILNEIREILQS  347



>gb|KDO82148.1| hypothetical protein CISIN_1g041858mg [Citrus sinensis]
Length=528

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 9/143 (6%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L ID   + PF KA  +     L+R +L    WK  K +   G+  E++L  A Q 
Sbjct  206  DPGCLAID-LPEVPFAKAFEEATELSLFRFLLPPFIWKPMKLF---GLGYERRLKIAIQI  261

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM---QFLRDIFVTFIIAGG  356
              +F   I+ +   +L +      D S +L+  + T   N     ++ RD  V+FI+AG 
Sbjct  262  VQDFADKIVSDRRNKLTRLG-SLIDQSDLLSRLMDTEEKNGHLPDKYYRDFSVSFILAGR  320

Query  357  DTTASALG-SFCSLHKTLKLKQR  422
            DTT+ AL   F  LHK L+++ +
Sbjct  321  DTTSVALTWFFWLLHKNLEVETK  343



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 71/138 (51%), Gaps = 18/138 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA---  176
            DPG L ++   +  F KA+ D   AI YR++  E+ W++Q      G+  EKK+++A   
Sbjct  192  DPGCLSVE-MPEVEFAKALDDAEEAIFYRHVKPEIFWRIQGLL---GLGDEKKMTKARMT  247

Query  177  -DQSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIF  332
             D+  S  I    +E++  ++        S  +LTS++       K L  +  +FLRD  
Sbjct  248  LDRVCSECIASRRDEISRGIDNVD---SPSKDLLTSYMNLDTTKYKLLNPSDDRFLRDTV  304

Query  333  VTFIIAGGDTTASALGSF  386
            +TF++AG DTT S L  F
Sbjct  305  LTFMLAGRDTTGSGLTWF  322



>gb|KFK22570.1| hypothetical protein AALP_AAs72953U000100 [Arabis alpina]
Length=500

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 11/118 (9%)
 Frame = +3

Query  66   DGVI-AILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQLNKT  242
            DGV+  + YR+ +    WKLQK WI  G+  EK++ +   SF      I+    E+L   
Sbjct  211  DGVVDGLFYRHFMPVFLWKLQK-WI--GVGVEKRMKRGLASFDKLFEKIISAKREELKTH  267

Query  243  Q*QPHDSSGMLTSHI-------KTL*GNSMQFLRDIFVTFIIAGGDTTASALGSFCSL  395
                 ++  +LT ++       K L  +S +F+RDI   F+IAG DTT++AL  F  L
Sbjct  268  IDSKGEAVDVLTYYLTMDTTKYKHLKLSSDKFIRDIIFGFLIAGRDTTSTALTWFFWL  325



>gb|EPS72790.1| hypothetical protein M569_01963, partial [Genlisea aurea]
Length=491

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 9/131 (7%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQA-DQ  182
            DPG L +D   D PF  A+     AI  R+IL E  WK+ ++   G   R K+     D+
Sbjct  182  DPGCLSVD-LPDVPFSAAMDTAEEAIFIRHILPETLWKIGRFLRIGYEQRLKRAHGVLDR  240

Query  183  SFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
               ++I     E+++   K      +S  +LTS+I      + +FLRD  +  +IAG DT
Sbjct  241  VIGDYIAMKKSELSDPTRK------NSDDLLTSYISES-DVTDKFLRDTVLNLMIAGRDT  293

Query  363  TASALGSFCSL  395
            T+SAL  F  L
Sbjct  294  TSSALTWFIWL  304



>ref|XP_006405689.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
 gb|ESQ47142.1| hypothetical protein EUTSA_v10028261mg, partial [Eutrema salsugineum]
Length=538

 Score = 50.4 bits (119),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 65/139 (47%), Gaps = 22/139 (16%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP SL I+      F KA+ D    I+YR+ L+  C          G  +E KL +AD +
Sbjct  205  DPRSLSIEMPEVDEFTKALNDVGEVIMYRH-LKPSCKD------GFGFGQETKLFKADAT  257

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIKT-------L*GNSMQFLRDI  329
                    +    E++  +    H+S+G     +LTSH+K        L  N  +FLRD 
Sbjct  258  LRRVCAQFISAKREEIITSD---HNSNGESDHDLLTSHMKLDATKYELLNPNDDKFLRDT  314

Query  330  FVTFIIAGGDTTASALGSF  386
             + FI+AG DTTAS L  F
Sbjct  315  MLAFILAGRDTTASGLTWF  333


 Score = 24.6 bits (52),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 17/30 (57%), Gaps = 3/30 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDKL  475
            LLL++NPQV  KI  +I     NL   D +
Sbjct  335  LLLSENPQVVTKIRQEI---NTNLPNNDSM  361



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score = 50.1 bits (118),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 5/128 (4%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP  L +D   +    KA  +   +I YR+ + +  WKLQK W+   I +EKK+++A ++
Sbjct  191  DPNCLSVD-IPEVAIEKAFNEAEESIFYRHTVPKCVWKLQK-WL--QIGQEKKMTEACKT  246

Query  186  FSNFIYP-ILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGDT  362
               FI+  I  +  E  N  +        ++T+ ++    +  +F+RD      +AG DT
Sbjct  247  LDQFIHACIASKRVELSNDNEMGEAHHVDLITALMREKQTHDDRFIRDAVFNLFVAGRDT  306

Query  363  TASALGSF  386
              SAL  F
Sbjct  307  ITSALTWF  314


 Score = 25.0 bits (53),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 3/29 (10%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDILQLKQNLAKQDK  472
             L+A NP VEAKIL +I   K+ L   +K
Sbjct  316  WLVATNPLVEAKILEEI---KEKLETNEK  341



>ref|XP_003558844.1| PREDICTED: cytochrome P450 86B1-like [Brachypodium distachyon]
Length=522

 Score = 49.3 bits (116),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 63/135 (47%), Gaps = 19/135 (14%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L I    + PF +A+ D +  +  R+++   CWKL      G    EKK++ A ++
Sbjct  192  DPGCLAIG-LPEIPFARAMDDVLETLFLRHLISPACWKLMYRLELG---PEKKMAVARRT  247

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSG-----MLTSHIKT---L*GNSMQFLRDIFVTF  341
               F         E + K +   H++S      ML+S I         S +FLRD  V  
Sbjct  248  IDRF-------AAETIAKRRADSHETSAAHGADMLSSFIGQDDHTGEYSDEFLRDTTVNL  300

Query  342  IIAGGDTTASALGSF  386
            ++AG DTT +AL  F
Sbjct  301  LLAGRDTTGAALAWF  315


 Score = 25.4 bits (54),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDI  436
            LL+QNP+VE KIL ++
Sbjct  318  LLSQNPRVEQKILAEL  333



>emb|CDY42628.1| BnaC01g00400D [Brassica napus]
Length=557

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 17/143 (12%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DP +L ++   D  + +A+      I +R+++ +  WKLQK WI  G  +EK+  +AD +
Sbjct  191  DPKTLSVEMPEDE-YAEALDVLGEGIFFRHVIPKFLWKLQK-WI--GFGQEKRTMEADAT  246

Query  186  FSNFIYP-ILEEMTEQLNKTQ*QPHDSSG-----MLTSHIKT-------L*GNSMQFLRD  326
            F       IL +  E L++       S+G     +LTSH+K        L  +  +FLRD
Sbjct  247  FDRVSAKYILAKRHEVLSQGIHDQQQSNGECHEDLLTSHMKLDTTKYELLNPSDDKFLRD  306

Query  327  IFVTFIIAGGDTTASALGSFCSL  395
              + F +AG DTTASAL  F  L
Sbjct  307  TILAFNLAGRDTTASALSWFFWL  329



>ref|XP_004968445.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=510

 Score = 49.7 bits (117),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 64/129 (50%), Gaps = 15/129 (12%)
 Frame = +3

Query  21   CIDPTGDHP-FLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNF  197
            C+  +   P F +A ++   A+L+R+I+    WKL + W+  G   EKKL+ A    + F
Sbjct  201  CLSVSSPMPVFGRATKEAEEALLFRHIVPSRLWKLLR-WLNVGT--EKKLADAKMVINQF  257

Query  198  IYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSM------QFLRDIFVTFIIAGGD  359
            IY   EE+ ++  K Q      + +L+ ++K     SM      QFLRD  V  I+AG D
Sbjct  258  IY---EEIAKR--KAQGSNGSQADLLSMYMKVTLDPSMSEHQKTQFLRDTAVGLILAGKD  312

Query  360  TTASALGSF  386
              A  L  F
Sbjct  313  LIAVTLTWF  321


 Score = 25.0 bits (53),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVF  481
            ++ ++P VEAKIL ++  LK +    D  VF
Sbjct  324  MMCKHPNVEAKILEELKGLKSSTWPGDFSVF  354



>ref|XP_003538960.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=562

 Score = 49.3 bits (116),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 62/131 (47%), Gaps = 8/131 (6%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +    + PF KA  D   A ++R +     WK  K+   G    E+KL+++ + 
Sbjct  231  DPGCLQLG-LPEIPFAKAFEDATEATVFRFVTPTCLWKAMKFLNLG---MERKLNKSIKG  286

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GN----SMQFLRDIFVTFIIAG  353
               F   ++    ++L+           +LT  ++    N    S +FLRDI V FI+AG
Sbjct  287  VDEFAESVIRTRKKELSLQCEDSKQRLDLLTVFMRLKDENGQAYSDKFLRDICVNFILAG  346

Query  354  GDTTASALGSF  386
             DT++ AL  F
Sbjct  347  RDTSSVALSWF  357


 Score = 25.8 bits (55),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQL  445
            LL QNPQVE  IL +I ++
Sbjct  360  LLEQNPQVEENILAEICKV  378



>ref|XP_007150920.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
 gb|ESW22914.1| hypothetical protein PHAVU_004G005700g [Phaseolus vulgaris]
Length=457

 Score = 50.8 bits (120),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 6/120 (5%)
 Frame = +3

Query  54   KAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMTEQL  233
            KA      +I YR+I  +  WKLQK+   GG   E+K+++A +SF  FI+ ++    E L
Sbjct  206  KAFSQAEESIFYRHIKPKSLWKLQKWLQIGG---ERKMTEACKSFDQFIHALIASKLEAL  262

Query  234  NKTQ*QP--HDSSGMLTSHIKT-L*GNSMQFLRDIFVTFIIAGGDTTASALGSFCSLHKT  404
            +K         S+ +LT+ ++     +  +FLRD      +AG D   S L  F  L  T
Sbjct  263  SKCNENETGEASADLLTTLMREGKEEHDARFLRDAMFNLFVAGRDAITSVLTWFFWLVAT  322


 Score = 23.9 bits (50),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  386  LLLAQNPQVEAKILNDI  436
             L+A NP VEAKIL ++
Sbjct  318  WLVATNPLVEAKILEEM  334



>ref|XP_007052008.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96165.1| Cytochrome P450 family protein [Theobroma cacao]
Length=514

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 16/131 (12%)
 Frame = +3

Query  15   SLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSN  194
            S+C        F  A  D   AIL+R +  ++ WK++++   G    E  L ++ +   N
Sbjct  199  SMCGSNLEGKQFTAAFDDSSAAILFRYV--DIFWKIKRFLNIGS---EATLKKSIEVVDN  253

Query  195  FIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ-------FLRDIFVTFIIAG  353
            F+Y ++    EQ+  ++    D S ++    + +    +Q       +LRDI + FIIAG
Sbjct  254  FVYKLIHNKIEQMRNSK----DESSIMQMKKEDILSRFLQVSDTDPTYLRDIILNFIIAG  309

Query  354  GDTTASALGSF  386
             DTTA+ L  F
Sbjct  310  KDTTAATLSWF  320



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 10/127 (8%)
 Frame = +3

Query  45   PFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQSFSNFIYPILEEMT  224
            PFLKA+ D    +  R +L E  WKLQK W+  G+  E +L +A       I   +    
Sbjct  205  PFLKAMDDAKYVVSIRYLLPESIWKLQK-WL--GVGPEMQLRKASDVLDRVIGEYILMKR  261

Query  225  EQLNKTQ*QPHDSSG--MLTSHI-----KTL*GNSMQFLRDIFVTFIIAGGDTTASALGS  383
            E+L++ +    +  G  +LT +I     +T      +FLRD F+ F+ AG DT +S L  
Sbjct  262  EELSRVEKCKENEEGFDLLTPYIINDGERTSGLKFDKFLRDTFLNFMFAGHDTVSSGLTW  321

Query  384  FCSLHKT  404
            F  L  T
Sbjct  322  FIWLVST  328



>emb|CBH32607.1| cytochrome P450, putative, expressed [Triticum aestivum]
 emb|CDM86333.1| unnamed protein product [Triticum aestivum]
Length=514

 Score = 52.8 bits (125),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 11/133 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +    + PF +AI D +  +L R++L    WKL +     G+  E+K++ A + 
Sbjct  194  DPGCLAVG-FPEVPFARAIDDAMDVLLVRSLLPLSWWKLVRRL---GVGYERKMAVAGRD  249

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQ------FLRDIFVTFII  347
               FI   + +  E +  T     DS+ +L+S+I    G++        FLRD  +  +I
Sbjct  250  IDRFIGDTIAKRREAVKATG-GIEDSADLLSSYIDDDDGDAGSGTVVDVFLRDTTLNLVI  308

Query  348  AGGDTTASALGSF  386
            AG DTT SAL  F
Sbjct  309  AGRDTTGSALTWF  321


 Score = 21.9 bits (45),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (53%), Gaps = 0/34 (0%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDKLVFNIP  490
            LL +NP V +KIL ++  +K      D +V   P
Sbjct  324  LLTRNPGVVSKILAELDTIKTTTTTLDGMVTYDP  357



>ref|XP_011034022.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=532

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 13/147 (9%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L +D   D PF KA       IL+R ++    WK  K++   GI  EK L +A   
Sbjct  210  DPGCLALD-IPDVPFAKAFEKATELILFRFLIPPFIWKTMKFF---GIGYEKTLKEAVGI  265

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDS---SGMLTSHIKTL*GNSMQF----LRDIFVTFI  344
               F    ++   +++ K     H S   S ++      L G  +QF     RD+ V FI
Sbjct  266  VHEFAEKTVKGRRDEIRKHGSLCHQSDLLSRLIEIEYNGL-GKELQFPDKYFRDLCVNFI  324

Query  345  IAGGDTTASALGSFCSL-HKTLKLKQR  422
            +AG DTT+ AL  F  L H   +++ R
Sbjct  325  LAGRDTTSVALAWFFWLVHSNPQVENR  351



>ref|XP_008461361.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
melo]
Length=588

 Score = 48.9 bits (115),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 61/133 (46%), Gaps = 10/133 (8%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQADQS  185
            DPG L      + PF KA  D     + R I     WK  +Y     I  EKKL Q+ ++
Sbjct  256  DPGCLR-GGLPEIPFAKAFEDATEVTVMRFITPTFIWKAMRYL---NIGIEKKLKQSIKA  311

Query  186  FSNFIYPILEEMTEQLNKTQ*QPHDS--SGMLTSHIKTL*GN----SMQFLRDIFVTFII  347
               F   +++    +L+       D+  S +LT  +K         S +FLRDI V FI+
Sbjct  312  VDEFAENVIQTRKRELSTPAESQADNKRSDLLTVFMKLRDEQGRPFSDKFLRDICVNFIL  371

Query  348  AGGDTTASALGSF  386
            AG DT++ AL  F
Sbjct  372  AGRDTSSVALSWF  384


 Score = 25.8 bits (55),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQL--KQNLAKQDKLVFN  484
            LL QNP VE KIL +I ++  ++  AK  +L F+
Sbjct  387  LLDQNPDVEDKILAEICRIVGEREEAKTRELRFD  420



>ref|XP_010414809.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=495

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (50%), Gaps = 20/151 (13%)
 Frame = +3

Query  6    DPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQ--AD  179
            DP SL  +   +  F +A+  G  AI YR++   + WKLQK WI  G++R+ ++S    D
Sbjct  194  DPMSLSTE-MPEVEFAEAVDLGEEAIFYRHLKPVILWKLQK-WIGIGLERKLRVSMLTVD  251

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKT-------L*GNSMQFLRDIFVT  338
            +  +  I    EE++    +T      S  +LT +I         L   + +F+RD+  +
Sbjct  252  EMLAKIISSRREEISRGERET------SMDVLTYYINVDTIKYRFLKPRNDKFIRDVVFS  305

Query  339  FIIAGGDTTASALGSF---CSLHKTLKLKQR  422
             +IAG DTT+SA   F    S+H  +  K R
Sbjct  306  LLIAGRDTTSSAFTWFFWLLSMHPQVMAKIR  336



>gb|EYU23445.1| hypothetical protein MIMGU_mgv1a026937mg [Erythranthe guttata]
Length=523

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 7/132 (5%)
 Frame = +3

Query  3    RDPGSLCIDPTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGG-IDREKKLSQAD  179
            +DP +L +D   D+ F  A      A L R I  E  WKL+K+   G  +   + L   D
Sbjct  194  KDPQTLAVD-MPDNSFAAAFDRATEATLQRFIFPEFVWKLKKWLRLGTELSLSRNLKHVD  252

Query  180  QSFSNFIYPILEEMTEQLNKTQ*QPHDSSGMLTSHIKTL*GNSMQFLRDIFVTFIIAGGD  359
            +  +N I     E+T Q N      HD   +L+  +K     + +FL+ + + FI+AG D
Sbjct  253  EYMTNVISTRKLELTSQQNGVV---HDD--LLSRFMKKKEPYTDEFLQYVVLNFILAGRD  307

Query  360  TTASALGSFCSL  395
            T+++AL  F  L
Sbjct  308  TSSAALSWFFWL  319



>ref|XP_004489209.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=511

 Score = 51.2 bits (121),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 16/136 (12%)
 Frame = +3

Query  3    RDPGSLCID-PTGDHPFLKAIRDGVIAILYRNILREMCWKLQKYWICGGIDREKKLSQAD  179
             DP  L ID P  +    KA      +I YR+ +    W+LQK W+   I  EKK++ A 
Sbjct  192  HDPNCLSIDFPEIECE--KAFNQAEESIFYRHTVPLCVWRLQK-WL--QIGEEKKMTDAC  246

Query  180  QSFSNFIYPIL----EEMTEQLNKTQ*QPHDSSG------MLTSHIKTL*GNSMQFLRDI  329
            + F +F+Y  +    EE+T+  NK Q    D S       ++T   K    N  +FLRD 
Sbjct  247  KVFDHFLYDCIASKREELTKNSNKNQNIETDESHVDLLTYLITEEEKKGESNDDKFLRDA  306

Query  330  FVTFIIAGGDTTASAL  377
                 +AG DT  S+L
Sbjct  307  AFNLFVAGRDTITSSL  322


 Score = 23.1 bits (48),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 3/28 (11%)
 Frame = +2

Query  389  LLAQNPQVEAKILNDILQLKQNLAKQDK  472
            L+A +P VEAKIL +I   K+    ++K
Sbjct  328  LVATHPLVEAKILEEI---KEKFGHKEK  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510