BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029N16

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766381.1|  PREDICTED: early light-induced protein, chlo...    100   1e-33   Nicotiana sylvestris
ref|XP_004247604.1|  PREDICTED: early light-induced protein 1, ch...  95.9    6e-33   
ref|XP_006363471.1|  PREDICTED: early light-induced protein, chlo...  97.1    7e-33   Solanum tuberosum [potatoes]
ref|XP_004247605.1|  PREDICTED: early light-induced protein 1, ch...  95.5    8e-33   
ref|XP_009616081.1|  PREDICTED: early light-induced protein, chlo...  95.5    2e-31   Nicotiana tomentosiformis
gb|ADM72804.1|  early light-inducible protein                         85.9    6e-29   Capsicum annuum
ref|XP_009778398.1|  PREDICTED: early light-induced protein, chlo...  84.7    3e-28   Nicotiana sylvestris
gb|AAO33591.1|AF479309_1  putative early light induced protein        79.7    2e-25   Arachis hypogaea [goober]
gb|ACV89760.1|  putative early light induced protein 2                82.4    4e-25   Camellia sinensis [black tea]
gb|AFK41568.1|  unknown                                               82.0    2e-24   Lotus japonicus
gb|ABU98940.1|  early light-induced protein 3                         84.7    4e-24   Rhododendron catawbiense [Catawba rosebay]
ref|XP_007034868.1|  Early light-induced protein, putative            82.0    4e-24   
gb|ACB20694.1|  putative cold-inducible protein                       82.4    8e-24   Camellia sinensis [black tea]
gb|AFK38527.1|  unknown                                               80.9    1e-23   Lotus japonicus
gb|ABU98938.1|  early light-induced protein 1                         83.2    3e-23   Rhododendron catawbiense [Catawba rosebay]
ref|XP_006420038.1|  hypothetical protein CICLE_v10006006mg           75.9    4e-23   Citrus clementina [clementine]
gb|ABU98939.1|  early light-induced protein 2                         82.0    5e-23   Rhododendron catawbiense [Catawba rosebay]
ref|XP_002517068.1|  early light-induced protein, putative            74.3    6e-23   Ricinus communis
gb|AFK38098.1|  unknown                                               75.9    1e-22   Lotus japonicus
ref|XP_011027193.1|  PREDICTED: early light-induced protein 1, ch...  71.6    2e-22   Populus euphratica
ref|XP_002312551.2|  hypothetical protein POPTR_0008s15770g           70.9    2e-22   
gb|AFK48277.1|  unknown                                               74.3    4e-22   Lotus japonicus
ref|XP_011027158.1|  PREDICTED: early light-induced protein 1, ch...  70.9    4e-22   Populus euphratica
emb|CDO99111.1|  unnamed protein product                              74.7    5e-22   Coffea canephora [robusta coffee]
ref|XP_006379854.1|  early light-induced protein precursor            70.1    5e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004496671.1|  PREDICTED: early light-induced protein, chlo...  70.5    9e-22   Cicer arietinum [garbanzo]
ref|XP_010043033.1|  PREDICTED: early light-induced protein 1, ch...  66.6    2e-21   Eucalyptus grandis [rose gum]
ref|XP_008224239.1|  PREDICTED: early light-induced protein 1, ch...  70.9    2e-21   Prunus mume [ume]
gb|ABU98942.1|  early light-induced protein 5                         75.9    2e-21   Rhododendron catawbiense [Catawba rosebay]
ref|XP_007143316.1|  hypothetical protein PHAVU_007G062000g           69.3    2e-21   Phaseolus vulgaris [French bean]
ref|XP_002312552.2|  early light-induced protein precursor            67.4    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011027169.1|  PREDICTED: early light-induced protein 1, ch...  70.5    3e-21   Populus euphratica
gb|KEH43786.1|  early light-induced-like protein                      71.2    3e-21   Medicago truncatula
gb|AAQ21120.1|  early light inducible protein                         71.2    3e-21   Trifolium pratense [peavine clover]
ref|XP_010279261.1|  PREDICTED: early light-induced protein 1, ch...  67.0    5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_007225862.1|  hypothetical protein PRUPE_ppa011739mg           71.2    6e-21   Prunus persica
sp|P11432.1|ELI_PEA  RecName: Full=Early light-induced protein, c...  73.6    6e-21   Pisum sativum [garden pea]
ref|XP_010279259.1|  PREDICTED: early light-induced protein 1, ch...  66.6    8e-21   
gb|AAK63815.1|AF383622_1  early light inducible protein               67.8    8e-21   Medicago sativa [alfalfa]
ref|XP_002312550.2|  hypothetical protein POPTR_0008s15760g           69.3    2e-20   
ref|XP_010107710.1|  hypothetical protein L484_013325                 64.7    2e-20   Morus notabilis
gb|ABQ01425.1|  early light inducible protein                         66.6    2e-20   Medicago falcata [sickle alfalfa]
ref|XP_007225864.1|  hypothetical protein PRUPE_ppa011747mg           67.0    2e-20   Prunus persica
ref|XP_010107713.1|  hypothetical protein L484_013328                 64.3    2e-20   Morus notabilis
ref|XP_004134120.1|  PREDICTED: early light-induced protein, chlo...  67.8    3e-20   Cucumis sativus [cucumbers]
ref|XP_010326693.1|  PREDICTED: early light-induced protein 1, ch...  71.2    3e-20   
ref|XP_011027181.1|  PREDICTED: early light-induced protein 2, ch...  64.3    3e-20   Populus euphratica
ref|XP_010043034.1|  PREDICTED: early light-induced protein 1, ch...  63.5    3e-20   Eucalyptus grandis [rose gum]
gb|KEH43785.1|  early light-induced-like protein                      67.8    4e-20   Medicago truncatula
gb|ABU98941.1|  early light-induced protein 4                         71.6    4e-20   Rhododendron catawbiense [Catawba rosebay]
gb|AFK35794.1|  unknown                                               67.4    4e-20   Medicago truncatula
ref|XP_011090668.1|  PREDICTED: early light-induced protein 2, ch...  67.4    4e-20   Sesamum indicum [beniseed]
gb|AFK46043.1|  unknown                                               67.8    4e-20   Medicago truncatula
ref|NP_001267842.1|  uncharacterized protein LOC100263179             64.7    6e-20   Vitis vinifera
gb|KEH43766.1|  early light-induced-like protein                      66.6    6e-20   Medicago truncatula
gb|ACU13898.1|  unknown                                               66.2    1e-19   Glycine max [soybeans]
ref|XP_010043032.1|  PREDICTED: early light-induced protein 1, ch...  63.5    1e-19   Eucalyptus grandis [rose gum]
ref|XP_006420039.1|  hypothetical protein CICLE_v10005974mg           62.4    1e-19   Citrus clementina [clementine]
gb|AFD62760.1|  ELIP                                                  62.0    1e-19   Citrus sinensis [apfelsine]
ref|XP_008392721.1|  PREDICTED: early light-induced protein 1, ch...  70.5    2e-19   
gb|ABU98944.1|  early light-induced protein 7                         67.0    2e-19   Rhododendron catawbiense [Catawba rosebay]
gb|ABU98943.1|  early light-induced protein 6                         69.3    2e-19   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004289994.1|  PREDICTED: early light-induced protein 1, ch...  73.2    3e-19   Fragaria vesca subsp. vesca
gb|EYU41436.1|  hypothetical protein MIMGU_mgv1a014191mg              63.2    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_010045777.1|  PREDICTED: early light-induced protein 1, ch...  63.5    4e-19   Eucalyptus grandis [rose gum]
ref|XP_011090667.1|  PREDICTED: early light-induced protein 1, ch...  67.4    5e-19   Sesamum indicum [beniseed]
gb|KCW84128.1|  hypothetical protein EUGRSUZ_B01004                   61.6    7e-19   Eucalyptus grandis [rose gum]
emb|CDY10676.1|  BnaA05g16860D                                        64.3    1e-18   Brassica napus [oilseed rape]
ref|XP_010034436.1|  PREDICTED: early light-induced protein 1, ch...  63.2    1e-18   Eucalyptus grandis [rose gum]
ref|XP_009145258.1|  PREDICTED: early light-induced protein 1, ch...  64.3    1e-18   Brassica rapa
ref|XP_004296581.1|  PREDICTED: early light-induced protein 1, ch...  63.2    1e-18   Fragaria vesca subsp. vesca
ref|NP_001235754.1|  early light-induced protein                      63.9    2e-18   
ref|XP_004289995.1|  PREDICTED: early light-induced protein 1, ch...  70.5    2e-18   Fragaria vesca subsp. vesca
ref|XP_010488320.1|  PREDICTED: early light-induced protein 1, ch...  59.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008364578.1|  PREDICTED: early light-induced protein 1, ch...  67.0    4e-18   Malus domestica [apple tree]
gb|KHG26201.1|  Early light-induced, chloroplastic                    65.5    5e-18   Gossypium arboreum [tree cotton]
ref|XP_006298609.1|  hypothetical protein CARUB_v10014694mg           60.8    6e-18   Capsella rubella
ref|XP_010045776.1|  PREDICTED: early light-induced protein 1, ch...  61.6    7e-18   
gb|KJB38210.1|  hypothetical protein B456_006G242600                  62.4    8e-18   Gossypium raimondii
gb|KCW84134.1|  hypothetical protein EUGRSUZ_B01008                   61.6    9e-18   Eucalyptus grandis [rose gum]
ref|XP_002870293.1|  hypothetical protein ARALYDRAFT_330043           63.2    1e-17   
ref|XP_010440414.1|  PREDICTED: early light-induced protein 2, ch...  60.8    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010435090.1|  PREDICTED: early light-induced protein 2, ch...  60.8    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_003637637.1|  Early light inducible protein                    58.5    2e-17   
gb|KEH43789.1|  early light-induced-like protein                      60.8    2e-17   Medicago truncatula
gb|KFK23555.1|  hypothetical protein AALP_AAs41881U000100             62.4    2e-17   Arabis alpina [alpine rockcress]
ref|XP_006414662.1|  hypothetical protein EUTSA_v10026335mg           58.2    3e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010034484.1|  PREDICTED: early light-induced protein 1, ch...  58.9    3e-17   Eucalyptus grandis [rose gum]
gb|AAM67121.1|  light-induced protein-like protein                    60.8    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292245.1|  PREDICTED: early light-induced protein 1, ch...  65.9    3e-17   Fragaria vesca subsp. vesca
gb|KCW84135.1|  hypothetical protein EUGRSUZ_B01008                   59.7    4e-17   Eucalyptus grandis [rose gum]
ref|XP_006588384.1|  PREDICTED: uncharacterized protein LOC100306...  58.9    4e-17   
ref|NP_001237842.1|  uncharacterized protein LOC100306375             58.5    4e-17   
ref|XP_010440411.1|  PREDICTED: early light-induced protein 2, ch...  60.1    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010034506.1|  PREDICTED: early light-induced protein 1, ch...  59.7    5e-17   Eucalyptus grandis [rose gum]
emb|CAB10248.1|  light induced protein like                           63.2    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043035.1|  PREDICTED: early light-induced protein 1, ch...  59.7    5e-17   Eucalyptus grandis [rose gum]
ref|XP_010043036.1|  PREDICTED: early light-induced protein 1, ch...  61.6    6e-17   
gb|AAD28779.1|AF134132_1  early light-inducable protein               62.8    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511764.1|  PREDICTED: early light-induced protein 1, ch...  59.7    7e-17   Camelina sativa [gold-of-pleasure]
ref|XP_008341015.1|  PREDICTED: early light-induced protein 1, ch...  57.4    7e-17   
ref|NP_567438.1|  early light-inducible protein 2                     62.8    7e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466577.1|  PREDICTED: early light-induced protein 1, ch...  59.7    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010450014.1|  PREDICTED: early light-induced protein 2, ch...  59.7    8e-17   Camelina sativa [gold-of-pleasure]
emb|CBI26312.3|  unnamed protein product                              59.7    8e-17   Vitis vinifera
gb|KHN02753.1|  Early light-induced protein, chloroplastic            58.9    8e-17   Glycine soja [wild soybean]
ref|XP_009108614.1|  PREDICTED: early light-induced protein 1, ch...  60.8    8e-17   Brassica rapa
ref|XP_010676775.1|  PREDICTED: early light-induced protein 1, ch...  65.5    9e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010450010.1|  PREDICTED: early light-induced protein 2, ch...  60.8    9e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010450011.1|  PREDICTED: early light-induced protein 2, ch...  61.2    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010435089.1|  PREDICTED: early light-induced protein 2, ch...  60.8    1e-16   Camelina sativa [gold-of-pleasure]
gb|KCW84133.1|  hypothetical protein EUGRSUZ_B010071                  62.4    1e-16   Eucalyptus grandis [rose gum]
emb|CDY29755.1|  BnaA01g19110D                                        62.4    1e-16   Brassica napus [oilseed rape]
emb|CDY10312.1|  BnaC05g29670D                                        62.0    1e-16   Brassica napus [oilseed rape]
ref|XP_006414664.1|  hypothetical protein EUTSA_v10026318mg           58.5    1e-16   Eutrema salsugineum [saltwater cress]
gb|KEH43787.1|  early light-induced-like protein                      58.2    1e-16   Medicago truncatula
ref|XP_002885526.1|  early light-inducable protein                    63.2    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010440412.1|  PREDICTED: early light-induced protein 2, ch...  59.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010034491.1|  PREDICTED: early light-induced protein 1, ch...  57.4    2e-16   Eucalyptus grandis [rose gum]
gb|KCW85053.1|  hypothetical protein EUGRSUZ_B01896                   60.1    2e-16   Eucalyptus grandis [rose gum]
emb|CDY46608.1|  BnaCnng14300D                                        60.8    2e-16   Brassica napus [oilseed rape]
ref|XP_007225903.1|  hypothetical protein PRUPE_ppa011907mg           57.4    2e-16   Prunus persica
ref|XP_010435088.1|  PREDICTED: early light-induced protein 2, ch...  59.7    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010440410.1|  PREDICTED: early light-induced protein 2, ch...  61.2    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010279260.1|  PREDICTED: early light-induced protein 1, ch...  60.8    3e-16   
gb|KFK39567.1|  hypothetical protein AALP_AA3G261100                  63.5    3e-16   Arabis alpina [alpine rockcress]
ref|XP_010450013.1|  PREDICTED: early light-induced protein 2, ch...  60.1    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008224237.1|  PREDICTED: early light-induced protein 1, ch...  57.8    4e-16   Prunus mume [ume]
ref|XP_009148406.1|  PREDICTED: early light-induced protein 2, ch...  60.5    4e-16   Brassica rapa
ref|XP_008438620.1|  PREDICTED: early light-induced protein 1, ch...  57.8    5e-16   Cucumis melo [Oriental melon]
ref|XP_009375990.1|  PREDICTED: early light-induced protein 1, ch...  55.8    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_006285275.1|  hypothetical protein CARUB_v10006649mg           59.7    5e-16   Capsella rubella
ref|XP_006406123.1|  hypothetical protein EUTSA_v10021557mg           61.2    5e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010435087.1|  PREDICTED: early light-induced protein 2, ch...  59.7    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006285225.1|  hypothetical protein CARUB_v10006584mg           58.9    5e-16   Capsella rubella
ref|XP_009341096.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-16   Pyrus x bretschneideri [bai li]
gb|KHN15724.1|  Early light-induced protein, chloroplastic            57.4    8e-16   Glycine soja [wild soybean]
ref|XP_009371939.1|  PREDICTED: early light-induced protein 1, ch...  55.5    8e-16   Pyrus x bretschneideri [bai li]
gb|KFK23556.1|  hypothetical protein AALP_AAs41881U000200             60.8    8e-16   Arabis alpina [alpine rockcress]
gb|AAL32038.1|AF439279_1  early light-induced protein-like protein    61.6    9e-16   Retama raetam [retem]
gb|ACJ09655.1|  putative cold-inducible protein                       64.3    9e-16   Cupressus sempervirens
ref|XP_007224626.1|  hypothetical protein PRUPE_ppa026587mg           55.8    1e-15   Prunus persica
gb|KCW84137.1|  hypothetical protein EUGRSUZ_B01008                   55.5    1e-15   Eucalyptus grandis [rose gum]
gb|EPS65382.1|  early light inducible protein                         59.7    1e-15   Genlisea aurea
ref|XP_011028244.1|  PREDICTED: early light-induced protein 1, ch...  60.5    1e-15   Populus euphratica
ref|XP_010676773.1|  PREDICTED: early light-induced protein 2, ch...  54.7    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW84143.1|  hypothetical protein EUGRSUZ_B01008                   58.2    3e-15   Eucalyptus grandis [rose gum]
ref|XP_008224236.1|  PREDICTED: early light-induced protein 1, ch...  56.6    3e-15   Prunus mume [ume]
ref|XP_010525221.1|  PREDICTED: early light-induced protein 1, ch...  54.7    3e-15   Tarenaya hassleriana [spider flower]
emb|CDY67220.1|  BnaCnng53960D                                        58.9    3e-15   Brassica napus [oilseed rape]
ref|XP_011463234.1|  PREDICTED: early light-induced protein 1, ch...  61.2    4e-15   Fragaria vesca subsp. vesca
emb|CDY42783.1|  BnaC01g22830D                                        61.6    5e-15   Brassica napus [oilseed rape]
ref|XP_009135830.1|  PREDICTED: early light-induced protein 1, ch...  59.3    5e-15   Brassica rapa
emb|CDX92959.1|  BnaA03g36810D                                        59.3    6e-15   
ref|XP_009337531.1|  PREDICTED: early light-induced protein 1, ch...  62.4    9e-15   Pyrus x bretschneideri [bai li]
ref|NP_188923.1|  chlorophyll A-B binding, early light-inducible ...  59.3    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224234.1|  PREDICTED: early light-induced protein 1, ch...  55.5    1e-14   
gb|ADV19257.1|  putative cold-inducible protein-like protein          57.0    2e-14   Helleborus orientalis [lenten-rose]
gb|KDP40234.1|  hypothetical protein JCGZ_02232                       53.5    2e-14   Jatropha curcas
ref|XP_006286322.1|  hypothetical protein CARUB_v100071911mg          58.5    3e-14   
ref|XP_006838940.1|  hypothetical protein AMTR_s00002p00270470        53.9    3e-14   Amborella trichopoda
gb|KCW84141.1|  hypothetical protein EUGRSUZ_B01008                   54.3    3e-14   Eucalyptus grandis [rose gum]
ref|XP_009341107.1|  PREDICTED: early light-induced protein 1, ch...  57.0    4e-14   
ref|XP_007226151.1|  hypothetical protein PRUPE_ppa014920mg           52.8    5e-14   Prunus persica
ref|XP_009341102.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_009343965.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_009343966.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_009341101.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_008360362.1|  PREDICTED: early light-induced protein 1, ch...  56.6    6e-14   
ref|XP_009341094.1|  PREDICTED: early light-induced protein 1, ch...  56.6    7e-14   Pyrus x bretschneideri [bai li]
ref|XP_008360363.1|  PREDICTED: early light-induced protein 1, ch...  56.6    7e-14   
gb|ABK22971.1|  unknown                                               55.8    7e-14   Picea sitchensis
ref|XP_009341095.1|  PREDICTED: early light-induced protein 1, ch...  56.6    7e-14   Pyrus x bretschneideri [bai li]
gb|AFP90212.1|  early light-induced protein                           55.8    8e-14   Pinus armandii [Armand pine]
ref|XP_010676774.1|  PREDICTED: early light-induced protein 2, ch...  52.8    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009343974.1|  PREDICTED: early light-induced protein 1, ch...  55.8    1e-13   
sp|Q01931.1|DS22_CRAPL  RecName: Full=Desiccation stress protein ...  52.8    1e-13   Craterostigma plantagineum
ref|XP_008391008.1|  PREDICTED: early light-induced protein 1, ch...  55.5    2e-13   
gb|ABR16462.1|  unknown                                               54.7    2e-13   Picea sitchensis
gb|ABR16737.1|  unknown                                               54.3    3e-13   Picea sitchensis
gb|ABK24316.1|  unknown                                               53.5    3e-13   Picea sitchensis
ref|XP_008224238.1|  PREDICTED: early light-induced protein 1, ch...  53.5    4e-13   Prunus mume [ume]
ref|XP_010923519.1|  PREDICTED: early light-induced protein 1, ch...  53.5    4e-13   Elaeis guineensis
ref|XP_010935694.1|  PREDICTED: early light-induced protein 1, ch...  55.5    4e-13   Elaeis guineensis
gb|AEW08119.1|  hypothetical protein 2_114_01                         55.1    5e-13   Pinus radiata
ref|XP_009413904.1|  PREDICTED: early light-induced protein 1, ch...  53.9    5e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009343962.1|  PREDICTED: early light-induced protein 1, ch...  57.0    5e-13   Pyrus x bretschneideri [bai li]
ref|XP_009586916.1|  PREDICTED: early light-induced protein 2, ch...  55.1    5e-13   Nicotiana tomentosiformis
gb|AFG63029.1|  hypothetical protein 2_114_01                         54.7    6e-13   Pinus taeda
gb|ACN39996.1|  unknown                                               52.4    6e-13   Picea sitchensis
ref|XP_010935701.1|  PREDICTED: early light-induced protein 1, ch...  55.1    7e-13   Elaeis guineensis
emb|CAA63338.1|  unnamed protein product                              51.6    1e-12   Helianthus annuus
ref|XP_009341105.1|  PREDICTED: early light-induced protein 1, ch...  54.3    1e-12   Pyrus x bretschneideri [bai li]
gb|ABK24238.1|  unknown                                               50.4    2e-12   Picea sitchensis
ref|XP_002976832.1|  LHC-related protein                              51.2    3e-12   Selaginella moellendorffii
gb|AGH13359.1|  early light-inducible protein                         51.2    4e-12   Helianthus annuus
gb|AGH13354.1|  early light-inducible protein                         50.8    4e-12   Helianthus annuus
ref|XP_002980561.1|  LHC-related protein                              51.2    5e-12   Selaginella moellendorffii
gb|ACN40010.1|  unknown                                               48.9    7e-12   Picea sitchensis
ref|XP_008786056.1|  PREDICTED: early light-induced protein 1, ch...  49.7    2e-11   Phoenix dactylifera
ref|XP_003557497.1|  PREDICTED: low molecular mass early light-in...  54.3    2e-11   Brachypodium distachyon [annual false brome]
gb|AGH13356.1|  early light-inducible protein                         48.5    6e-11   Helianthus annuus
ref|XP_008777102.1|  PREDICTED: early light-induced protein 1, ch...  47.0    9e-11   
gb|AAP80747.1|  early light-induced protein                           50.1    1e-10   Kandelia candel
ref|XP_010228291.1|  PREDICTED: high molecular mass early light-i...  51.6    1e-10   Brachypodium distachyon [annual false brome]
gb|KCW84132.1|  hypothetical protein EUGRSUZ_B010072                  66.2    1e-10   Eucalyptus grandis [rose gum]
ref|XP_003557495.1|  PREDICTED: high molecular mass early light-i...  51.2    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_010045778.1|  PREDICTED: early light-induced protein 1, ch...  65.9    2e-10   Eucalyptus grandis [rose gum]
gb|AFP90187.1|  early light-induced protein                           49.3    2e-10   Pinus densata
dbj|BAJ86766.1|  predicted protein                                    56.2    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97969.1|  predicted protein                                    56.2    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT18433.1|  High molecular mass early light-inducible protein...  54.7    7e-10   
ref|XP_003557498.1|  PREDICTED: low molecular mass early light-in...  56.2    8e-10   Brachypodium distachyon [annual false brome]
ref|XP_002461536.1|  hypothetical protein SORBIDRAFT_02g004380        52.0    1e-09   Sorghum bicolor [broomcorn]
gb|ABR15761.1|  early light-inducible protein                         47.4    1e-09   Spirogyra varians
dbj|BAJ86949.1|  predicted protein                                    52.0    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACI87755.1|  putative early light-induced protein                  45.4    3e-09   Cupressus sempervirens
gb|ACI87803.1|  putative early light-induced protein                  49.7    3e-09   Cupressus sempervirens
gb|EMS57269.1|  hypothetical protein TRIUR3_20794                     52.8    4e-09   Triticum urartu
ref|NP_001152703.1|  early light-induced protein                      51.6    5e-09   
ref|NP_001152683.1|  early light-induced protein                      51.6    5e-09   
ref|NP_001152927.1|  early light-induced protein                      51.6    5e-09   
dbj|BAJ90110.1|  predicted protein                                    51.6    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG24515.1|  early light-induced protein                           51.6    6e-09   Zea mays [maize]
dbj|BAJ89047.1|  predicted protein                                    51.2    6e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24337.1|  High molecular mass early light-inducible protein...  51.2    7e-09   
ref|XP_004955632.1|  PREDICTED: low molecular mass early light-in...  51.2    7e-09   Setaria italica
dbj|BAJ90265.1|  predicted protein                                    52.0    7e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152179.1|  early light-induced protein                      51.2    7e-09   
tpg|DAA42559.1|  TPA: early light-induced protein                     51.2    8e-09   
gb|EMS65479.1|  hypothetical protein TRIUR3_00475                     51.2    9e-09   Triticum urartu
ref|XP_004955631.1|  PREDICTED: high molecular mass early light-i...  51.2    1e-08   Setaria italica
ref|XP_006379855.1|  hypothetical protein POPTR_0008s15800g           60.1    1e-08   
sp|P14895.1|ELI5_HORVU  RecName: Full=High molecular mass early l...  52.0    1e-08   Hordeum vulgare [barley]
gb|EMS45625.1|  hypothetical protein TRIUR3_10356                     50.8    2e-08   Triticum urartu
gb|EMS45333.1|  hypothetical protein TRIUR3_35028                     50.8    2e-08   Triticum urartu
ref|NP_001059030.1|  Os07g0178800                                     52.8    3e-08   
ref|XP_004955634.1|  PREDICTED: low molecular mass early light-in...  51.6    4e-08   Setaria italica
dbj|BAD30330.1|  putative low molecular mass early light-induced ...  52.4    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23518.1|  hypothetical protein F775_14184                       51.2    4e-08   
gb|EMS68027.1|  hypothetical protein TRIUR3_23641                     51.2    4e-08   Triticum urartu
dbj|BAJ84888.1|  predicted protein                                    50.8    5e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS65481.1|  hypothetical protein TRIUR3_00477                     50.8    5e-08   Triticum urartu
sp|P14896.1|ELI6_HORVU  RecName: Full=Low molecular mass early li...  50.8    5e-08   Hordeum vulgare [barley]
dbj|BAJ86624.1|  predicted protein                                    50.4    6e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS51739.1|  hypothetical protein TRIUR3_09306                     51.2    6e-08   Triticum urartu
dbj|BAJ88670.1|  predicted protein                                    50.8    7e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98694.1|  predicted protein                                    50.8    8e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT08136.1|  Low molecular mass early light-inducible protein ...  50.8    9e-08   
dbj|BAJ91644.1|  predicted protein                                    50.4    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90447.1|  predicted protein                                    50.4    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDJ26491.1|  unnamed protein product                              49.7    1e-07   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90175.1|  early light-induced protein                           44.7    1e-07   Pinus yunnanensis [Yunnan pine]
gb|AFP90174.1|  early light-induced protein                           44.7    1e-07   Pinus yunnanensis [Yunnan pine]
sp|P14897.1|ELI9_HORVU  RecName: Full=Low molecular mass early li...  50.1    1e-07   Hordeum vulgare [barley]
gb|EMT03102.1|  Low molecular mass early light-inducible protein ...  48.9    2e-07   
dbj|BAA76309.1|  early light-inducible protein                        50.8    3e-07   Triticum aestivum [Canadian hard winter wheat]
gb|AFP90157.1|  early light-induced protein                           42.7    5e-07   Pinus densata
gb|KHG26202.1|  Early light-induced, chloroplastic                    42.4    5e-07   Gossypium arboreum [tree cotton]
ref|WP_039311765.1|  hypothetical protein                             55.1    8e-07   Paenibacillus sp. IHB B 3415
ref|XP_009615000.1|  PREDICTED: early light-induced protein 2, ch...  56.6    8e-07   Nicotiana tomentosiformis
ref|NP_001059029.1|  Os07g0178700                                     52.4    9e-07   
ref|XP_009622523.1|  PREDICTED: early light-induced protein 2, ch...  56.6    9e-07   Nicotiana tomentosiformis
ref|XP_003557500.1|  PREDICTED: low molecular mass early light-in...  55.8    1e-06   Brachypodium distachyon [annual false brome]
gb|EAY73277.1|  hypothetical protein OsI_01151                        52.8    1e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_003557499.1|  PREDICTED: low molecular mass early light-in...  55.8    1e-06   Brachypodium distachyon [annual false brome]
gb|KJB38211.1|  hypothetical protein B456_006G242700                  41.6    1e-06   Gossypium raimondii
gb|AFP90210.1|  early light-induced protein                           45.1    2e-06   Pinus densata
gb|EAZ02969.1|  hypothetical protein OsI_25109                        52.0    3e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006493973.1|  PREDICTED: uncharacterized protein LOC102620537  55.8    4e-06   
ref|XP_007227407.1|  hypothetical protein PRUPE_ppb019918mg           52.4    4e-06   
ref|NP_001042574.1|  Os01g0246400                                     52.8    4e-06   
gb|AFP90201.1|  early light-induced protein                           43.1    2e-05   Pinus yunnanensis [Yunnan pine]
gb|AFP90166.1|  early light-induced protein                           43.1    2e-05   Pinus densata
gb|AFP90167.1|  early light-induced protein                           43.1    2e-05   Pinus yunnanensis [Yunnan pine]
gb|AFP90160.1|  early light-induced protein                           43.1    2e-05   Pinus tabuliformis [southern Chinese pine]
gb|AFP90162.1|  early light-induced protein                           43.1    2e-05   Pinus tabuliformis [southern Chinese pine]
gb|AFP90205.1|  early light-induced protein                           43.1    2e-05   Pinus tabuliformis [southern Chinese pine]
gb|AFP90168.1|  early light-induced protein                           43.1    2e-05   Pinus densata
gb|AFP90192.1|  early light-induced protein                           43.1    2e-05   
gb|AFP90179.1|  early light-induced protein                           43.1    2e-05   
gb|AFP90182.1|  early light-induced protein                           43.1    2e-05   
gb|AFP90185.1|  early light-induced protein                           43.1    2e-05   
gb|AAB70536.1|  low molecular early light-inducible protein           52.0    3e-05   
gb|AFP90211.1|  early light-induced protein                           43.1    3e-05   
ref|NP_001105051.1|  early light-inducible protein ELIP               52.0    3e-05   
gb|AFP90197.1|  early light-induced protein                           42.7    3e-05   
gb|ACI87806.1|  putative early light-induced protein                  43.9    3e-05   
gb|ACG24151.1|  early light-induced protein                           52.0    3e-05   
gb|AFP90159.1|  early light-induced protein                           43.1    3e-05   
gb|ACG27686.1|  early light-induced protein                           52.0    3e-05   
gb|AFP90158.1|  early light-induced protein                           42.7    4e-05   
dbj|BAJ87895.1|  predicted protein                                    50.8    4e-05   
gb|AFP90164.1|  early light-induced protein                           43.1    5e-05   
emb|CDJ26488.1|  unnamed protein product                              51.2    6e-05   
gb|AFP90180.1|  early light-induced protein                           43.1    6e-05   
ref|XP_010497961.1|  PREDICTED: early light-induced protein 1, ch...  49.3    6e-05   
ref|XP_004955633.1|  PREDICTED: low molecular mass early light-in...  51.2    8e-05   
gb|AFP90193.1|  early light-induced protein                           40.8    8e-05   
gb|AHZ44785.1|  early light inducible protein                         49.3    1e-04   
ref|NP_001172891.1|  Os02g0265550                                     49.7    1e-04   
gb|AFP90177.1|  early light-induced protein                           40.0    1e-04   
ref|XP_009623411.1|  PREDICTED: desiccation stress protein DSP-22...  48.1    2e-04   
ref|XP_002461537.1|  hypothetical protein SORBIDRAFT_02g004390        49.3    3e-04   
ref|XP_001765645.1|  early light-induced protein 8                    42.7    4e-04   
gb|AFP90204.1|  early light-induced protein                           42.7    4e-04   
ref|XP_007210927.1|  hypothetical protein PRUPE_ppa027213mg           47.8    4e-04   
dbj|BAD27891.1|  putative early light-induced protein, low molecu...  49.3    6e-04   
gb|ABF96631.1|  hypothetical protein LOC_Os03g30400                   47.4    7e-04   
gb|EMS68026.1|  hypothetical protein TRIUR3_23640                     43.5    8e-04   



>ref|XP_009766381.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=195

 Score =   100 bits (250),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 9/119 (8%)
 Frame = +1

Query  142  MASTVVMQSIL--GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            M ++  MQS++   SP TSF  RNG++QFVP  YLPR Q++    V+ MSED   KEQ +
Sbjct  1    MTTSFAMQSMIVGSSPPTSFSKRNGLNQFVPGCYLPRFQKSSRLRVKCMSEDGEKKEQSS  60

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +P+T              P P   AK+STN  DVFSFSG GPERINGRLAMIGF AA+G
Sbjct  61   SPLTN-------TAATSKPTPPPPAKASTNFSDVFSFSGAGPERINGRLAMIGFVAALG  112


 Score = 69.7 bits (169),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELANGGDL AQ+SNGG +WFLG++ALLTLAS+IPLFQG++
Sbjct  112  GVELANGGDLSAQLSNGGFSWFLGTSALLTLASLIPLFQGIS  153



>ref|XP_004247604.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=192

 Score = 95.9 bits (237),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 14/125 (11%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            M ++  MQSI LGSPV   +++NG++QFVPS YLPRL+R     V+ M+E+  G+++ +T
Sbjct  1    MITSFAMQSIILGSPVKLSQSKNGLNQFVPSCYLPRLRRTSRVRVKCMAEE--GEKESST  58

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG--  492
            P T+ S T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+G  
Sbjct  59   PSTDYSATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGME  111

Query  493  --NGA  501
              NGA
Sbjct  112  LANGA  116


 Score = 72.4 bits (176),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            GMELANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT
Sbjct  109  GMELANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVT  150



>ref|XP_006363471.1| PREDICTED: early light-induced protein, chloroplastic-like [Solanum 
tuberosum]
Length=197

 Score = 97.1 bits (240),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            M+++  MQSI LGSPV   ++RNG++QFVPS YLPRL R     V+ M+E+    ++ +T
Sbjct  1    MSTSFAMQSIILGSPVKLSQSRNGLNQFVPSCYLPRLHRRSPLRVKCMAEEGEKLDKAST  60

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG--  492
            P+T+    +    P P+PAP   AK STN  D+FSFSGP PERINGRLAMIGF AA+G  
Sbjct  61   PLTD----SAATVPKPTPAPFAKAKPSTNFSDIFSFSGPAPERINGRLAMIGFVAAIGVE  116

Query  493  --NGA  501
              NGA
Sbjct  117  LANGA  121


 Score = 70.5 bits (171),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT
Sbjct  114  GVELANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVT  155



>ref|XP_004247605.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Solanum lycopersicum]
 gb|AAS92268.1| early light inducible protein [Solanum lycopersicum]
Length=191

 Score = 95.5 bits (236),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 14/123 (11%)
 Frame = +1

Query  148  STVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            ++  MQSI LGSP+   +N+NG++QFVPS YLPRL R     V+ M+E+  G+++ +TP 
Sbjct  2    TSFAMQSIILGSPLKLSQNKNGLNQFVPSCYLPRLHRTSRVSVKCMAEE--GEKESSTPS  59

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG----  492
            T+ S T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+G    
Sbjct  60   TDYSATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELA  112

Query  493  NGA  501
            NGA
Sbjct  113  NGA  115


 Score = 72.0 bits (175),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            GMELANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT
Sbjct  108  GMELANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVT  149



>ref|XP_009616081.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=199

 Score = 95.5 bits (236),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 74/119 (62%), Gaps = 6/119 (5%)
 Frame = +1

Query  142  MASTVVMQS-ILGSPVTS-FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA+ V MQ+ ILGSP+ S    RNGV+QFVPS Y+PRLQRN +  V+ MSED   K Q +
Sbjct  1    MATCVGMQTMILGSPIVSNISKRNGVNQFVPSCYIPRLQRNSTLSVKCMSEDGE-KGQTS  59

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
              + + + T      P  P     +       D+F+FSGP PERINGRLAMIGF AA+G
Sbjct  60   NSLNDITATPTPTPTPTPPPVAKTST---KFGDLFAFSGPAPERINGRLAMIGFVAALG  115


 Score = 67.4 bits (163),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            G E ANGGD+FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+
Sbjct  115  GAEFANGGDIFAQLSSGGFSWFLGTSALLTLASLIPLFQGI  155



>gb|ADM72804.1| early light-inducible protein [Capsicum annuum]
Length=160

 Score = 85.9 bits (211),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 61/109 (56%), Gaps = 34/109 (31%)
 Frame = +1

Query  169  ILGSPVTSF-KNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  345
            ILGSPVTS  ++RNG++QFVPSSYLPRL RN    V+ MSE  +  +             
Sbjct  2    ILGSPVTSLSQSRNGLNQFVPSSYLPRLHRNTRLRVKCMSEPKSSTD-------------  48

Query  346  pkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                                 +D+FSFSGP PERINGRLAMIGF AA+G
Sbjct  49   --------------------FFDLFSFSGPAPERINGRLAMIGFVAAIG  77


 Score = 68.6 bits (166),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELANGGDL AQ+S+GG+ WFLGS+ LLTLAS+IPLFQGVT
Sbjct  77   GVELANGGDLSAQLSSGGLLWFLGSSVLLTLASIIPLFQGVT  118



>ref|XP_009778398.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=200

 Score = 84.7 bits (208),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = +1

Query  142  MASTVVMQS-ILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA    MQS ILGSP+ S   RNGV+QFVP  Y+PR QRN +  V+ MSED   K Q + 
Sbjct  1    MAICGGMQSMILGSPIVS--KRNGVNQFVPCCYIPRPQRNSTLSVKCMSEDGE-KGQTSN  57

Query  319  PVTEssttapkptpppspapkv-aaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             + + +TT      P         AK+ST   D+F+FSGP PERINGRLAMIGF AA+G
Sbjct  58   SLNDIATTPTPTPTPTPIPTPRPVAKTSTKFGDLFAFSGPAPERINGRLAMIGFVAALG  116


 Score = 67.4 bits (163),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            G E ANGGD+FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+
Sbjct  116  GAEFANGGDIFAQLSSGGFSWFLGTSALLTLASLIPLFQGI  156



>gb|AAO33591.1|AF479309_1 putative early light induced protein [Arachis hypogaea]
Length=189

 Score = 79.7 bits (195),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            S+  MQSIL SP+T   +R+ V+QF VP+ Y+P ++RN S  VRSM+E++  KEQ T P 
Sbjct  4    SSYAMQSILASPMTRTPSRSRVNQFGVPALYMPNMRRNASLSVRSMAEEEQ-KEQSTEPT  62

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +  +   PKP P         +       DV +FSGP PERINGRLAMIGF AA+ 
Sbjct  63   SPVTPPPPKPQPRSPKMSTKFS-------DVLAFSGPAPERINGRLAMIGFVAALA  111


 Score = 63.2 bits (152),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+NG DL +QISNGG+ WFLG++ +L+LAS+IPLFQGV+
Sbjct  111  AVELSNGQDLLSQISNGGIPWFLGTSVVLSLASLIPLFQGVS  152



>gb|ACV89760.1| putative early light induced protein 2 [Camellia sinensis]
 gb|ACV89763.1| putative early light induced protein 2 [Camellia sinensis]
Length=175

 Score = 82.4 bits (202),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 60/117 (51%), Gaps = 23/117 (20%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            MA++  MQS+L  PVTS   R    QF P SY+P LQ+N S  VR M++    ++    P
Sbjct  1    MATSATMQSVLARPVTSVTTRARFGQFTPCSYVPYLQKNASMQVRCMAKYGQKEDVTQKP  60

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                                   K ST   DV +FSGP PERINGRLAMIGF AAM 
Sbjct  61   -----------------------KVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMA  94


 Score = 59.7 bits (143),  Expect(2) = 4e-25, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+NG D+  QISNGGV WF+G++ +LTLAS++PLF+GV+
Sbjct  94   AVELSNGEDVLVQISNGGVPWFVGTSIVLTLASLVPLFKGVS  135



>gb|AFK41568.1| unknown [Lotus japonicus]
Length=194

 Score = 82.0 bits (201),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 7/117 (6%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            +ST  MQSIL +P+     R+ V+QF +PS Y+P  +RN S  VRSM+E+   K+QP  P
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSQRRNSSLRVRSMAEEP--KKQPIEP  60

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             T +S   P   PP   APKV+        DV +F GP PERINGRLAMIGFAAAM 
Sbjct  61   ATSASPVTPSAPPPKPRAPKVST----KFSDVMAFGGPAPERINGRLAMIGFAAAMA  113


 Score = 57.8 bits (138),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+
Sbjct  113  AVEVARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVS  154



>gb|ABU98940.1| early light-induced protein 3 [Rhododendron catawbiense]
Length=181

 Score = 84.7 bits (208),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 70/117 (60%), Gaps = 19/117 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+S+ +P SSYLPR  R+   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSSYLPRQGRDSGMLVRCMAKDGK-KEEVES  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            PV                     AK+  + +D+ +FSGPGPERINGRLAM+GF AA+
Sbjct  60   PV-----------------KATVAKARIDFFDLLAFSGPGPERINGRLAMVGFVAAI  99


 Score = 53.9 bits (128),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  101  VELSKGEDVFAQISNGGIPWFLLTTGVLSIASLIPLSSGVS  141



>ref|XP_007034868.1| Early light-induced protein, putative [Theobroma cacao]
 gb|EOY05794.1| Early light-induced protein, putative [Theobroma cacao]
Length=193

 Score = 82.0 bits (201),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 69/118 (58%), Gaps = 7/118 (6%)
 Frame = +1

Query  142  MASTVVMQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++  MQS+L   PVT   NR  V QF P   +PR QRN +  VR ++E++   EQPT 
Sbjct  1    MAASSAMQSLLLAGPVTGLANRGRVIQFFPVKSVPRFQRNANLHVRCLAEEEP-TEQPTK  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            PVT +    PKP P P+              DV +FSGP PERINGRLAM+GF AA+ 
Sbjct  60   PVTSAPPQVPKPNPSPAAPKVST-----KFSDVLAFSGPAPERINGRLAMVGFVAALA  112


 Score = 56.6 bits (135),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             MEL+ G D+F QIS+GG+  FLG++ L++LAS+IPLF+GVT
Sbjct  112  AMELSKGQDVFTQISDGGIPLFLGTSILVSLASLIPLFRGVT  153



>gb|ACB20694.1| putative cold-inducible protein [Camellia sinensis]
 gb|ACV89762.1| putative light-inducible protein [Camellia sinensis]
Length=190

 Score = 82.4 bits (202),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 63/115 (55%), Gaps = 7/115 (6%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVT  327
            +T  MQSIL  PV+    R   SQF P SY+PRLQRN    VR M+EDD  K+       
Sbjct  2    ATPAMQSILARPVSGVTARARFSQFTPCSYVPRLQRNAGMQVRCMAEDDQNKDVTPITTP  61

Query  328  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                    PT  P   P    K ST   DV +FSGP PERINGRLAMIGF AAM 
Sbjct  62   P-------PTSQPISFPPPKPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMA  109


 Score = 55.1 bits (131),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
            +EL+ G D+ AQISNGGV WF G++ +LTLAS+IPLF+G
Sbjct  110  VELSKGEDVLAQISNGGVPWFGGTSIVLTLASLIPLFKG  148



>gb|AFK38527.1| unknown [Lotus japonicus]
Length=193

 Score = 80.9 bits (198),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            MQSI+ SP+     R+ V+QF  P+ Y+P L+RN +  VRSM+E +  KEQP  PVT +S
Sbjct  4    MQSIISSPMIRMTTRSRVNQFTTPAVYMPSLRRNATLRVRSMAEGEP-KEQPIEPVTSAS  62

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
               P P PPP         +  +  DV +F GP PERINGRLAMIGF AAM 
Sbjct  63   PVTPSPPPPPPKPRAPKVSTKFS--DVMAFGGPAPERINGRLAMIGFVAAMA  112


 Score = 56.2 bits (134),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +F QIS+GGV WFLG++ + TLAS++PLFQGV+
Sbjct  112  AVEVARGQGVFEQISDGGVPWFLGASVVFTLASLVPLFQGVS  153



>gb|ABU98938.1| early light-induced protein 1 [Rhododendron catawbiense]
Length=181

 Score = 83.2 bits (204),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 19/117 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+S+ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            P+                     AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+
Sbjct  60   PIE-----------------ANVAKVRTDFFDLLAFSGPGPERINGRLAMVGFVAAI  99


 Score = 52.8 bits (125),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL  G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  101  VELYKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVS  141



>ref|XP_006420038.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 ref|XP_006489464.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR33278.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 gb|KDO74446.1| hypothetical protein CISIN_1g029976mg [Citrus sinensis]
Length=184

 Score = 75.9 bits (185),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 24/122 (20%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFK----NRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKE  306
            MA+++  QS+LGS V + +     ++GV QF    YLP  LQRN S  VR M++++  K+
Sbjct  1    MAASLATQSMLGSSVVAARVTGIRKSGVYQFSSVKYLPGTLQRNVSLSVRCMAKNEQQKD  60

Query  307  QPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
            Q T P                       + ST   DVF+FSGP PERINGRLAMIGF AA
Sbjct  61   QSTQP-------------------PKLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAA  101

Query  487  MG  492
            + 
Sbjct  102  LA  103


 Score = 58.9 bits (141),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQ+S+GGV WFLG++ LL++AS++PLF+GV+
Sbjct  103  AVELSKGQDVFAQLSDGGVAWFLGTSVLLSVASLVPLFKGVS  144



>gb|ABU98939.1| early light-induced protein 2 [Rhododendron catawbiense]
Length=181

 Score = 82.0 bits (201),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (59%), Gaps = 19/117 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+++ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLNRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            P+                     AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+
Sbjct  60   PIE-----------------ANVAKVKTDFFDLLAFSGPGPERINGRLAMVGFVAAI  99


 Score = 52.4 bits (124),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL  G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  101  VELYKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVS  141



>ref|XP_002517068.1| early light-induced protein, putative [Ricinus communis]
 gb|EEF45231.1| early light-induced protein, putative [Ricinus communis]
Length=191

 Score = 74.3 bits (181),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 69/118 (58%), Gaps = 15/118 (13%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKE-QPTTP  321
            +TV+  +IL SPV    NR  V+QF+P+ Y PRL+R  +   VR M+E+   +E +PT P
Sbjct  5    ATVMQAAILASPVLR-PNRARVTQFLPAPYTPRLRRMATATPVRCMAEEKENQEMKPTEP  63

Query  322  VTEssttapkptpppspapkvaaksstNLW-DVFSFSGPGPERINGRLAMIGFAAAMG  492
            V+ +    P P P  S             W D+ +FSGP PERINGRLAMIGF AAM 
Sbjct  64   VSATPKPQPAPKPKVSTK-----------WSDLLAFSGPAPERINGRLAMIGFVAAMA  110


 Score = 60.1 bits (144),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
             +ELA G DLF Q+S+GG+TWF+G++ +L+LAS+IPLF+GV
Sbjct  110  AVELAKGQDLFTQVSSGGITWFVGTSVVLSLASLIPLFKGV  150



>gb|AFK38098.1| unknown [Lotus japonicus]
Length=188

 Score = 75.9 bits (185),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 67/117 (57%), Gaps = 13/117 (11%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            +ST  MQSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  +P
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSASP  60

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT S        P  S              DV +F GP PERINGRLAMIGF AAM 
Sbjct  61   VTPSPPPPKPRAPKVSTKFS----------DVMAFGGPAPERINGRLAMIGFVAAMA  107


 Score = 57.8 bits (138),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+
Sbjct  107  AVEVARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVS  148



>ref|XP_011027193.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score = 71.6 bits (174),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 67/122 (55%), Gaps = 26/122 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-  312
            MA++ VMQ++L SPV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+   
Sbjct  1    MATSTVMQTVLASPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAG  60

Query  313  --TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
              +TP                       K ST   D+ +FSGP PERINGRLAMIGF AA
Sbjct  61   LSSTP---------------------KPKVSTKFADLLAFSGPAPERINGRLAMIGFVAA  99

Query  487  MG  492
            M 
Sbjct  100  MA  101


 Score = 61.2 bits (147),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++
Sbjct  101  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGIS  142



>ref|XP_002312551.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
 gb|EEE89918.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
Length=182

 Score = 70.9 bits (172),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 65/122 (53%), Gaps = 26/122 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  306
            MA++ VMQ++L +PV S   KNR+ VS    ++Y+PRL+ + S  V+    DD  K   E
Sbjct  1    MATSTVMQTVLATPVPSGLVKNRSRVSNLFSATYVPRLRGSASKRVQCSKLDDQIKKLAE  60

Query  307  QPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
              +TP                       K S    D+F+FSGP PERINGRLAMIGF AA
Sbjct  61   PSSTP---------------------KPKVSPKFLDLFAFSGPAPERINGRLAMIGFVAA  99

Query  487  MG  492
            M 
Sbjct  100  MA  101


 Score = 61.6 bits (148),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+
Sbjct  101  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVS  142



>gb|AFK48277.1| unknown [Lotus japonicus]
Length=188

 Score = 74.3 bits (181),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 13/117 (11%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            +ST  +QSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  +P
Sbjct  3    SSTSAIQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSASP  60

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT S        P  S              DV +F GP PERINGRLAMIGF AAM 
Sbjct  61   VTPSPPPPKPRAPKVSTKFS----------DVMAFGGPAPERINGRLAMIGFVAAMA  107


 Score = 57.8 bits (138),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+
Sbjct  107  AVEVARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVS  148



>ref|XP_011027158.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score = 70.9 bits (172),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 26/122 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-  312
            MA++ VMQ++L +PV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+   
Sbjct  1    MATSTVMQTVLATPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAG  60

Query  313  --TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
              +TP                       K ST   D+ +FSGP PERINGRLAMIGF AA
Sbjct  61   LSSTP---------------------KPKVSTKFADLLAFSGPAPERINGRLAMIGFVAA  99

Query  487  MG  492
            M 
Sbjct  100  MA  101


 Score = 61.2 bits (147),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++
Sbjct  101  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGIS  142



>emb|CDO99111.1| unnamed protein product [Coffea canephora]
Length=191

 Score = 74.7 bits (182),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 68/122 (56%), Gaps = 17/122 (14%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE-----  306
            MA++V MQS LGSPV    +R G++Q V  S    L +  +F VRSM+E++  +      
Sbjct  1    MAASVAMQSFLGSPVAGVSSRRGLNQVVRLSCGLHLPKRANFRVRSMAEENDKETADAAP  60

Query  307  QPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
            QPT P                P P    K ST   DV +FSGPGPERINGRLAMIGF AA
Sbjct  61   QPTQP------------NVAQPNPAPKPKVSTKFEDVLAFSGPGPERINGRLAMIGFVAA  108

Query  487  MG  492
            +G
Sbjct  109  IG  110


 Score = 56.6 bits (135),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+EL  G DLF QI++GG+ WF+G++ LL++AS+IPLF+GV 
Sbjct  110  GVELGRGQDLFTQINDGGLQWFIGTSVLLSIASLIPLFRGVR  151



>ref|XP_006379854.1| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK95874.1| unknown [Populus trichocarpa]
 gb|ERP57651.1| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score = 70.1 bits (170),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 67/119 (56%), Gaps = 20/119 (17%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+ + S  ++  +E D   EQ  
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSASKRLQCKAELD---EQKM  57

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +                 P+P    K ST   DV +FSGP PERINGRLAMIGF AAM 
Sbjct  58   SA---------------EPSPPPKPKVSTKFADVLAFSGPAPERINGRLAMIGFVAAMA  101


 Score = 61.2 bits (147),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+
Sbjct  101  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVS  142



>ref|XP_004496671.1| PREDICTED: early light-induced protein, chloroplastic-like [Cicer 
arietinum]
Length=197

 Score = 70.5 bits (171),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +1

Query  184  VTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkpt  357
            +T   +R+ VSQF  +PS Y+P  +R+ S  VRSM+E++  K+QP  PV   +  +  P 
Sbjct  14   MTGISSRSRVSQFSSIPSVYIPNTRRSASLKVRSMAEEEQ-KQQPKVPVNPVTPVSQPPP  72

Query  358  pppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            PP     + +  S+    D+ +F GP PERINGRLAMIGF AAMG
Sbjct  73   PPQPAYTRPSKMST-KFSDLMAFGGPAPERINGRLAMIGFVAAMG  116


 Score = 60.1 bits (144),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GGV WFLG++ LLTLAS+IP FQGV+
Sbjct  116  GVEIAKGQGLFEQISGGGVPWFLGTSVLLTLASLIPFFQGVS  157



>ref|XP_010043033.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85048.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score = 66.6 bits (161),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E+   +   
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEEIKPEGST  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             TP ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+
Sbjct  61   ETPASDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAI  117


 Score = 63.2 bits (152),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT
Sbjct  118  AVELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVT  159



>ref|XP_008224239.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=198

 Score = 70.9 bits (172),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 76/120 (63%), Gaps = 6/120 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  MQS+L + V     ++    V+  +P+ Y P L R P+  VRSM+E+   +EQP
Sbjct  1    MAASASMQSLLANSVAFGAGKSKSLRVNHLLPAKYAPTLHRYPNMRVRSMAENGQ-EEQP  59

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +T     ++  P P P P+P PK + K STN  DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--APEASKIPPPPPTPTPPPKRSPKISTNFSDVFAFSGPAPERINGRLAMVGFVSALA  117


 Score = 58.9 bits (141),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +ELA G DLFAQIS+GGV+ FLG++ LL++AS+IPLF+GV+
Sbjct  117  AVELAKGQDLFAQISDGGVSLFLGTSILLSVASLIPLFRGVS  158



>gb|ABU98942.1| early light-induced protein 5 [Rhododendron catawbiense]
Length=177

 Score = 75.9 bits (185),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 62/118 (53%), Gaps = 26/118 (22%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSS--YLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA++ VMQSI+ SPVT      G+S+ +P S  YLPR  RN   LVR M++    +E  +
Sbjct  1    MATSSVMQSIMVSPVTGVAKGTGLSRTIPRSCCYLPRQGRNSGMLVRCMAKGGQKEEAGS  60

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             P  +                         L+D+ +F GP PERINGRLAMIGF AA+
Sbjct  61   PPKAKV------------------------LFDLLAFKGPAPERINGRLAMIGFVAAI  94


 Score = 53.5 bits (127),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  96   VELSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVS  136



>ref|XP_007143316.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
 gb|ESW15310.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
Length=192

 Score = 69.3 bits (168),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 70/117 (60%), Gaps = 9/117 (8%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            AS+  MQSIL +P+     R+ V+ F +P+ Y+   +RN S  VRS++E++  + +P  P
Sbjct  3    ASSSAMQSILANPMIGMSTRSRVNHFGLPAVYM---RRNVSLRVRSLAEEEQ-QSEPAAP  58

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT      P   P   PA   + K ST   DV +FSGP PERINGRLAMIGF AAM 
Sbjct  59   VTP----PPSVKPVQQPATTASPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMA  111


 Score = 60.1 bits (144),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +F QISNGGV WFLG++ +LTLAS+IPLFQGV+
Sbjct  111  AVEVAKGQGVFEQISNGGVPWFLGTSVVLTLASLIPLFQGVS  152



>ref|XP_002312552.2| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK94838.1| unknown [Populus trichocarpa]
 gb|EEE89919.2| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score = 67.4 bits (163),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 20/119 (17%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+ +    ++  +E D   EQ  
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSAGKRLQCKAELD---EQNM  57

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +                 P+P    K ST   DV +FSGP PERINGRLAMIGF AAM 
Sbjct  58   SA---------------EPSPPPKPKVSTKFADVLAFSGPAPERINGRLAMIGFVAAMA  101


 Score = 61.6 bits (148),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+
Sbjct  101  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVS  142



>ref|XP_011027169.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score = 70.5 bits (171),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 62/120 (52%), Gaps = 22/120 (18%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSE-DDAGKEQP  312
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+   S  V+  +E DD      
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGGASKRVQCKAELDDQKMSAE  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             +P  +   +                       DV +FSGP PERINGRLAMIGF AAM 
Sbjct  61   PSPAPKPKVST-------------------KFADVLAFSGPAPERINGRLAMIGFVAAMA  101


 Score = 58.5 bits (140),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLF+QISNGG +WF+G++ LL++AS+IPLF+GV+
Sbjct  101  AVELSKGPDLFSQISNGGGSWFVGTSILLSVASLIPLFKGVS  142



>gb|KEH43786.1| early light-induced-like protein [Medicago truncatula]
Length=197

 Score = 71.2 bits (173),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +1

Query  223  VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksst  402
            +PS Y+P  +RN SF VRSM+E+   KEQP  PV +S T    PTPPP  A   A K ST
Sbjct  29   IPSVYMPSFRRNASFKVRSMAEEGQ-KEQPKVPV-DSITPTSAPTPPPQSAYTRAPKMST  86

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
               D+ +F GP PERINGRLAMIGF AAMG
Sbjct  87   KFSDLMAFGGPAPERINGRLAMIGFVAAMG  116


 Score = 57.8 bits (138),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  116  GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  157



>gb|AAQ21120.1| early light inducible protein [Trifolium pratense]
Length=198

 Score = 71.2 bits (173),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P ++RN SF VRSM+E++  KEQP  PV   + T    TPPP P    
Sbjct  23   VNQFSNIPSVYMPNMRRNASFKVRSMAEEEQ-KEQPKVPVDPITPTPTPVTPPPKPTYTR  81

Query  385  aaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            + K ST   D+ +F GP PERINGRLAMIGF AAMG
Sbjct  82   SPKISTKFSDLMAFGGPAPERINGRLAMIGFVAAMG  117


 Score = 57.4 bits (137),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GGV WFLG++ +L+LAS+IP FQGV+
Sbjct  117  GVEIAKGQGLFEQISGGGVPWFLGTSVVLSLASLIPFFQGVS  158



>ref|XP_010279261.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=195

 Score = 67.0 bits (162),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 73/120 (61%), Gaps = 11/120 (9%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  309
            MAS+V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ
Sbjct  1    MASSVSMQSILVNPVAVGRLGHRCRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ  59

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                  +SS  +  P+PP   +P  + K ST   DV +FSGP PERINGRLAMIGF AAM
Sbjct  60   ------KSSPVSAPPSPPQPTSPSASPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAM  113


 Score = 61.2 bits (147),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
             +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV
Sbjct  114  AVELAKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGV  154



>ref|XP_007225862.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
 gb|EMJ27061.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
Length=198

 Score = 71.2 bits (173),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 6/120 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  MQSIL + V     ++G   VS  VP+ Y     R P   VRSM+E+   +EQP
Sbjct  1    MAASASMQSILANSVVYGAGKSGSVRVSHLVPAKYATTSHRYPQLRVRSMAENGQ-EEQP  59

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +T  T  ++  P P P P+P+PK + K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--TPEASRIPPPPPTPTPSPKRSPKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALA  117


 Score = 56.6 bits (135),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQIS+GGV+ FL ++ LL++ASVIPLF+GV+
Sbjct  117  AVELSKGQDVFAQISDGGVSLFLATSILLSVASVIPLFKGVS  158



>sp|P11432.1|ELI_PEA RecName: Full=Early light-induced protein, chloroplastic; Short=ELIP; 
Flags: Precursor [Pisum sativum]
 emb|CAA29399.1| ELI protein [Pisum sativum]
Length=196

 Score = 73.6 bits (179),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +1

Query  163  QSILGSPVTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            QSI+ + +T+  +R+ V+QF  +PS Y+P L+RN S  VRSM+E +  KEQ    V  ++
Sbjct  7    QSIMSNSMTNISSRSRVNQFTNIPSVYIPTLRRNVSLKVRSMAEGEP-KEQSKVAVDPTT  65

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             TA  PTP P+        +  +  D+ +FSGP PERINGRLAMIGF AAMG
Sbjct  66   PTASTPTPQPAYTRPPKMSTKFS--DLMAFSGPAPERINGRLAMIGFVAAMG  115


 Score = 53.9 bits (128),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  L  Q+S GGV WFLG++ LL+LAS+IP FQGV+
Sbjct  115  GVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVS  156



>ref|XP_010279259.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=195

 Score = 66.6 bits (161),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 72/120 (60%), Gaps = 11/120 (9%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  309
            MAS+V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ
Sbjct  1    MASSVSMQSILVNPVAVGRLGHRGRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ  59

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                  +SS  +  P+PP    P  + K ST   DV +FSGP PERINGRLAMIGF AAM
Sbjct  60   ------KSSPVSAPPSPPQHTTPSGSPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAM  113


 Score = 60.8 bits (146),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV
Sbjct  115  VELAKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGV  154



>gb|AAK63815.1|AF383622_1 early light inducible protein [Medicago sativa]
Length=199

 Score = 67.8 bits (164),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP       
Sbjct  23   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPPSAPTPPPQPQPTYT  81

Query  385  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG----NGAG  504
             + K ST   D+ +F GP PERINGRLAMIGF AAMG    NG G
Sbjct  82   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQG  126


 Score = 59.7 bits (143),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+ANG  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  118  GVEIANGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  159



>ref|XP_002312550.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
 gb|EEE89917.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
Length=182

 Score = 69.3 bits (168),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 65/122 (53%), Gaps = 26/122 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  306
            MA++ VMQ++L +PV S   KNR+ VS    ++++PRL+ + S  V+    DD  K   E
Sbjct  1    MATSTVMQTVLATPVPSGLVKNRSRVSNLFSATFVPRLRGSASKRVQCSKLDDQIKKLAE  60

Query  307  QPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
              +TP                       K S    D+F+FSGP PERINGRLAMIGF AA
Sbjct  61   PSSTP---------------------KPKVSPKFLDLFAFSGPAPERINGRLAMIGFVAA  99

Query  487  MG  492
            M 
Sbjct  100  MA  101


 Score = 57.4 bits (137),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DL  QISNGGV+WF+G++ LL++AS+IPLF+GV+
Sbjct  101  AVELSKGQDLSYQISNGGVSWFVGTSILLSVASLIPLFKGVS  142



>ref|XP_010107710.1| hypothetical protein L484_013325 [Morus notabilis]
 gb|EXC16745.1| hypothetical protein L484_013325 [Morus notabilis]
Length=195

 Score = 64.7 bits (156),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 63/121 (52%), Gaps = 11/121 (9%)
 Frame = +1

Query  142  MASTVVMQ-SILGSPVTSFKN--RNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQ  309
            MA   VMQ S++ S      N  +    QF+PS  LPRL+R N    VR M++D   KEQ
Sbjct  1    MAGPAVMQYSVVTSSFVCAANGIKKANKQFLPSLNLPRLRRINTPLRVRCMTQDGEQKEQ  60

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            PT PV  S          P+P             D+ +FSGP PERINGRLAM+GF AAM
Sbjct  61   PT-PVPNSPPQPTPAPSRPTPKVST------KFSDILAFSGPAPERINGRLAMVGFVAAM  113

Query  490  G  492
             
Sbjct  114  A  114


 Score = 61.6 bits (148),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGG++WF+G++ +LTLAS++PLF+GV+
Sbjct  114  AVELSKGQDVFAQISNGGISWFVGTSIVLTLASLVPLFKGVS  155



>gb|ABQ01425.1| early light inducible protein [Medicago falcata]
Length=199

 Score = 66.6 bits (161),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 61/105 (58%), Gaps = 8/105 (8%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP       
Sbjct  23   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKGPVDPITPPSAPTPPPQPQPTYT  81

Query  385  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG----NGAG  504
             + K ST   D+ +F GP PERINGRLAMIGF AAMG    NG G
Sbjct  82   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQG  126


 Score = 59.7 bits (143),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+ANG  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  118  GVEIANGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  159



>ref|XP_007225864.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
 gb|EMJ27063.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
Length=198

 Score = 67.0 bits (162),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 6/120 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  +QS+L + V     ++    V+  +P+ Y P L R P+  VRSM+E+   +EQP
Sbjct  1    MAASASVQSLLANSVAYGAGKSKSLRVNHLLPAKYAPTLHRYPNMRVRSMAENGQ-EEQP  59

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +T     ++  P P P P+P PK + K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--APEASKIPPPPPTPTPPPKRSPKISTKFSDVFAFSGPAPERINGRLAMVGFVSALA  117


 Score = 59.3 bits (142),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +ELA G DLFAQIS+GGV+ FLG++ LL++AS+IPLF+GV+
Sbjct  117  AVELAKGQDLFAQISDGGVSLFLGTSILLSVASLIPLFRGVS  158



>ref|XP_010107713.1| hypothetical protein L484_013328 [Morus notabilis]
 gb|EXC16748.1| hypothetical protein L484_013328 [Morus notabilis]
Length=195

 Score = 64.3 bits (155),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 65/121 (54%), Gaps = 11/121 (9%)
 Frame = +1

Query  142  MASTVVMQ-SILGSPVTSFKN--RNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQ  309
            MA + VMQ S++ S      N  +    Q +PS  LPRL+R N    VR M++D   K+Q
Sbjct  1    MAGSAVMQYSVVTSCFVCAANGIKKANKQLLPSLNLPRLRRINTPLRVRCMTKDREQKKQ  60

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            PT PV  S      P  PP+P             DV +FSGP PERINGRLAM+GF AAM
Sbjct  61   PT-PVRNSPPQPTLPPSPPTPKVSTKFS------DVLAFSGPAPERINGRLAMVGFVAAM  113

Query  490  G  492
             
Sbjct  114  A  114


 Score = 61.6 bits (148),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGG++WF+G++ +LTLAS++PLF+GV+
Sbjct  114  AVELSKGQDVFAQISNGGISWFVGTSLVLTLASLVPLFKGVS  155



>ref|XP_004134120.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162267.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56941.1| hypothetical protein Csa_3G145780 [Cucumis sativus]
Length=192

 Score = 67.8 bits (164),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 65/117 (56%), Gaps = 6/117 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            MA++ VMQSIL +  T    R   ++ +P++  P  +   +F VR M+E+D  +EQ    
Sbjct  1    MAASAVMQSILSTTATRGVYRTTTNRLLPAALRPCSRSTAAFRVRCMAEEDQ-REQAIPS  59

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                S   P+P+P P             L D+ +FSGPGPERINGRLAMIGF AA+ 
Sbjct  60   SIPPSPPKPEPSPSPPSKVTST-----KLTDILAFSGPGPERINGRLAMIGFVAALA  111


 Score = 57.8 bits (138),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E++ G D+F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+
Sbjct  111  AVEVSKGQDVFEQIANGGIPWFVGTSVVLTLASLIPLFKGVS  152



>ref|XP_010326693.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Solanum lycopersicum]
Length=122

 Score = 71.2 bits (173),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            GMELANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT
Sbjct  36   GMELANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVT  77


 Score = 54.3 bits (129),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 4/37 (11%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMG----NGA  501
            N  D+FSFSGP PERINGRLAMIGF AA+G    NGA
Sbjct  7    NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELANGA  43



>ref|XP_011027181.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Populus euphratica]
Length=181

 Score = 64.3 bits (155),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 65/122 (53%), Gaps = 27/122 (22%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  306
            MA++ VMQ++L +P  S   KNR+ VS F  ++Y+P L+ + S  V+  +E D  K   E
Sbjct  1    MATSTVMQTVLATPAASSLVKNRSRVSNFFSATYVP-LRGSASKRVQCKAELDDQKMSAE  59

Query  307  QPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAA  486
              +TP                       K ST   D+ +FSGP PERINGRLAMIGF AA
Sbjct  60   PSSTP---------------------KPKVSTKFADLLAFSGPAPERINGRLAMIGFVAA  98

Query  487  MG  492
            M 
Sbjct  99   MA  100


 Score = 61.2 bits (147),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
             +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV
Sbjct  100  AVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGV  140



>ref|XP_010043034.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X3 [Eucalyptus grandis]
 gb|KCW85049.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=181

 Score = 63.5 bits (153),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 65/119 (55%), Gaps = 23/119 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E++     P
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEENKRDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +                    PK  +K STN  DVF+FSGP PERINGRLAMIGF AA+
Sbjct  61   S--------------------PKSKSKVSTNFRDVFAFSGPAPERINGRLAMIGFVAAI  99


 Score = 62.0 bits (149),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVT
Sbjct  101  VELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVT  141



>gb|KEH43785.1| early light-induced-like protein [Medicago truncatula]
Length=200

 Score = 67.8 bits (164),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 4/97 (4%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP       
Sbjct  24   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYT  82

Query  385  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             + K ST   D+ +F GP PERINGRLAMIGF AAMG
Sbjct  83   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMG  119


 Score = 57.4 bits (137),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  119  GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  160



>gb|ABU98941.1| early light-induced protein 4 [Rhododendron catawbiense]
Length=164

 Score = 71.6 bits (174),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 36/117 (31%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPVT      G+S+ +P + YLPR  RN   LVR M++          
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRTCYLPRQGRNSGMLVRCMAK----------  50

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                                     +  + +D+ +FSGPGPERINGRLAM+GF AA+
Sbjct  51   -------------------------ARIDFFDLLAFSGPGPERINGRLAMVGFVAAI  82


 Score = 53.1 bits (126),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  84   VELSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVS  124



>gb|AFK35794.1| unknown [Medicago truncatula]
Length=191

 Score = 67.4 bits (163),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 4/97 (4%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP       
Sbjct  15   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYT  73

Query  385  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             + K ST   D+ +F GP PERINGRLAMIGF AAMG
Sbjct  74   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMG  110


 Score = 57.4 bits (137),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  110  GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  151



>ref|XP_011090668.1| PREDICTED: early light-induced protein 2, chloroplastic isoform 
X2 [Sesamum indicum]
Length=188

 Score = 67.4 bits (163),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            GME+ANG D+FAQ+ NGG+ WFLG++ LL+LAS+IP+F+GVT
Sbjct  107  GMEIANGQDIFAQVQNGGIPWFLGTSVLLSLASLIPMFRGVT  148


 Score = 57.8 bits (138),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 59/109 (54%), Gaps = 19/109 (17%)
 Frame = +1

Query  175  GSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  345
            GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E+D   ++P     + +T  
Sbjct  15   GSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEEDDQIKEPAVVPPKPTTPP  71

Query  346  pkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                                  DV +FSGPGPERINGRLAMIGF AA+G
Sbjct  72   KPKVST-------------GFSDVLAFSGPGPERINGRLAMIGFVAAIG  107



>gb|AFK46043.1| unknown [Medicago truncatula]
Length=200

 Score = 67.8 bits (164),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 4/97 (4%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP       
Sbjct  24   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYT  82

Query  385  aa-ksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             + K ST   D+ +F GP PERINGRLAMIGF AAMG
Sbjct  83   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMG  119


 Score = 57.4 bits (137),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  119  GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  160



>ref|NP_001267842.1| uncharacterized protein LOC100263179 [Vitis vinifera]
 gb|ADG21226.1| chloroplast ELIP early light-induced protein [Vitis vinifera]
Length=199

 Score = 64.7 bits (156),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 65/119 (55%), Gaps = 3/119 (3%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--T  315
            MA    MQS L + +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  T
Sbjct  1    MAMATTMQSTLATAMTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVT  59

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            T   +  + +    P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG
Sbjct  60   TNPQQPPSLSQSRQPIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMG  118


 Score = 59.7 bits (143),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G E+  G D+FAQISNGG+ WFLG+  +L+LAS+IPLF+GV+
Sbjct  118  GAEIWKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVS  159



>gb|KEH43766.1| early light-induced-like protein [Medicago truncatula]
Length=198

 Score = 66.6 bits (161),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  384
            V+QF  +PS Y+P  +RN S  VRSM+E++  KEQ   P+ +  TT   PTPPP  A   
Sbjct  24   VNQFNNIPSVYMPSFRRNASLKVRSMAEEEQ-KEQSEVPL-DPITTPSAPTPPPQSAYTR  81

Query  385  aaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            A K ST   D+ +F GP PERINGRLAMIGF AAMG
Sbjct  82   APKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMG  117


 Score = 57.4 bits (137),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  117  GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  158



>gb|ACU13898.1| unknown [Glycine max]
Length=192

 Score = 66.2 bits (160),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 9/117 (8%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            AS+  MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P TP
Sbjct  3    ASSYAMQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PATP  58

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT   +  PKP P  +P+ KV+        DV +FSGP PERINGRLAMIGF AAM 
Sbjct  59   VTPPPSVEPKPQPVSAPSSKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMA  111


 Score = 57.4 bits (137),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+
Sbjct  111  AVEVAKGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVS  152



>ref|XP_010043032.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85050.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score = 63.5 bits (153),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT
Sbjct  118  AVELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVT  159


 Score = 60.1 bits (144),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 71/120 (59%), Gaps = 5/120 (4%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAS ++++SI  SP  + +    R+ V    P+ ++PR        VR M+E+   +   
Sbjct  1    MASAILLRSIPASPSAAIEINSRRSVVRGRFPAYHVPRTAPRGGLRVRCMTEEIKPEGST  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             TP ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   ETPASDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAIA  118



>ref|XP_006420039.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 ref|XP_006489465.1| PREDICTED: early light-induced protein 1, chloroplastic [Citrus 
sinensis]
 gb|ESR33279.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 gb|KDO74445.1| hypothetical protein CISIN_1g029497mg [Citrus sinensis]
Length=192

 Score = 62.4 bits (150),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 64/124 (52%), Gaps = 20/124 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKN---RNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ-  309
            MA+++  QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q 
Sbjct  1    MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQK  60

Query  310  ---PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFA  480
               PT P  E                           +VF+FSGP PERINGRLAMIGF 
Sbjct  61   DDQPTIPKAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFV  107

Query  481  AAMG  492
            AA+G
Sbjct  108  AALG  111


 Score = 61.2 bits (147),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E++ G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+
Sbjct  111  GVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVS  152



>gb|AFD62760.1| ELIP, partial [Citrus sinensis]
Length=208

 Score = 62.0 bits (149),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 64/124 (52%), Gaps = 20/124 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKN---RNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ-  309
            MA+++  QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q 
Sbjct  19   MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQK  78

Query  310  ---PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFA  480
               PT P  E                           +VF+FSGP PERINGRLAMIGF 
Sbjct  79   DDQPTIPKAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFV  125

Query  481  AAMG  492
            AA+G
Sbjct  126  AALG  129


 Score = 60.8 bits (146),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E++ G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+
Sbjct  129  GVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVS  170



>ref|XP_008392721.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=188

 Score = 70.5 bits (171),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 72/119 (61%), Gaps = 3/119 (3%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPR-LQRNPSFLVRSMSEDDAGKEQPT  315
            MA+TV MQSI  S V     ++ V+Q  VP++Y P  L+++    V +M++D+  KEQPT
Sbjct  1    MAATVSMQSIFTSSVAYGVGKSRVNQLIVPANYAPSSLRKHAHMRVIAMAKDEQ-KEQPT  59

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            T    S  + P P+ P  P P    K S    DV +FSGP PERINGRLAM+GF AA+ 
Sbjct  60   TVTDASENSEPAPSSPLPPPPPPPPKVSPKFSDVLAFSGPAPERINGRLAMVGFVAALA  118


 Score = 52.4 bits (124),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNG G+  FLG++ LL++AS++PLF+GV+
Sbjct  118  AVELSKGQDVFAQISNGLGIPLFLGTSILLSVASLVPLFKGVS  160



>gb|ABU98944.1| early light-induced protein 7 [Rhododendron catawbiense]
Length=194

 Score = 67.0 bits (162),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 68/118 (58%), Gaps = 7/118 (6%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSS-YLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++ VMQSIL SPV       G ++  P+  ++P  +R+ S +VR  +E+   KEQ   
Sbjct  1    MATSSVMQSILVSPVAGVAKGLGSNRLRPAYRHMPHQRRSSSVVVRCTAENGQ-KEQAVP  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
              T S+ +     PPP  A         + +DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  60   AATPSTPSPLPIPPPPPKAKAST-----DFFDVFAFSGPAPERINGRLAMIGFVAAIA  112


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQI+NGG+ WF+ +T +L++AS+IPLF GVT
Sbjct  112  AVELSKGEDVFAQIANGGIPWFVLTTGVLSVASLIPLFSGVT  153



>gb|ABU98943.1| early light-induced protein 6 [Rhododendron catawbiense]
Length=182

 Score = 69.3 bits (168),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 66/120 (55%), Gaps = 25/120 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNR-NGVSQ-FVP--SSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            MA++ VMQSI+ SP T    +  G+S+  +P  S YLPR  RN   LVR M++    +E 
Sbjct  1    MATSSVMQSIMVSPATGVATKGTGLSRSTIPRSSCYLPRQGRNSGALVRCMAKGGQKEEV  60

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             T+P  +  T                     + +++ +FSGPGPERINGRLAM+GF AA+
Sbjct  61   GTSPKAKVRT---------------------DFFNLLAFSGPGPERINGRLAMVGFVAAI  99


 Score = 53.1 bits (126),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+
Sbjct  101  VELSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVS  141



>ref|XP_004289994.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=192

 Score = 73.2 bits (178),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 66/121 (55%), Gaps = 15/121 (12%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT---SFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  309
            MA+T VMQSILGS V    + KNR   SQ    S +P      S+L VRSM+ED   K+Q
Sbjct  1    MATTTVMQSILGSSVAYGAAGKNR---SQMKLRSTVPASYAVSSYLRVRSMAEDGQ-KKQ  56

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            PTT  T           P           ST   DVF+FSGP PERINGRLAM+GF AA+
Sbjct  57   PTTVTT-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVAAL  109

Query  490  G  492
             
Sbjct  110  A  110


 Score = 48.5 bits (114),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT
Sbjct  110  AVELSKGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVT  152



>gb|EYU41436.1| hypothetical protein MIMGU_mgv1a014191mg [Erythranthe guttata]
Length=198

 Score = 63.2 bits (152),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G ELA+G DLFAQ+S GG  WFLG++ LLT ASVIPLF+GVT
Sbjct  117  GAELASGQDLFAQVSEGGFPWFLGTSILLTFASVIPLFKGVT  158


 Score = 58.2 bits (139),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = +1

Query  175  GSPVTSFKNRNGVSQ-FVPS--SYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  345
            GSPV +   +  +SQ F PS  + LP ++RN  F VRSM+E D  KE    P    +T A
Sbjct  15   GSPVAT--RKAALSQGFGPSNLALLP-MKRNMKFSVRSMAEGDEIKE---VPAAAPATAA  68

Query  346  pkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
                 PP P P    K  T+ +D+F+FSGP PE+INGRLAM+GF AA+G
Sbjct  69   TPKLTPPPPPPPAKPKVGTDFFDIFAFSGPAPEKINGRLAMVGFVAALG  117



>ref|XP_010045777.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84131.1| hypothetical protein EUGRSUZ_B01006 [Eucalyptus grandis]
Length=181

 Score = 63.5 bits (153),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+NG DLFAQIS GG+ WF+G++ LL++AS++PLFQGVT
Sbjct  101  VELSNGQDLFAQISEGGIPWFIGTSILLSVASLVPLFQGVT  141


 Score = 57.8 bits (138),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP  V    +R  + + F P ++ PRL       V+ M+++      P
Sbjct  1    MASTILMHSVPASPRTVIDISSRKYIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +                     K  +K ST   DVF+FSGP PERINGRLAMIG+ AA+
Sbjct  61   S--------------------QKSKSKVSTGFTDVFAFSGPAPERINGRLAMIGYVAAI  99



>ref|XP_011090667.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Sesamum indicum]
Length=189

 Score = 67.4 bits (163),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            GME+ANG D+FAQ+ NGG+ WFLG++ LL+LAS+IP+F+GVT
Sbjct  108  GMEIANGQDIFAQVQNGGIPWFLGTSVLLSLASLIPMFRGVT  149


 Score = 53.9 bits (128),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 61/111 (55%), Gaps = 22/111 (20%)
 Frame = +1

Query  175  GSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSE--DDAGKEQPTTPVTEsst  339
            GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E  DD  KE    P   ++ 
Sbjct  15   GSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEQEDDQIKEPAVVPPKPTTP  71

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
              PK +                  DV +FSGPGPERINGRLAMIGF AA+G
Sbjct  72   PKPKVST--------------GFSDVLAFSGPGPERINGRLAMIGFVAAIG  108



>gb|KCW84128.1| hypothetical protein EUGRSUZ_B01004 [Eucalyptus grandis]
Length=181

 Score = 61.6 bits (148),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVT
Sbjct  100  AVELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVT  141


 Score = 58.9 bits (141),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 25/121 (21%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            MAST++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M+++      
Sbjct  1    MASTILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLN  59

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            P+                     K  +K ST   DVF+FSGP PERINGRLAMIGF AA+
Sbjct  60   PS--------------------QKSKSKVSTGFTDVFAFSGPAPERINGRLAMIGFVAAI  99

Query  490  G  492
             
Sbjct  100  A  100



>emb|CDY10676.1| BnaA05g16860D [Brassica napus]
Length=196

 Score = 64.3 bits (155),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+T
Sbjct  116  VELSKGENVFAQISDGGVSWFLGTTAILTLASLVPLFQGIT  156


 Score = 55.8 bits (133),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAAL  114



>ref|XP_010034436.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=203

 Score = 63.2 bits (152),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT
Sbjct  123  VELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVT  163


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 63/122 (52%), Gaps = 7/122 (6%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSED---DAGK  303
            MAS V+++ I  SP  + +    R+ V    P+ Y+PR        VR M+E+   +   
Sbjct  1    MASAVLLRWIPASPSAAIEINFRRSVVRGHFPAYYVPRTAPRGGLRVRCMTEEIKPEGST  60

Query  304  EQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAA  483
            E P + V  +S T      P          S+ +  DVF+FSGP PERINGRLAMIGF A
Sbjct  61   EIPASDVPSTSPTPTPTPTPIPTPKPKRKVST-SFTDVFAFSGPAPERINGRLAMIGFVA  119

Query  484  AM  489
            A+
Sbjct  120  AI  121



>ref|XP_009145258.1| PREDICTED: early light-induced protein 1, chloroplastic [Brassica 
rapa]
Length=196

 Score = 64.3 bits (155),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+T
Sbjct  116  VELSKGENVFAQISDGGVSWFLGTTAILTLASLVPLFQGIT  156


 Score = 55.5 bits (132),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFNDLLAFSGPAPERINGRLAMVGFVAAL  114



>ref|XP_004296581.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=197

 Score = 63.2 bits (152),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +1

Query  238  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  417
            LP L R P+  VRSM+ED   +E+P+T    S   A  PTP P P P    K ST   DV
Sbjct  32   LPTLHRYPNMRVRSMAEDGLPEEKPSTVSEPSKIPAAAPTPTPFPPPPRTPKVSTKFGDV  91

Query  418  FSFSGPGPERINGRLAMIGFAAAM  489
            F+FSGP PERINGRLAM+GF +A+
Sbjct  92   FAFSGPAPERINGRLAMVGFVSAL  115


 Score = 56.6 bits (135),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL  G D+F+QIS+GGV+ FLG++ LL++ASVIPLFQGV+
Sbjct  117  VELLKGQDVFSQISDGGVSVFLGTSILLSVASVIPLFQGVS  157



>ref|NP_001235754.1| early light-induced protein [Glycine max]
 gb|AAC16403.1| early light-induced protein [Glycine max]
Length=192

 Score = 63.9 bits (154),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 9/117 (8%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            AS+  MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P  P
Sbjct  3    ASSYAMQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PAIP  58

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT   +  PKP P  +P+PKV+        DV +FSGP PERINGRLAMIGF AAM 
Sbjct  59   VTPPPSVEPKPQPVSAPSPKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMA  111


 Score = 55.8 bits (133),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+
Sbjct  111  AVEVAIGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVS  152



>ref|XP_004289995.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=192

 Score = 70.5 bits (171),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 69/122 (57%), Gaps = 19/122 (16%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT---SFKNRN--GVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGK  303
            MA+T VMQSILGS V    + KNR+   +   VP+SY P      S+L VRSM+ED   K
Sbjct  1    MATTTVMQSILGSSVAYGAAGKNRSLMKLQGTVPASY-PV----SSYLRVRSMAEDGQ-K  54

Query  304  EQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAA  483
            +QPTT  T           P           ST   DVF+FSGP PERINGRLAM+GF A
Sbjct  55   KQPTTVTT-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVA  107

Query  484  AM  489
            A+
Sbjct  108  AL  109


 Score = 48.5 bits (114),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT
Sbjct  111  VELSKGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVT  152



>ref|XP_010488320.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=193

 Score = 59.7 bits (143),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  113  VELSKGENVLSQISDGGVSWFLGTTAILTLASLVPLFKGIT  153


 Score = 58.2 bits (139),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  336
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINSNKLFSAGSF-PNLKRNYPVGVRCMAEGEPKKEDSTATPATSAL  66

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+
Sbjct  67   PKSPSPPPPMKPKVSTKFS------DLLAFSGPAPERINGRLAMVGFVAAL  111



>ref|XP_008364578.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=195

 Score = 67.0 bits (162),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 72/118 (61%), Gaps = 6/118 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKEQPTT  318
            M + V MQSI  S V     ++ V+Q + S+  P  L+++    V SM++DD  KEQPTT
Sbjct  1    MYAIVSMQSIFTSSVAYGVGKSRVNQLIVSANYPVSLRKHAHMRVISMAKDDQ-KEQPTT  59

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
              +E+S  AP    PP P+PKV       + DV +FSGP PERINGRLAM+GF AA+ 
Sbjct  60   YASENSEPAPSSPLPPRPSPKVTP----KISDVLAFSGPAPERINGRLAMVGFVAALA  113


 Score = 50.8 bits (120),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNG G+  FLG++ LLT+AS++PL +GV+
Sbjct  113  AVELSKGQDVFAQISNGAGIPLFLGTSILLTVASLVPLLKGVS  155



>gb|KHG26201.1| Early light-induced, chloroplastic [Gossypium arboreum]
Length=193

 Score = 65.5 bits (158),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 58/112 (52%), Gaps = 10/112 (9%)
 Frame = +1

Query  160  MQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            MQS+L  SP+T   ++  + QF     +PR QR  +  VR ++E+   KE   T  T   
Sbjct  10   MQSLLLASPMTGLASKRQMVQFYNVKRMPRFQRKLNLQVRCLAEEGDQKEPMPTARTPEP  69

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
              +P P  P                DVF+FSGP PERINGRLAM+GF AAM 
Sbjct  70   KPSPPPVSPKLST---------KFSDVFAFSGPAPERINGRLAMVGFVAAMA  112


 Score = 52.4 bits (124),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             MEL+ G D+  QISNGG+  F+G++ +L+LAS+IPLF+G T
Sbjct  112  AMELSKGQDVLTQISNGGIPLFVGTSIVLSLASLIPLFRGET  153



>ref|XP_006298609.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
 gb|EOA31507.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
Length=196

 Score = 60.8 bits (146),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  116  VELSKGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGIT  156


 Score = 57.0 bits (136),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  336
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E D  K+  T TP T +S
Sbjct  8    MQSVFAGGLTTTRKINTNKLFSAGSF-PNLKRNFPVGVRCMAEGDPTKQDSTPTPSTSAS  66

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
               PK   PP P     +   +   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  67   QPLPKSPSPPPPMKPKVSTKFS---DLLAFSGPAPERINGRLAMVGFVAAL  114



>ref|XP_010045776.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=166

 Score = 61.6 bits (148),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVT
Sbjct  85   AVELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVT  126


 Score = 56.2 bits (134),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 55/121 (45%), Gaps = 40/121 (33%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            MAST++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M++   G   
Sbjct  1    MASTILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKVSTGFT-  58

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                                              DVF+FSGP PERINGRLAMIGF AA+
Sbjct  59   ----------------------------------DVFAFSGPAPERINGRLAMIGFVAAI  84

Query  490  G  492
             
Sbjct  85   A  85



>gb|KJB38210.1| hypothetical protein B456_006G242600 [Gossypium raimondii]
Length=193

 Score = 62.4 bits (150),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 61/120 (51%), Gaps = 16/120 (13%)
 Frame = +1

Query  145  ASTVVMQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE---QP  312
            +S + MQS+L  SP+T   ++  + QF     +PR QR  +  VR ++E+   KE     
Sbjct  5    SSAMQMQSLLLASPMTGLGSKRQMVQFYNVKPMPRFQRKLNLQVRCLAEEGDQKEPMPAA  64

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            TTP  + S     P                   DVF+FSGP PERINGRLAM+GF AA+ 
Sbjct  65   TTPEPKQSPPRISPKVST------------KFSDVFAFSGPAPERINGRLAMVGFVAALA  112


 Score = 54.7 bits (130),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             MEL+NG D+  QISNGG+  F+G++ +L+LAS+IPLF+G T
Sbjct  112  AMELSNGQDVLTQISNGGIPLFVGTSIVLSLASLIPLFRGET  153



>gb|KCW84134.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score = 61.6 bits (148),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 59/120 (49%), Gaps = 23/120 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  119

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            ++ +    +T                    +  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  120  SSKLKSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAIA  159


 Score = 55.5 bits (132),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  159  AVELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  200



>ref|XP_002870293.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46552.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 63.2 bits (152),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
             +EL+ G ++FAQISNGGV WFLG+TALLTLAS++PLF+G+
Sbjct  113  AVELSKGENVFAQISNGGVGWFLGTTALLTLASMVPLFKGI  153


 Score = 53.5 bits (127),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 61/114 (54%), Gaps = 11/114 (10%)
 Frame = +1

Query  160  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  330
            MQS+  +P   + S +N    +Q +        +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGVLKSSRNIRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTS  60

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +S T P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ 
Sbjct  61   TSATPPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIA  113



>ref|XP_010440414.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score = 60.8 bits (146),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  113  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  152


 Score = 55.8 bits (133),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+L +P     +RN     + ++     +RN    V+ M++ D  KE P+ P+T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVKCMAQGDPIKEDPSVPLTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>ref|XP_010435090.1| PREDICTED: early light-induced protein 2, chloroplastic [Camelina 
sativa]
Length=193

 Score = 60.8 bits (146),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  113  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  152


 Score = 55.5 bits (132),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+L +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>ref|XP_003637637.1| Early light inducible protein [Medicago truncatula]
Length=160

 Score = 58.5 bits (140),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  238  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaa-ksstNLWD  414
            +P  +RN S  VRSM+E+   KEQP  PV   + T+    PP        + K ST   D
Sbjct  1    MPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYTRSPKMSTKFSD  59

Query  415  VFSFSGPGPERINGRLAMIGFAAAMG  492
            + +F GP PERINGRLAMIGF AAMG
Sbjct  60   LMAFGGPAPERINGRLAMIGFVAAMG  85


 Score = 57.8 bits (138),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A G  LF QIS GG+ WFLG++ LL+LAS+IP FQGV+
Sbjct  85   GVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLIPFFQGVS  126



>gb|KEH43789.1| early light-induced-like protein [Medicago truncatula]
Length=186

 Score = 60.8 bits (146),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 54/97 (56%), Gaps = 18/97 (19%)
 Frame = +1

Query  211  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-TTPVTEssttapkptpppspapk  381
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  TP                 +  
Sbjct  24   VNQFNNIPSVYMPSFKRNASLKVRSMAEEGQ-KEQPKVTP--------------QPASTT  68

Query  382  vaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             + K ST   D+ +F G  PERINGRLAMIGF +AMG
Sbjct  69   RSPKISTKFSDLMAFGGAAPERINGRLAMIGFVSAMG  105


 Score = 55.1 bits (131),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA G  LF QIS GG+ WFL ++ LLT+AS++PLF+GV+
Sbjct  105  GVELAKGQGLFDQISGGGIPWFLYTSVLLTVASLVPLFEGVS  146



>gb|KFK23555.1| hypothetical protein AALP_AAs41881U000100 [Arabis alpina]
Length=193

 Score = 62.4 bits (150),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLFQG+
Sbjct  113  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFQGI  152


 Score = 53.1 bits (126),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P    ++RN     + +S     +RN S +V+ M++DD  KE  ++P + S+ 
Sbjct  8    MQSVFIAPSGVLRSRN-----IRNSNQLFFKRNASMVVKCMAQDDLIKENSSSP-SSSAA  61

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+ P  P P    K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  62   QPQIPSSPLPPPPVSKPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>ref|XP_006414662.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
 gb|ESQ56115.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
Length=185

 Score = 58.2 bits (139),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 56/112 (50%), Gaps = 18/112 (16%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  333
            MQS+  +P     +RN    +QF         +RNPS  VR M+++D  KE  + P T +
Sbjct  8    MQSVFAAPSGGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPIKEDSSLPSTSA  60

Query  334  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +      + P                D+ +FSGP PERINGRLAM+GF AA+
Sbjct  61   TQPQEPASKPKVST---------KFRDLLAFSGPAPERINGRLAMVGFVAAL  103


 Score = 57.0 bits (136),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++ AQIS+GG  WFLG+TALLTLAS++PLF+G+
Sbjct  105  VELSKGENVLAQISDGGAGWFLGTTALLTLASMVPLFKGI  144



>ref|XP_010034484.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84139.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84142.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=181

 Score = 58.9 bits (141),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  101  VELSKGQDLFAQISEGGIPWFIGTSILLSVASLVPLLQGVT  141


 Score = 56.2 bits (134),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 57/120 (48%), Gaps = 23/120 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +  +    +T                       DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SPNLKSKVST--------------------GFTDVFAFSGPAPERINGRLAMIGFVAAIA  100



>gb|AAM67121.1| light-induced protein-like protein [Arabidopsis thaliana]
Length=193

 Score = 60.8 bits (146),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  113  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  152


 Score = 54.3 bits (129),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   TQPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>ref|XP_004292245.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=196

 Score = 65.9 bits (159),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 70/122 (57%), Gaps = 15/122 (12%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT----SFKNRNGVSQF-VPSSYLPRLQRNPSFL-VRSMSEDDAGK  303
            MA+T  MQSILGS +       KNR+   QF VP+S   +     S+L VRSM+ED   K
Sbjct  1    MAATSAMQSILGSSIAYGAAGNKNRSVNLQFTVPASSAVQ-----SYLRVRSMTEDGQ-K  54

Query  304  EQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAA  483
            +QPTT VT++S   P    P              L DV +FSGP PERINGRLAM+GF A
Sbjct  55   KQPTT-VTKASKNPPPAAAPSPSPSPPPPSP--KLSDVLAFSGPAPERINGRLAMVGFVA  111

Query  484  AM  489
            A+
Sbjct  112  AL  113


 Score = 49.7 bits (117),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNG GV  F+G++ LL++AS++PL +GV+
Sbjct  115  VELSKGQDVFAQISNGPGVPLFIGTSVLLSVASLVPLLKGVS  156



>gb|KCW84135.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84136.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score = 59.7 bits (143),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 59/120 (49%), Gaps = 23/120 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  119

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  120  SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  159


 Score = 55.5 bits (132),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  160  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  200



>ref|XP_006588384.1| PREDICTED: uncharacterized protein LOC100306375 isoform X1 [Glycine 
max]
Length=191

 Score = 58.9 bits (141),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E+A G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++
Sbjct  111  VEVAKGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGIS  151


 Score = 56.2 bits (134),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 64/115 (56%), Gaps = 8/115 (7%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            AS+  MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+ P 
Sbjct  3    ASSYAMQSILANPMIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQPA  56

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T  +    +P P P   P     +  +  DV +FSGP PERINGRLAMIGF  AM
Sbjct  57   TPVTPPPAEPKPQPVSTPSPKVSTKFS--DVLAFSGPAPERINGRLAMIGFVGAM  109



>ref|NP_001237842.1| uncharacterized protein LOC100306375 [Glycine max]
 gb|ACU14515.1| unknown [Glycine max]
Length=182

 Score = 58.5 bits (140),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E+A G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++
Sbjct  111  VEVAKGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGIS  151


 Score = 56.2 bits (134),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 64/115 (56%), Gaps = 8/115 (7%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            AS+  MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+ P 
Sbjct  3    ASSYAMQSILANPLIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQPA  56

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T  +    +P P P   P     +  +  DV +FSGP PERINGRLAMIGF  AM
Sbjct  57   TPVTPPPAEPKPQPVSTPSPKVSTKFS--DVLAFSGPAPERINGRLAMIGFVGAM  109



>ref|XP_010440411.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score = 60.1 bits (144),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+
Sbjct  112  LELSKGENVFAQISDGGVGWFLGTTALLTVASMVPLFKGI  151


 Score = 54.3 bits (129),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 7/110 (6%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   AQPQMPPSPPPVSKPKVSTKFR--DLLAFSGPAPERINGRLAMVGFVAAI  110



>ref|XP_010034506.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=181

 Score = 59.7 bits (143),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 59/119 (50%), Gaps = 23/119 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+
Sbjct  61   SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAI  99


 Score = 55.1 bits (131),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  101  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  141



>emb|CAB10248.1| light induced protein like [Arabidopsis thaliana]
 emb|CAB78511.1| light induced protein like [Arabidopsis thaliana]
Length=318

 Score = 63.2 bits (152),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
             MEL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  112  AMELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  152


 Score = 51.2 bits (121),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ 
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIA  112



>ref|XP_010043035.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85052.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score = 59.7 bits (143),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+
Sbjct  61   SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAI  99


 Score = 54.7 bits (130),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  101  VELSKGQDLSAQISGGGIPWFVGTSILLSVASLVPLLQGVT  141



>ref|XP_010043036.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85051.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score = 61.6 bits (148),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++ +    +T                    +  DVF+FSGP PERINGRLAMIGF AA+
Sbjct  61   SSKLKSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAI  99


 Score = 52.8 bits (125),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL  QIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  101  VELSKGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVT  141



>gb|AAD28779.1|AF134132_1 early light-inducable protein [Arabidopsis thaliana]
Length=186

 Score = 62.8 bits (151),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            MEL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  106  MELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  145


 Score = 51.2 bits (121),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  1    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  55

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  56   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  104



>ref|XP_010511764.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Camelina sativa]
Length=192

 Score = 59.7 bits (143),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  112  VELSKGENVLSQISDGGVSWFLGTTAILTLASLVPLFKGIT  152


 Score = 54.3 bits (129),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 57/111 (51%), Gaps = 9/111 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  336
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNKHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAAL  110



>ref|XP_008341015.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=193

 Score = 57.4 bits (137),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+F+QIS+GGV+ FLG++ LL++ASVIPLF+GV+
Sbjct  112  AVELSKGQDVFSQISDGGVSLFLGTSILLSVASVIPLFKGVS  153


 Score = 56.6 bits (135),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 68/116 (59%), Gaps = 5/116 (4%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            MA++  MQS+L   V+S     G S+ V  S+L    +    +VRSM+E+   +EQP++ 
Sbjct  1    MAASASMQSLL---VSSVVYGAGKSRSVRVSHLVPANKYRHMVVRSMAENGQ-EEQPSST  56

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            + E+S   P P  P    P+    S+     VF+FSGP PERINGRLAM+GF +A+
Sbjct  57   IPEASKIPPPPPTPXPFPPRPKKVST-KFSSVFAFSGPAPERINGRLAMVGFVSAL  111



>ref|NP_567438.1| early light-inducible protein 2 [Arabidopsis thaliana]
 sp|Q94K66.1|ELIP2_ARATH RecName: Full=Early light-induced protein 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK44081.1|AF370266_1 unknown protein [Arabidopsis thaliana]
 gb|AAL34257.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83475.1| early light-inducible protein 2 [Arabidopsis thaliana]
Length=193

 Score = 62.8 bits (151),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            MEL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  113  MELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  152


 Score = 51.2 bits (121),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 6/110 (5%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>ref|XP_010466577.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=192

 Score = 59.7 bits (143),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  112  VELSKGENVLSQISDGGVSWFLGTTAILTLASLVPLFKGIT  152


 Score = 53.9 bits (128),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 57/111 (51%), Gaps = 9/111 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  336
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNEHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAAL  110



>ref|XP_010450014.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score = 59.7 bits (143),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG++ALLTLAS++PLF+G+
Sbjct  113  VELSKGENVFAQISDGGVGWFLGTSALLTLASMVPLFKGI  152


 Score = 54.3 bits (129),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 10/112 (9%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  333
            MQS+  +P     +RN    +Q +        +RN    VR M++ D  KE P+ P T +
Sbjct  8    MQSVFAAPSGGLTSRNMRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTST  60

Query  334  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            S   P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  61   SAAQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAI  111



>emb|CBI26312.3| unnamed protein product [Vitis vinifera]
Length=191

 Score = 59.7 bits (143),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G E+  G D+FAQISNGG+ WFLG+  +L+LAS+IPLF+GV+
Sbjct  104  GAEIWKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVS  145


 Score = 54.3 bits (129),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 58/105 (55%), Gaps = 3/105 (3%)
 Frame = +1

Query  184  VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--TTPVTEssttapkpt  357
            +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  TT   +  + +    
Sbjct  1    MTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVTTNPQQPPSLSQSRQ  59

Query  358  pppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG
Sbjct  60   PIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMG  104



>gb|KHN02753.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=191

 Score = 58.9 bits (141),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E+A G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++
Sbjct  111  VEVAKGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGIS  151


 Score = 55.1 bits (131),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 63/115 (55%), Gaps = 8/115 (7%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            AS+  MQSIL +P+    + +  + F   +Y  R  RN    VRSM+E+    EQP+ P 
Sbjct  3    ASSYAMQSILANPMIRISSGSRENHFGVPAYHRR--RNVGLRVRSMAEE----EQPSQPA  56

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T  +    +P P P   P     +  +  DV +FSGP PERINGRLAMIGF  AM
Sbjct  57   TPVTPPPAEPKPQPVSTPSPKVSTKFS--DVLAFSGPAPERINGRLAMIGFVGAM  109



>ref|XP_009108614.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
 gb|AAR11456.1| ELIP [Brassica rapa subsp. pekinensis]
 emb|CDY34227.1| BnaA01g24440D [Brassica napus]
Length=194

 Score = 60.8 bits (146),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  114  VELSKGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGIT  154


 Score = 52.8 bits (125),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            ++V MQS+    + + K N N +  F   ++ P L+RN    VR M+E   G +  +TP 
Sbjct  4    ASVNMQSVFACGLATRKINTNKL--FFAGNF-PNLKRNYPVGVRCMAE---GMKDESTPS  57

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  58   TSAAQPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAAL  112



>ref|XP_010676775.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score = 65.5 bits (158),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 70/119 (59%), Gaps = 17/119 (14%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSED--------DAGKEQP  312
            MQS+L +PV SF N + ++  V P  + PR+    +F V+ M+E+        D+G  + 
Sbjct  5    MQSLLANPVGSFANGSRMTSMVSPLGFYPRMSNRVNFAVKCMAEEGGQGEPKLDSGLPKT  64

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P+          +P P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+
Sbjct  65   TPPMA--------ASPTPTPTPKPQPKVSTSFADLFAFSGPAPERINGRLAMIGFVAAI  115


 Score = 48.1 bits (113),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
            +EL+ G DLF+QIS+GG   FL ++ LL++AS++PLF+G
Sbjct  117  VELSKGTDLFSQISDGGAQSFLATSILLSVASLVPLFKG  155



>ref|XP_010450010.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
 ref|XP_010450012.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score = 60.8 bits (146),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  149


 Score = 52.8 bits (125),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 9/110 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+L +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVLAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAI  108



>ref|XP_010450011.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score = 61.2 bits (147),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTTALLTLASLVPLFKGI  149


 Score = 52.4 bits (124),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+PP +  PK++        D+ +FSGP PERINGRLAMIGF AA+
Sbjct  63   PQMPPSPPQASKPKMST----KFRDLLAFSGPAPERINGRLAMIGFVAAI  108



>ref|XP_010435089.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score = 60.8 bits (146),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  149


 Score = 52.8 bits (125),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 15/113 (13%)
 Frame = +1

Query  160  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  330
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAI  108



>gb|KCW84133.1| hypothetical protein EUGRSUZ_B010071, partial [Eucalyptus grandis]
Length=151

 Score = 62.4 bits (150),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT
Sbjct  71   VELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVT  111


 Score = 50.8 bits (120),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DVF+FSGP PERINGRLAMIGF AA+
Sbjct  44   DVFAFSGPAPERINGRLAMIGFVAAI  69



>emb|CDY29755.1| BnaA01g19110D [Brassica napus]
Length=191

 Score = 62.4 bits (150),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  111  VELSKGENMFAQISDGGVGWFLGTTALLTLASMIPLFKGI  150


 Score = 50.8 bits (120),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +1

Query  253  RNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSG  432
            RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FSG
Sbjct  34   RNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFSG  90

Query  433  PGPERINGRLAMIGFAAAM  489
            P PERINGRLAM+GF AA+
Sbjct  91   PAPERINGRLAMVGFVAAI  109



>emb|CDY10312.1| BnaC05g29670D [Brassica napus]
Length=195

 Score = 62.0 bits (149),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++FAQIS+ GV+WFLG+TA+LTLAS++PLFQG+T
Sbjct  115  VELSKGENVFAQISDDGVSWFLGTTAILTLASLVPLFQGIT  155


 Score = 51.2 bits (121),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +1

Query  238  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  417
             P L+RN    VR M+E +  K++ T   + + +     +PPP P P    K +T   D+
Sbjct  30   FPNLKRNFPVGVRCMAEGEPMKDESTPSTSAAQSLPKSSSPPPPPPPPTTPKVNTKFSDL  89

Query  418  FSFSGPGPERINGRLAMIGFAAAM  489
             +FSGP PERINGRLAM+GF AA+
Sbjct  90   LAFSGPAPERINGRLAMVGFVAAL  113



>ref|XP_006414664.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
 gb|ESQ56117.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
Length=191

 Score = 58.5 bits (140),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++ AQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  111  VELSKGENVLAQISDGGVGWFLGTTALLTLASMVPLFKGI  150


 Score = 54.7 bits (130),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 14/113 (12%)
 Frame = +1

Query  160  MQSILGSPV---TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  330
            +QS+  +P     S +N    +QF         +RNPS  VR M+++D  KE  + P T 
Sbjct  8    LQSVFAAPSGHGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPTKEDSSLPSTS  60

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++      +PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  61   ATQPQTPLSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAL  109



>gb|KEH43787.1| early light-induced-like protein [Medicago truncatula]
Length=182

 Score = 58.2 bits (139),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 14/90 (16%)
 Frame = +1

Query  223  VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksst  402
            +PS Y+P  +RN +  VRSM+E+   ++   TP                 +   + K ST
Sbjct  26   IPSVYMPSFRRNANLKVRSMAEEAQKEQSKVTP--------------QPASTTRSPKIST  71

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
               D+ +F G  PERINGRLAMIGF +AMG
Sbjct  72   KFSDLMAFGGAAPERINGRLAMIGFVSAMG  101


 Score = 55.1 bits (131),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA G  LF QIS GG+ WFL ++ LLT+AS++PLF+GV+
Sbjct  101  GVELAKGQGLFDQISGGGIPWFLYTSVLLTVASLVPLFEGVS  142



>ref|XP_002885526.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61785.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score = 63.2 bits (152),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  103  VELSKGENVFAQISDGGVSWFLGTTAILTLASLVPLFKGIT  143


 Score = 49.7 bits (117),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 54/119 (45%), Gaps = 34/119 (29%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ---------P  312
            MQS+    +T+ +  NG   F   ++ P L+RN    VR M+E +   E          P
Sbjct  8    MQSVFAGGLTT-RKINGNKLFFAGTF-PSLKRNYPVGVRCMAEGEPKNEDSAPTSAAPPP  65

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P                       K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  66   TKP-----------------------KVSTKFSDLLAFSGPAPERINGRLAMVGFVAAL  101



>ref|XP_010440412.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score = 59.7 bits (143),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+
Sbjct  112  VELSKGENVFAQISDGGVGWFLGTTALLTVASMVPLFKGI  151


 Score = 52.8 bits (125),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 7/110 (6%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P  P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPFMPSTSASA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            + P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   SQPQMPPSPPPVSKPKVSTKFR--DLLAFSGPAPERINGRLAMVGFVAAI  110



>ref|XP_010034491.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010034497.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84140.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=178

 Score = 57.4 bits (137),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 59/119 (50%), Gaps = 26/119 (22%)
 Frame = +1

Query  142  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +                        +K ST+  DVF+FSGP PERINGRLAMIGF AA+
Sbjct  61   S-----------------------KSKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAI  96


 Score = 55.1 bits (131),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  98   VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  138



>gb|KCW85053.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score = 60.1 bits (144),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 59/120 (49%), Gaps = 23/120 (19%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQ---FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M SI  SP T+    + +S      P++  PRL       VR M+E+      P
Sbjct  1    MASTILMHSITASPRTAINISSRISVVRGLFPANRSPRLAPRGGLRVRCMAEESKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +  +                      K ST+  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SPKL--------------------KWKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAIA  100


 Score = 52.4 bits (124),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL  QIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  101  VELSKGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVT  141



>emb|CDY46608.1| BnaCnng14300D [Brassica napus]
Length=196

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  116  VELSKGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGIT  156


 Score = 51.6 bits (122),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 5/115 (4%)
 Frame = +1

Query  148  STVVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  324
            ++V MQS+    + + K N N +  F   ++ P L+RN    V+ M+E +  K++ + P 
Sbjct  4    ASVNMQSVFACGLATRKINTNKL--FFAGNF-PNLKRNYPVGVKCMAEGEPMKDE-SAPS  59

Query  325  TEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+
Sbjct  60   TSAAKPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAAL  114



>ref|XP_007225903.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
 gb|EMJ27102.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
Length=191

 Score = 57.4 bits (137),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+NG D+FAQISNGGV+ F+ ++ LL++AS++PLF+GV+
Sbjct  110  AVELSNGQDVFAQISNGGVSLFVATSILLSVASLVPLFKGVS  151


 Score = 55.1 bits (131),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 15/121 (12%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSF---KNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  309
            MA++  MQSI  +   ++   KN++ GVS  V     P L+  P  +  S    D  K+Q
Sbjct  1    MAASSSMQSIFLASSVAYGARKNKSVGVSHLVA----PTLRSYPHMMRVSSMAKDGQKKQ  56

Query  310  PTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            P+T VT +S   P     P P             D+F+FSGP PERINGRLAM+GF +A+
Sbjct  57   PST-VTNASKVPPPSPSSPPPKVST------KFSDLFAFSGPAPERINGRLAMVGFVSAL  109

Query  490  G  492
             
Sbjct  110  A  110



>ref|XP_010435088.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=190

 Score = 59.7 bits (143),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTTALLTVASMVPLFKGI  149


 Score = 52.8 bits (125),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 15/113 (13%)
 Frame = +1

Query  160  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  330
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAI  108



>ref|XP_010440410.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score = 61.2 bits (147),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  149


 Score = 50.8 bits (120),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAI  108



>ref|XP_010279260.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=145

 Score = 60.8 bits (146),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV
Sbjct  65   VELAKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGV  104


 Score = 51.2 bits (121),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +FSGP PERINGRLAMIGF AAM
Sbjct  38   DVLAFSGPAPERINGRLAMIGFVAAM  63



>gb|KFK39567.1| hypothetical protein AALP_AA3G261100 [Arabis alpina]
Length=195

 Score = 63.5 bits (153),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G ++FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+T
Sbjct  114  AVELSKGENVFAQISDGGVSWFLGTTAILTLASLVPLFKGIT  155


 Score = 48.5 bits (114),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +1

Query  238  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  417
             P L RN    VR M+E++  KE  +TP T ++   PK   PP+P P     S+    D+
Sbjct  32   FPNLVRNYPVGVRCMAEEEPIKED-STPSTSAAQPLPKSPSPPTPTPTKPKVST-KFRDL  89

Query  418  FSFSGPGPERINGRLAMIGFAAAMG  492
             +FSGP PERINGRLAM+GF AA+ 
Sbjct  90   LAFSGPAPERINGRLAMVGFVAALA  114



>ref|XP_010450013.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score = 60.1 bits (144),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG++ALLTLAS++PLF+G+
Sbjct  110  VELSKGENVFAQISDGGVGWFLGTSALLTLASMVPLFKGI  149


 Score = 52.0 bits (123),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 9/110 (8%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  SP     +RN     +  +     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFASPSGGLSSRN-----IRKTSQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAI  108



>ref|XP_008224237.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Prunus mume]
Length=189

 Score = 57.8 bits (138),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 65/118 (55%), Gaps = 11/118 (9%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++  MQSI L + + ++  RN  S  V    +P L R P+  VRSM++D   KEQP+T
Sbjct  1    MAASSSMQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNMKVRSMAKD-GKKEQPST  57

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             VT +S   P    P                D+ +FSGP PERINGRLAM+GF +A+ 
Sbjct  58   -VTNASKNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALA  108


 Score = 53.9 bits (128),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL  G D+FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+
Sbjct  108  AVELFKGQDVFAQISDGGVSLFVGTSILLSVASLIPLFKGVS  149



>ref|XP_009148406.1| PREDICTED: early light-induced protein 2, chloroplastic [Brassica 
rapa]
Length=191

 Score = 60.5 bits (145),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL  G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  111  VELLKGENVFAQISDGGVGWFLGTTALLTLASMIPLFKGI  150


 Score = 51.2 bits (121),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = +1

Query  253  RNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSG  432
            RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FSG
Sbjct  34   RNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFSG  90

Query  433  PGPERINGRLAMIGFAAAM  489
            P PERINGRLAM+GF AA+
Sbjct  91   PAPERINGRLAMVGFVAAI  109



>ref|XP_008438620.1| PREDICTED: early light-induced protein 1, chloroplastic [Cucumis 
melo]
Length=192

 Score = 57.8 bits (138),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E++ G D+F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+
Sbjct  112  VEVSKGQDVFEQIANGGIPWFVGTSVVLTLASLIPLFKGVS  152


 Score = 53.5 bits (127),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 58/116 (50%), Gaps = 6/116 (5%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            MA++ VMQSI  S  +    R   ++ +P++     +   +F VR   E+D  +EQ    
Sbjct  1    MAASAVMQSIPSSTASRGVYRTTTNRLLPAAVRLCSRNTGAFRVRCTGEEDQ-REQAIPS  59

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                S    +P P  +              D+ +FSGPGPERINGRLAMIGF AA+
Sbjct  60   SIPPSPPKLEPAPSSTSKVTST-----KFTDILAFSGPGPERINGRLAMIGFVAAL  110



>ref|XP_009375990.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375991.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score = 55.8 bits (133),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            MA++  MQS+L S V       G S+ V  S+L    R    +VRS +E+   +E+P++ 
Sbjct  1    MAASASMQSLLASSVV---YGAGKSRSVRVSHLVPANRFRHMVVRSTAENGQ-EERPSST  56

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            + E+S   P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+
Sbjct  57   IPEASKIPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSAL  111


 Score = 55.5 bits (132),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+F+QIS+GGV+ FLG++ LL++AS IPLF+GV+
Sbjct  112  AVELSKGQDVFSQISDGGVSLFLGTSILLSVASAIPLFKGVS  153



>ref|XP_006285275.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
 gb|EOA18173.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
Length=192

 Score = 59.7 bits (143),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++ AQIS+GGV WFLG+TALLT+AS+IPLFQG+
Sbjct  112  VELSKGENVLAQISDGGVGWFLGTTALLTMASMIPLFQGI  151


 Score = 51.2 bits (121),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 7/110 (6%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P     +RN     + ++     +RN    VR M++    KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQIFFKRNAPVGVRCMAQGGPIKEDPSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   TQPQMPPSPPPVSKPKVSTKFR--DLLAFSGPAPERINGRLAMVGFVAAI  110



>ref|XP_006406123.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
 gb|ESQ47576.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
Length=197

 Score = 61.2 bits (147),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +1

Query  142  MASTVV-MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA+T   MQS+    +T+   R   ++   +     L+RN    VR M+E D  K++ TT
Sbjct  1    MATTSFNMQSVFAGGLTT--RRINTNKLSFAGNFSNLKRNYPVGVRCMAEGDPMKDESTT  58

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            P T ++   PK + PP P P    K ST L D+ +FSGP PERINGRLAM+GF AA+
Sbjct  59   PSTSAAQPMPKASSPPPPPPPTKPKVSTKLGDLLAFSGPAPERINGRLAMVGFVAAL  115


 Score = 49.7 bits (117),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++  QIS+GGV+WFL +TA+ T AS +PL +G+T
Sbjct  117  VELSKGENVLTQISDGGVSWFLVTTAIFTFASFVPLLKGIT  157



>ref|XP_010435087.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=192

 Score = 59.7 bits (143),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+
Sbjct  112  VELSKGENVFAQISDGGVGWFLGTTALLTVASMVPLFKGI  151


 Score = 51.2 bits (121),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 7/110 (6%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE  + P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSTSA  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   AQPQMPPSPPPVSKPKVST--KFGDLLAFSGPAPERINGRLAMVGFVAAI  110



>ref|XP_006285225.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
 gb|EOA18123.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
Length=191

 Score = 58.9 bits (141),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++ AQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  111  VELSKGENVLAQISDGGVGWFLGTTALLTLASMIPLFKGI  150


 Score = 52.0 bits (123),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  339
            MQS+  +P     +RN     + ++     +RN     R M++ D  KE P+ P T ++ 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGFRCMAQGDPIKEDPSVPSTSAAQ  62

Query  340  tapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                P+PPP  +    +       D+ +FSGP PERINGRLAM+GF AA+
Sbjct  63   PQMPPSPPPPVSKPKVST---KFGDLLAFSGPAPERINGRLAMVGFVAAI  109



>ref|XP_009341096.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341098.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009343967.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score = 56.6 bits (135),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT--SFKNRNG-VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  MQS+L + V   + K+R+  V   VP+       R    +VRSM+E+  G+E+ 
Sbjct  1    MAASASMQSLLANSVVYGAGKSRSARVIHLVPA------NRYRHMVVRSMAEN--GQEEQ  52

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            ++     ++  P P P  +P+P    K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  53   SSSTIPEASKTPLPPPTATPSPPPPKKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALA  112


 Score = 54.7 bits (130),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+F QIS+GGV+ FL ++ LL++ASVIPLF+GV+
Sbjct  112  AVELSKGQDVFTQISDGGVSLFLATSILLSVASVIPLFKGVS  153



>gb|KHN15724.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=178

 Score = 57.4 bits (137),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +E+A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+
Sbjct  97   AVEVAKGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVS  138


 Score = 53.1 bits (126),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 62/117 (53%), Gaps = 23/117 (20%)
 Frame = +1

Query  145  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  321
            AS+  MQSIL +P+    + + V+QF VP+ +   ++RN    VRSM+E++   E P TP
Sbjct  3    ASSYAMQSILANPMIRISSGSRVNQFGVPALH---MRRNVGLRVRSMAEEEQPSE-PATP  58

Query  322  VTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            VT  S+   KP                    V + S   PERINGRLAMIGF AAM 
Sbjct  59   VTPPSSIEGKPQ------------------PVSTPSAKSPERINGRLAMIGFVAAMA  97



>ref|XP_009371939.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score = 55.5 bits (132),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+F+QIS+GGV+ FLG++ LL++AS IPLF+GV+
Sbjct  113  VELSKGQDVFSQISDGGVSLFLGTSILLSVASAIPLFKGVS  153


 Score = 54.7 bits (130),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 72/119 (61%), Gaps = 11/119 (9%)
 Frame = +1

Query  142  MASTVVMQSILGSPVT--SFKNRNG-VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  MQS+L S V   + K+R+  VS  VP++   R+      +VRS +E+   +E+P
Sbjct  1    MAASPSMQSLLASSVVYGAGKSRSVRVSHLVPANRFRRM------VVRSTAENGQ-EERP  53

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++ + E+S   P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+
Sbjct  54   SSSIPEASKIPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSAL  111



>gb|KFK23556.1| hypothetical protein AALP_AAs41881U000200 [Arabis alpina]
Length=194

 Score = 60.8 bits (146),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+
Sbjct  114  VELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFKGI  153


 Score = 49.7 bits (117),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +1

Query  247  LQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSF  426
             +RN S +V+ M++DD  KE  ++P + S+     P+ P  P P    K ST   D+ +F
Sbjct  33   FKRNASMVVKCMAQDDLIKENSSSP-SSSAAQPQIPSSPLPPPPVSKPKVSTKFGDLLAF  91

Query  427  SGPGPERINGRLAMIGFAAAM  489
            SGP PERINGRLAM+GF AA+
Sbjct  92   SGPAPERINGRLAMVGFVAAI  112



>gb|AAL32038.1|AF439279_1 early light-induced protein-like protein [Retama raetam]
Length=141

 Score = 61.6 bits (148),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +ELA G D+FAQISNGG+ WFLG++ +L+LAS+IPLF+GV+
Sbjct  61   VELAKGQDVFAQISNGGILWFLGTSVVLSLASLIPLFRGVS  101


 Score = 48.5 bits (114),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +FSGP PERINGRLAMIGF AA+
Sbjct  34   DVLAFSGPAPERINGRLAMIGFVAAI  59



>gb|ACJ09655.1| putative cold-inducible protein [Cupressus sempervirens]
Length=165

 Score = 64.3 bits (155),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 52/115 (45%), Gaps = 31/115 (27%)
 Frame = +1

Query  178  SPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDD----------AGKEQPTTPVT  327
            SPV+    R   SQ  P SY+PRLQRN    VR M+EDD              QP +P  
Sbjct  2    SPVSGVTARARFSQ-TPCSYVPRLQRNAGMQVRCMAEDDHKDVTPITTPPPTSQPISPPP  60

Query  328  EssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +   +                       DV +FSG  PERINGRLAMIGF AAM 
Sbjct  61   KPKVSTKS--------------------DVLAFSGCAPERINGRLAMIGFVAAMA  95


 Score = 45.8 bits (107),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
             +EL+N  D+ AQISNGGV W+  S  +LTLAS+IPLF+G
Sbjct  95   AVELSNE-DVLAQISNGGVPWYRTSI-VLTLASLIPLFKG  132



>ref|XP_007224626.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
 gb|EMJ25825.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
Length=189

 Score = 55.8 bits (133),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL NG D+FAQISNGGV+ F+ ++ LL++AS++PLF+GV+
Sbjct  108  AVELYNGQDVFAQISNGGVSLFVATSILLSVASLVPLFKGVS  149


 Score = 54.3 bits (129),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 67/118 (57%), Gaps = 13/118 (11%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQPT  315
            MA++  MQSI L + V     +N   + V    +P L R +P   VRSM++D   KEQP+
Sbjct  1    MAASSSMQSIFLANSVAYGAGKN---KCVGVISVPALHRYSPPMRVRSMAKDGQ-KEQPS  56

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            T VT +S + P P  P      +         D+F+FSGP PERINGRLAM+GF +A+
Sbjct  57   T-VTNASKSPPPPLTPLPSKASI------KFSDLFAFSGPAPERINGRLAMVGFVSAL  107



>gb|KCW84137.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=239

 Score = 55.5 bits (132),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  159  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  199


 Score = 54.7 bits (130),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 24/120 (20%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E       P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAESKP-DLNP  118

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  119  SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  158



>gb|EPS65382.1| early light inducible protein [Genlisea aurea]
Length=166

 Score = 59.7 bits (143),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G E A+G DL  Q+ NGGV+WFL ++A+LTLAS++PLFQGVT
Sbjct  85   GAEFASGQDLSEQLQNGGVSWFLATSAVLTLASLVPLFQGVT  126


 Score = 50.1 bits (118),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  415  VFSFSGPGPERINGRLAMIGFAAAMG  492
            +F+F GPGPERINGRLAMIGF AA+G
Sbjct  60   IFAFGGPGPERINGRLAMIGFVAAIG  85



>ref|XP_011028244.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Populus euphratica]
Length=132

 Score = 60.5 bits (145),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++
Sbjct  52   VELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGIS  92


 Score = 49.7 bits (117),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAMIGF AAM
Sbjct  25   DLLAFSGPAPERINGRLAMIGFVAAM  50



>ref|XP_010676773.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=175

 Score = 54.7 bits (130),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 27/118 (23%)
 Frame = +1

Query  142  MASTVVMQS-ILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            M+ ++ MQS +L +PV +  N + ++  V P  + PR+ +  +F V+ M+ D+  K +P 
Sbjct  1    MSMSMQMQSGLLVNPVGALSNGSRMTYMVSPLGFNPRMTKRVNFEVKCMAGDEP-KPKPQ  59

Query  316  TPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              V+                        T+  D+F+FSGP PERINGRLAMIGF AA+
Sbjct  60   PKVS------------------------TSFGDLFAFSGPAPERINGRLAMIGFVAAV  93


 Score = 54.7 bits (130),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
            +EL+ G DLF+QISNGG  +F+G++ LL++AS++PLFQG
Sbjct  95   VELSKGTDLFSQISNGGAEYFIGTSILLSVASLVPLFQG  133



>gb|KCW84143.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=132

 Score = 58.2 bits (139),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  52   VELSKGQDLFAQISEGGIPWFIGTSILLSVASLVPLLQGVT  92


 Score = 50.8 bits (120),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DVF+FSGP PERINGRLAMIGF AA+
Sbjct  25   DVFAFSGPAPERINGRLAMIGFVAAI  50



>ref|XP_008224236.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=192

 Score = 56.6 bits (135),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL NG D+FAQISNGGV+ F+ ++ LL++AS+IPLF+GV+
Sbjct  112  VELYNGQDVFAQISNGGVSLFVATSILLSVASLIPLFKGVS  152


 Score = 52.0 bits (123),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 52/99 (53%), Gaps = 12/99 (12%)
 Frame = +1

Query  196  KNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppsp  372
            KN++ GVS  V     P L   P  +  S    D  K+QP+T VT +S   P     P P
Sbjct  23   KNKSVGVSHLVA----PTLHSYPHMMRVSSMARDGQKKQPST-VTNASKVPPPSPSSPPP  77

Query  373  apkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                       L D+F+FSGP PERINGRLAM+GF +A+
Sbjct  78   KVSA------KLSDLFAFSGPAPERINGRLAMVGFVSAL  110



>ref|XP_010525221.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525223.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=198

 Score = 54.7 bits (130),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQ+S+GGV WF+G++ALLT+AS++PLF+GV+
Sbjct  118  VELSKGENVLAQLSDGGVGWFVGTSALLTVASLVPLFKGVS  158


 Score = 53.5 bits (127),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 61/111 (55%), Gaps = 3/111 (3%)
 Frame = +1

Query  160  MQSILGSPVT-SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  336
            MQS+   P T S       ++F  +  +P  +RN S +VR M+E +  +E  + P + S 
Sbjct  8    MQSVFTGPATGSVTQGMKSNRFCLAGTVPGFKRNASMVVRCMAEGEPTRED-SAP-SSSP  65

Query  337  ttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
              A  P     P+P    K ST   DV +FSGP PERINGRLAM+GF AA+
Sbjct  66   AGATPPEIKSKPSPPPKPKVSTKFSDVLAFSGPAPERINGRLAMVGFVAAL  116



>emb|CDY67220.1| BnaCnng53960D [Brassica napus]
 emb|CDY61075.1| BnaCnng37300D [Brassica napus]
 emb|CDX79257.1| BnaC06g20460D [Brassica napus]
Length=195

 Score = 58.9 bits (141),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+T
Sbjct  115  VELSKGENVLAQISDGGVSWFLGTAAILTLASLVPLFKGIT  155


 Score = 49.3 bits (116),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 65/113 (58%), Gaps = 10/113 (9%)
 Frame = +1

Query  160  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  330
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T V++
Sbjct  8    MQSVFAGGLTTRKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSVSQ  64

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                +  P PPP   PKV+ K S    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  65   PLPKSSSPPPPPPTKPKVSTKFS----DLLAFSGPAPERINGRLAMVGFVAAL  113



>ref|XP_011463234.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=158

 Score = 61.2 bits (147),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 65/114 (57%), Gaps = 7/114 (6%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPS--SYLPR-LQRNPSFLVRSMSEDDAGKEQPTTPVTE  330
            MQSILGS V     +N V+Q   S  +Y P  LQR  +  VRSM  D   KEQ TT    
Sbjct  1    MQSILGSSVAYGACKNKVNQINVSAVTYAPSYLQRFSNMRVRSM--DGQNKEQQTT--VP  56

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            S+  + +   P SP P  + K ST   D F+FSGP PERINGRLAM GF AA+ 
Sbjct  57   STLGSSQTPAPSSPLPPRSPKVSTTFSDTFAFSGPAPERINGRLAMAGFVAALA  110


 Score = 47.0 bits (110),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G  +FAQ+ NGG+  FLG++ LL++AS++PL +GVT
Sbjct  110  AVELSKGQYVFAQLFNGGIPLFLGTSILLSVASLVPLLKGVT  151



>emb|CDY42783.1| BnaC01g22830D [Brassica napus]
Length=189

 Score = 61.6 bits (148),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  109  VELSKGENVFAQISDGGVGWFLGTTALLTLASMIPLFKGI  148


 Score = 46.2 bits (108),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF AA+
Sbjct  82   DLLAFSGPAPERINGRLAMVGFVAAI  107



>ref|XP_009135830.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
Length=195

 Score = 59.3 bits (142),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+T
Sbjct  115  VELSKGENILAQISDGGVSWFLGTAAILTLASLVPLFKGIT  155


 Score = 48.5 bits (114),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 10/113 (9%)
 Frame = +1

Query  160  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  330
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSASQ  64

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                +  P PPP   PKV+ K S    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  65   PLPKSSSPPPPPPTKPKVSTKFS----DLLAFSGPAPERINGRLAMVGFVAAL  113



>emb|CDX92959.1| BnaA03g36810D [Brassica napus]
Length=195

 Score = 59.3 bits (142),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+T
Sbjct  115  VELSKGENILAQISDGGVSWFLGTAAILTLASLVPLFKGIT  155


 Score = 48.1 bits (113),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 10/113 (9%)
 Frame = +1

Query  160  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  330
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPIKDESAPSTSASQ  64

Query  331  ssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
                +  P PPP   PKV+ K S    D+ +FSGP PERINGRLAM+GF AA+
Sbjct  65   PLPKSSSPPPPPPTKPKVSTKFS----DLLAFSGPAPERINGRLAMVGFVAAL  113



>ref|XP_009337531.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=197

 Score = 62.4 bits (150),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA+T+ MQSI  S V     ++ V+Q  VP++Y P   R  + +    +  D  KEQPTT
Sbjct  1    MAATISMQSICTSSVAYGVGKSIVNQLIVPANYAPINLRKLAHMRVIATAKDEQKEQPTT  60

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             +T++S  +      P P P        +  DV +FSGP PERIN RLAM+GF AA+ 
Sbjct  61   -ITDASENSEPAPSSPLPPPPPKVSPKFS--DVLAFSGPAPERINNRLAMVGFVAALA  115


 Score = 44.7 bits (104),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +2

Query  497  ELANGGDLFAQISNGG-VTWFLGSTALLTLASVIPLFQGVT  616
            EL+ G D+FAQIS G  +  FL ++ LL++AS++PLF+GV+
Sbjct  117  ELSKGQDVFAQISKGSRIPLFLCTSILLSVASLVPLFKGVS  157



>ref|NP_188923.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
 sp|P93735.1|ELIP1_ARATH RecName: Full=Early light-induced protein 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB88391.1| early light-induced protein [Arabidopsis thaliana]
 dbj|BAB01259.1| early light-inducable protein-like [Arabidopsis thaliana]
 gb|AAL09799.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAL77679.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM19939.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM62548.1| early light-induced protein [Arabidopsis thaliana]
 gb|AEE76682.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
Length=195

 Score = 59.3 bits (142),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G++
Sbjct  115  VELSKGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGIS  155


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF AA+
Sbjct  88   DLLAFSGPAPERINGRLAMVGFVAAL  113



>ref|XP_008224234.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=149

 Score = 55.5 bits (132),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQIS+GGV+ FL ++ LL++ASVIPLF+GV+
Sbjct  69   VELSKGQDVFAQISDGGVSVFLATSILLSVASVIPLFKGVS  109


 Score = 50.8 bits (120),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DVF+FSGP PERINGRLAM+GF +AM
Sbjct  42   DVFAFSGPAPERINGRLAMVGFVSAM  67



>gb|ADV19257.1| putative cold-inducible protein-like protein [Helleborus orientalis]
Length=148

 Score = 57.0 bits (136),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            ELA G D+ AQI+NGG+ WF+G++ +LT AS+IPLF+GV+
Sbjct  69   ELAKGDDVVAQIANGGLPWFVGTSVVLTFASLIPLFKGVS  108


 Score = 49.3 bits (116),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 41/85 (48%), Gaps = 18/85 (21%)
 Frame = +1

Query  238  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDV  417
            +PR QR+    VR M+E+    EQ T P                       K  T   DV
Sbjct  1    MPRQQRSGCMQVRCMAEEKL-PEQSTPP-----------------PAPKVNKVITRFSDV  42

Query  418  FSFSGPGPERINGRLAMIGFAAAMG  492
             +FSGP PERINGRLAMIGF AA+ 
Sbjct  43   LAFSGPAPERINGRLAMIGFVAAIA  67



>gb|KDP40234.1| hypothetical protein JCGZ_02232 [Jatropha curcas]
Length=194

 Score = 53.5 bits (127),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 60/123 (49%), Gaps = 18/123 (15%)
 Frame = +1

Query  142  MASTVVMQ-SILGSPVTSFKNRNGVS-QFVPSSYLPRLQRNPSFLVRSMSE-----DDAG  300
            MA    MQ ++   P      R  VS +F+ + Y+PR  R     V+ M+E      +  
Sbjct  1    MAGATAMQGAVFAGPALRVSTRARVSGRFLATPYVPRPGRVAYTPVKCMAEGYQKEQEVE  60

Query  301  KEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFA  480
            K QPT PV             P P P    K ST   DV +F+GP PERINGRLAM+GF 
Sbjct  61   KIQPTEPV-----------GAPKPKPTPPPKFSTKFSDVLAFAGPAPERINGRLAMVGFV  109

Query  481  AAM  489
            AA+
Sbjct  110  AAI  112


 Score = 52.4 bits (124),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E+A G D FAQ+S+GG+  F+G++ +L+LAS+IPLF+GV+
Sbjct  114  VEVAKGQDFFAQLSDGGIPLFVGTSIVLSLASLIPLFKGVS  154



>ref|XP_006286322.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
 gb|EOA19220.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
Length=114

 Score = 58.5 bits (140),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+ G ++ AQIS+GGV WF+G+TALLTLAS++PLFQG+
Sbjct  34   VELSKGENVLAQISDGGVGWFIGTTALLTLASMVPLFQGI  73


 Score = 46.6 bits (109),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF AA+
Sbjct  7    DLLAFSGPAPERINGRLAMVGFVAAI  32



>ref|XP_006838940.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
 gb|ERN01509.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
Length=192

 Score = 53.9 bits (128),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            G+ELA G D+ +Q+++GG+ WF+GS+A+LTLAS+IPL +GV
Sbjct  109  GVELARGNDVASQLASGGLWWFVGSSAVLTLASLIPLLKGV  149


 Score = 50.8 bits (120),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+ +FSGPGPERINGRLAM+GF +A+G
Sbjct  83   DILAFSGPGPERINGRLAMVGFVSALG  109



>gb|KCW84141.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=129

 Score = 54.3 bits (129),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVT
Sbjct  49   VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVT  89


 Score = 50.8 bits (120),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DVF+FSGP PERINGRLAMIGF AA+
Sbjct  22   DVFAFSGPAPERINGRLAMIGFVAAI  47



>ref|XP_009341107.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=215

 Score = 57.0 bits (136),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  134  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  175


 Score = 47.8 bits (112),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  108  DLFAFSGPVPERINGRLAMVGFVSALA  134



>ref|XP_007226151.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
 gb|EMJ27350.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
Length=189

 Score = 52.8 bits (125),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 60/119 (50%), Gaps = 15/119 (13%)
 Frame = +1

Query  142  MASTVVMQSIL---GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MA++  MQSI     S      N   V  F     +P L R P+  VRSM +D   KEQP
Sbjct  1    MAASSSMQSIFLANNSVAYGAGNNKSVGPF----SVPALHRYPNMRVRSMVKD-GKKEQP  55

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +T VT +S   P    P              + D+ +FSGP PERINGRLAM+GF +A+
Sbjct  56   ST-VTNASKNPPPSNTPFPSKVST------KISDLLAFSGPAPERINGRLAMVGFVSAL  107


 Score = 51.6 bits (122),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL  G D+FAQIS+GG + F+G++ LL++AS+IPLF+GV+
Sbjct  109  VELFKGQDVFAQISDGGFSLFVGTSILLSVASLIPLFKGVS  149



>ref|XP_009341102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=187

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  107  VELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  147


 Score = 47.4 bits (111),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+F+FSGP PERINGRLAM+GF +A+
Sbjct  80   DLFAFSGPVPERINGRLAMVGFVSAL  105



>ref|XP_009343965.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  113  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  154


 Score = 47.4 bits (111),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALA  113



>ref|XP_009343966.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  112  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  153


 Score = 47.4 bits (111),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALA  112



>ref|XP_009341101.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  113  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  154


 Score = 47.4 bits (111),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALA  113



>ref|XP_008360362.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=193

 Score = 56.6 bits (135),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPLF+G++
Sbjct  114  ELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPLFKGLS  153


 Score = 47.4 bits (111),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMGN  495
            D+F+FSGP PERINGRLAM+GF +A+  
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSAIAT  113



>ref|XP_009341094.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009341099.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score = 56.6 bits (135),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  113  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  154


 Score = 47.4 bits (111),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALA  113



>ref|XP_008360363.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=192

 Score = 56.6 bits (135),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPLF+G++
Sbjct  113  ELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPLFKGLS  152


 Score = 47.4 bits (111),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMGN  495
            D+F+FSGP PERINGRLAM+GF +A+  
Sbjct  85   DLFAFSGPVPERINGRLAMVGFVSAIAT  112



>gb|ABK22971.1| unknown [Picea sitchensis]
Length=193

 Score = 55.8 bits (133),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA+G DLF+Q++ GGV+ F+GS  +L+LAS+IP+F+GV+
Sbjct  111  GVELASGKDLFSQLATGGVSLFVGSAVVLSLASLIPMFKGVS  152


 Score = 48.1 bits (113),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PE INGRLAM+GF +A+G
Sbjct  85   DIFAFSGPAPETINGRLAMLGFVSAVG  111



>ref|XP_009341095.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009341100.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score = 56.6 bits (135),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  112  AVELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  153


 Score = 47.4 bits (111),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PERINGRLAM+GF +A+ 
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALA  112



>gb|AFP90212.1| early light-induced protein, partial [Pinus armandii]
Length=120

 Score = 55.8 bits (133),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A+G DLF+Q++ GGV  FLGS  LL++ASVIP+F+GV+
Sbjct  47   GVEIASGRDLFSQLATGGVPLFLGSAILLSVASVIPMFKGVS  88


 Score = 48.1 bits (113),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+FSGP PE INGRLAM+GF +A+G
Sbjct  21   DVFAFSGPAPETINGRLAMLGFVSAVG  47



>ref|XP_010676774.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=198

 Score = 52.8 bits (125),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +1

Query  160  MQSILGSPVTSFKNRNGVSQFVPS-SYLPRLQRNPSFLVRSMSEDDA-GKEQPTTPVTEs  333
            MQS+L +PV +  N + +++   +  + PR+ +  +F V+ M+++   G+ +  + + ++
Sbjct  5    MQSLLVNPVGAVANGSRMTRVTYALGFNPRMSKRVNFGVKCMADEKVEGEPKLDSGLPKT  64

Query  334  sttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            + T   PTP P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+
Sbjct  65   NPTTVSPTPTPTPTPKPQPKVSTSFGDLFAFSGPAPERINGRLAMIGFVAAV  116


 Score = 50.4 bits (119),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
            +E + G DLF QIS+GG  WFL ++ LL++AS++PLF+G
Sbjct  118  VEASKGTDLFTQISDGGAQWFLATSILLSVASLVPLFKG  156



>ref|XP_009343974.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=174

 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+IPLF G++
Sbjct  94   VELSKGQDVFAQISNGGVSLFLGTSILITVASLIPLFNGLS  134


 Score = 47.4 bits (111),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+F+FSGP PERINGRLAM+GF +A+
Sbjct  67   DLFAFSGPVPERINGRLAMVGFVSAL  92



>sp|Q01931.1|DS22_CRAPL RecName: Full=Desiccation stress protein DSP-22, chloroplastic; 
Flags: Precursor [Craterostigma plantagineum]
 emb|CAA47164.1| dsp-22 [Craterostigma plantagineum]
Length=199

 Score = 52.8 bits (125),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA G D+F+Q+ NGGV WFL ++A+L LA++IP+++G++
Sbjct  116  GVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLS  157


 Score = 50.1 bits (118),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 17/125 (14%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTSFKNRNGVSQFVPS-------SY-LPRLQRNPSFLVRSMSEDDA  297
            MAS+    +I   P  S + ++ +++F P+       SY LP ++RN  F VRSM ED+ 
Sbjct  1    MASSTCYATI---PAMSCRGQSTITRFGPNNLFLGKQSYELPLMRRNAKFTVRSMREDNE  57

Query  298  GKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGF  477
             +EQ      ++    P  TP  +              D+FSF G  PERINGR AMIGF
Sbjct  58   KEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTV------DLFSFDGLAPERINGRSAMIGF  111

Query  478  AAAMG  492
             AA+G
Sbjct  112  VAAVG  116



>ref|XP_008391008.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=192

 Score = 55.5 bits (132),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG++ FLG++ LL++AS+IPL +GV+
Sbjct  112  VELSKGQDVFAQISNGGISLFLGTSILLSVASLIPLLKGVS  152


 Score = 47.0 bits (110),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 7/83 (8%)
 Frame = +1

Query  241  PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVF  420
            P +   P   + SM++D   K+QP+T +TE+S ++ + TP PSP             ++F
Sbjct  35   PTVHSYPQIRICSMAKDGQ-KKQPST-ITEASKSSSRXTPSPSPGKVST-----KFSELF  87

Query  421  SFSGPGPERINGRLAMIGFAAAM  489
            +FSGP PERINGRLAM+GF +A+
Sbjct  88   AFSGPVPERINGRLAMVGFVSAL  110



>gb|ABR16462.1| unknown [Picea sitchensis]
Length=158

 Score = 54.7 bits (130),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA+G DLF+Q+ +GGV  F+GS  L T+AS+IP+F+GV+
Sbjct  76   GVELASGKDLFSQLGSGGVPLFVGSAVLFTVASLIPMFKGVS  117


 Score = 47.8 bits (112),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+FSGP PE INGRLAM+GF +A+G
Sbjct  50   DVFAFSGPAPETINGRLAMLGFVSAVG  76



>gb|ABR16737.1| unknown [Picea sitchensis]
Length=155

 Score = 54.3 bits (129),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A+G DLF+Q++ GGV+ F+GS  +L+LAS+IP+F+GV+
Sbjct  73   GVEVASGKDLFSQLATGGVSLFVGSAVVLSLASLIPMFKGVS  114


 Score = 47.8 bits (112),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PE INGRLAM+GF +A+G
Sbjct  47   DIFAFSGPAPETINGRLAMLGFVSAVG  73



>gb|ABK24316.1| unknown [Picea sitchensis]
Length=193

 Score = 53.5 bits (127),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+
Sbjct  111  GVELASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVS  152


 Score = 48.1 bits (113),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 6/74 (8%)
 Frame = +1

Query  271  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERI  450
            V+ M+E D   ++  TP T+S+T  P P PP                DVF+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDVFAFSGPAPETI  97

Query  451  NGRLAMIGFAAAMG  492
            NGRLAM+GF +A+G
Sbjct  98   NGRLAMLGFVSAVG  111



>ref|XP_008224238.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Prunus mume]
Length=183

 Score = 53.5 bits (127),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL  G D+FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+
Sbjct  102  AVELFKGQDVFAQISDGGVSLFVGTSILLSVASLIPLFKGVS  143


 Score = 47.8 bits (112),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 59/118 (50%), Gaps = 17/118 (14%)
 Frame = +1

Query  142  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  318
            MA++  MQSI L + + ++  RN  S  V    +P L R P+         D  KEQP+T
Sbjct  1    MAASSSMQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNM-------KDGKKEQPST  51

Query  319  PVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
             VT +S   P    P                D+ +FSGP PERINGRLAM+GF +A+ 
Sbjct  52   -VTNASKNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALA  102



>ref|XP_010923519.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Elaeis guineensis]
Length=189

 Score = 53.5 bits (127),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +ELA G DL  Q+ NGG+ WF G+ ALL++AS++PLF+GV+
Sbjct  108  AVELARGDDLATQLMNGGLPWFAGTAALLSVASLVPLFKGVS  149


 Score = 47.8 bits (112),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DV +FSGP PERINGRLAMIGF +A+ 
Sbjct  82   DVLAFSGPAPERINGRLAMIGFVSALA  108



>ref|XP_010935694.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=187

 Score = 55.5 bits (132),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +ELA G DL AQ+ NGG+ WF G+ ALL++AS++PLF+GV+
Sbjct  107  VELAKGDDLAAQLMNGGLPWFAGTAALLSVASLVPLFKGVS  147


 Score = 45.8 bits (107),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF +A+
Sbjct  80   DMLAFSGPAPERINGRLAMVGFVSAL  105



>gb|AEW08119.1| hypothetical protein 2_114_01, partial [Pinus radiata]
 gb|AFG63030.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63031.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63032.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63033.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63034.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63035.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63036.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63037.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63038.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63039.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63040.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63041.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63042.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score = 55.1 bits (131),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  470  LGSRRRWGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            LG     G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+IP+F+GV+
Sbjct  37   LGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASLIPMFKGVS  85


 Score = 46.2 bits (108),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+F GP PE INGRLAM+GF +A+G
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALG  44



>ref|XP_009413904.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413905.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=184

 Score = 53.9 bits (128),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL  G DL AQ++NGG+ WF G+ ALL+ AS++PLF+GV+
Sbjct  103  AVELTRGDDLVAQLANGGLPWFAGTAALLSAASLVPLFKGVS  144


 Score = 47.0 bits (110),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+ +FSGP PERINGRLAMIGF +A+ 
Sbjct  77   DILAFSGPAPERINGRLAMIGFVSAIA  103



>ref|XP_009343962.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=199

 Score = 57.0 bits (136),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G D+FAQISNGG++ FLG++ LL++AS+IPLF+GV+
Sbjct  119  VELSMGQDVFAQISNGGISLFLGTSILLSVASLIPLFKGVS  159


 Score = 43.9 bits (102),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  241  PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVF  420
            P +   P   + SM++D   K+  T      ++  P P PPPS       K ST   D+F
Sbjct  35   PTVHSYPQIRICSMAKDSQKKQPSTVTQASKNSPPPPPPPPPSTPSPSPGKVSTKFSDLF  94

Query  421  SFSGPGPERINGRLAMIGFAAAM  489
             FSGP  ERINGRLAM+GF +A+
Sbjct  95   GFSGPVLERINGRLAMVGFVSAL  117



>ref|XP_009586916.1| PREDICTED: early light-induced protein 2, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=115

 Score = 55.1 bits (131),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            G E  +G ++FAQ+S+ G  WFLG++ALLTLAS+IPLFQ +
Sbjct  33   GTEFGDGANIFAQLSSRGFAWFLGTSALLTLASLIPLFQAI  73


 Score = 46.2 bits (108),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMGNGAG  504
            D+F+FSGP  ERIN RLAMIGF AA+G   G
Sbjct  7    DLFAFSGPALERINDRLAMIGFVAALGTEFG  37



>gb|AFG63029.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score = 54.7 bits (130),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  470  LGSRRRWGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            LG     G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+IP+F+GV+
Sbjct  37   LGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASLIPMFKGVS  85


 Score = 46.2 bits (108),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+F GP PE INGRLAM+GF +A+G
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALG  44



>gb|ACN39996.1| unknown [Picea sitchensis]
 gb|ACN40868.1| unknown [Picea sitchensis]
Length=193

 Score = 52.4 bits (124),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+
Sbjct  111  GVEVASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVS  152


 Score = 48.1 bits (113),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+FSGP PE INGRLAM+GF +A+G
Sbjct  85   DVFAFSGPAPETINGRLAMLGFVSAVG  111



>ref|XP_010935701.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=160

 Score = 55.1 bits (131),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +ELA G DL AQ+ NGG+ WF G+ ALL++AS++PLF+GV+
Sbjct  80   VELAKGDDLAAQLMNGGLPWFAGTAALLSVASLVPLFKGVS  120


 Score = 45.8 bits (107),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF +A+
Sbjct  53   DMLAFSGPAPERINGRLAMVGFVSAL  78



>emb|CAA63338.1| unnamed protein product [Helianthus annuus]
Length=174

 Score = 51.6 bits (122),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+NG D+FAQIS+GGV  F+ +  +L++AS++PLF+GV
Sbjct  94   VELSNGQDVFAQISHGGVPAFVATRLVLSVASLVPLFKGV  133


 Score = 48.1 bits (113),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 13/81 (16%)
 Frame = +1

Query  250  QRNPSF-LVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstNLWDVFSF  426
            +RN +F +VR MS+D    +QP+T  +++ +  P P P P  +            DV +F
Sbjct  24   RRNINFAVVRCMSQD----QQPSTDASKTPSAPPPPPPAPKVST--------KFSDVLAF  71

Query  427  SGPGPERINGRLAMIGFAAAM  489
             GP PERINGRLAMIGF +AM
Sbjct  72   GGPAPERINGRLAMIGFVSAM  92



>ref|XP_009341105.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341108.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=151

 Score = 54.3 bits (129),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
             +EL+ G D+FAQISNGG++ FLG++ LL++AS+IPLF+ V+
Sbjct  70   AVELSKGQDVFAQISNGGISLFLGTSILLSVASLIPLFKRVS  111


 Score = 45.1 bits (105),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D F+FSGP PERINGRLAM+GF +A+ 
Sbjct  44   DWFAFSGPVPERINGRLAMVGFVSALA  70



>gb|ABK24238.1| unknown [Picea sitchensis]
Length=193

 Score = 50.4 bits (119),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+ELA+G DL +Q+ +GGV  F+GS  L ++AS+IP+F+GV+
Sbjct  111  GVELASGKDLLSQLGSGGVPLFVGSAVLFSVASLIPMFKGVS  152


 Score = 48.5 bits (114),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+FSGP PE INGRLAM+GF +A+G
Sbjct  85   DVFAFSGPAPETINGRLAMLGFVSAVG  111



>ref|XP_002976832.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ21942.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score = 51.2 bits (121),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  470  LGSRRRWGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            LG     G+ELA+G  L  Q+ NGG ++F+G+  L TLAS++PLFQGV+
Sbjct  106  LGFTAALGVELASGRGLLGQLDNGGSSYFVGAALLFTLASLVPLFQGVS  154


 Score = 47.0 bits (110),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +  D+F+FSGP PE +NGRLAM+GF AA+G
Sbjct  84   SFLDLFAFSGPVPEAVNGRLAMLGFTAALG  113



>gb|AGH13359.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score = 51.2 bits (121),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+NG D+FAQIS+GGV  F+ ++ +L++AS++PLF+GV
Sbjct  34   VELSNGQDVFAQISHGGVPAFVATSLVLSVASLVPLFKGV  73


 Score = 47.4 bits (111),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +F GP PERINGRLAMIGF +AM
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAM  32



>gb|AGH13354.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13355.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13357.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13358.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score = 50.8 bits (120),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+NG D+FAQIS+GGV  F+ ++ +L++AS++PLF+GV
Sbjct  34   VELSNGQDVFAQISHGGVPAFVATSLVLSVASLVPLFKGV  73


 Score = 47.0 bits (110),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +F GP PERINGRLAMIGF +AM
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAM  32



>ref|XP_002980561.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ18212.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score = 51.2 bits (121),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  470  LGSRRRWGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            LG     G+ELA+G  L  Q+ NGG ++F+G+  L TLAS++PLFQGV+
Sbjct  106  LGFTAALGVELASGRGLLGQLDNGGSSYFVGAALLFTLASLVPLFQGVS  154


 Score = 46.6 bits (109),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PE +NGRLAM+GF AA+G
Sbjct  87   DLFAFSGPVPEAVNGRLAMLGFTAALG  113



>gb|ACN40010.1| unknown [Picea sitchensis]
Length=167

 Score = 48.9 bits (115),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A+G DLF+Q++  GV  F+GS  +L+ AS+IP+F+GV+
Sbjct  85   GVEVASGKDLFSQLATVGVPLFVGSAVVLSFASLIPMFKGVS  126


 Score = 48.1 bits (113),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            DVF+FSGP PE INGRLAM+GF +A+G
Sbjct  59   DVFAFSGPAPETINGRLAMLGFVSAVG  85



>ref|XP_008786056.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=193

 Score = 49.7 bits (117),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +ELA G  L  Q+ NGG+ WF G+ ALL++AS++PLF+GV+
Sbjct  113  VELARGDGLATQLMNGGLPWFAGTAALLSVASLVPLFKGVS  153


 Score = 45.8 bits (107),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            D+ +FSGP PERINGRLAM+GF +A+
Sbjct  86   DMLAFSGPAPERINGRLAMVGFVSAL  111



>ref|XP_003557497.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score = 54.3 bits (129),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD+ SFSGP PERINGRLAM+GF AA+
Sbjct  59   SVWDILSFSGPAPERINGRLAMVGFVAAL  87


 Score = 41.2 bits (95),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L +Q  +G G+ WFL +TALL++AS++PL QG
Sbjct  89   VEAARGGGLLSQAGSGAGMGWFLTTTALLSVASLVPLLQG  128



>gb|AGH13356.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score = 48.5 bits (114),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  613
            +EL+NG D+FA IS+GGV  F+ ++ +L++AS++PLF+GV
Sbjct  34   VELSNGLDVFAHISHGGVPAFVATSLVLSVASLVPLFKGV  73


 Score = 45.4 bits (106),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +F GP PERINGRLAMIGF + M
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSTM  32



>ref|XP_008777102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=176

 Score = 47.0 bits (110),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +FSGP PERINGRLAM+GF +A+
Sbjct  69   DVLAFSGPAPERINGRLAMVGFVSAL  94


 Score = 46.2 bits (108),  Expect(2) = 9e-11, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL  G DL AQ+ NGG+ WF  +  L ++AS++PLF+GV+
Sbjct  96   VELVRGDDLAAQLMNGGLLWFAATAVLWSVASLVPLFKGVS  136



>gb|AAP80747.1| early light-induced protein [Kandelia candel]
Length=74

 Score = 50.1 bits (118),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DV +F GPGPERINGRLAMIGF AAM
Sbjct  20   DVLAFGGPGPERINGRLAMIGFVAAM  45


 Score = 43.1 bits (100),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGST  568
            +EL+ G D+F QISNGGVTWFLG+T
Sbjct  47   IELSKGQDVFTQISNGGVTWFLGAT  71



>ref|XP_010228291.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=193

 Score = 51.6 bits (122),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAAL  108


 Score = 41.2 bits (95),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L +Q  +G G+ WFL +TALL++AS++PL QG
Sbjct  110  VEAARGGGLLSQAGSGAGLGWFLTTTALLSVASLVPLLQG  149



>gb|KCW84132.1| hypothetical protein EUGRSUZ_B010072, partial [Eucalyptus grandis]
Length=133

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 65/128 (51%), Gaps = 25/128 (20%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E +     P
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEGNKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +                        +K STN  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SP----------------------KSKVSTNFRDVFAFSGPAPERINGRLAMIGFVAAIS  98

Query  493  NGAGQRRR  516
                QR R
Sbjct  99   VELSQRPR  106



>ref|XP_003557495.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=188

 Score = 51.2 bits (121),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +WD  +FSGP PERINGRLAM+GF AA+
Sbjct  76   VWDALAFSGPAPERINGRLAMVGFVAAL  103


 Score = 41.2 bits (95),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L +Q  +G G+ WFL +TALL++AS++PL QG
Sbjct  105  VEAARGGGLLSQAGSGAGLGWFLTTTALLSVASLVPLLQG  144



>ref|XP_010045778.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=144

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 65/128 (51%), Gaps = 25/128 (20%)
 Frame = +1

Query  142  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  312
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E +     P
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEGNKPDLNP  60

Query  313  TTPVTEssttapkptpppspapkvaaksstNLWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            +                        +K STN  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   S----------------------PKSKVSTNFRDVFAFSGPAPERINGRLAMIGFVAAIS  98

Query  493  NGAGQRRR  516
                QR R
Sbjct  99   VELSQRPR  106



>gb|AFP90187.1| early light-induced protein, partial [Pinus densata]
Length=120

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E+A+G DL +Q+++GGV  F GS+ LLT AS+IP+F+GV+
Sbjct  48   VEIASGRDLISQLASGGVPLFSGSSLLLTFASLIPMFRGVS  88


 Score = 43.1 bits (100),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            N  +VF+FSGP PE INGRLA++GF +A+
Sbjct  18   NFKEVFAFSGPVPETINGRLAVLGFVSAI  46



>dbj|BAJ86766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score = 56.2 bits (134),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 8/119 (7%)
 Frame = +1

Query  142  MASTVVMQSILGSPV--TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            +A+T ++  ++ + V  +SF     V +  P+SY P L R  + LVR+ +E D    +PT
Sbjct  13   LATTCILLLVMTTMVALSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI---EPT  67

Query  316  TPVTEssttapkptpppspapkvaaksst-NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
               T +ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF AA+
Sbjct  68   KETTSASTSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFVAAL  126


 Score = 35.8 bits (81),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG
Sbjct  128  VEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQG  167



>dbj|BAJ97969.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score = 56.2 bits (134),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (61%), Gaps = 8/119 (7%)
 Frame = +1

Query  142  MASTVVMQSILGSPV--TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  315
            +A+T ++  ++ + V  +SF     V +  P+SY P L R  + LVR+ +E D    +PT
Sbjct  12   LATTCILLLVMTTMVALSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI---EPT  66

Query  316  TPVTEssttapkptpppspapkvaaksst-NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
               T +ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF AA+
Sbjct  67   KETTSASTSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFVAAL  125


 Score = 35.8 bits (81),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG
Sbjct  127  VEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQG  166



>gb|EMT18433.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=184

 Score = 54.7 bits (130),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 8/90 (9%)
 Frame = +1

Query  226  PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstN  405
            P+S+ P L R  + LVR+ +E D        P  E+++ +     P         K   N
Sbjct  16   PASWSPALTRQRALLVRAQTEPD------IEPTKETTSASTSSPTPTPSPVAPKPKPKAN  69

Query  406  --LWDVFSFSGPGPERINGRLAMIGFAAAM  489
              +WD  +FSGP PERINGRLAM+GF AA+
Sbjct  70   PSVWDALAFSGPAPERINGRLAMVGFVAAL  99


 Score = 35.4 bits (80),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG
Sbjct  101  VEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQG  140



>ref|XP_003557498.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score = 56.2 bits (134),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD+ SFSGP PERINGRLAM+GF  A+G  AG+
Sbjct  58   SIWDILSFSGPAPERINGRLAMVGFVTALGVEAGR  92


 Score = 33.9 bits (76),  Expect(2) = 8e-10, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (66%), Gaps = 1/41 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            G+E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  87   GVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSVASLVPLLQG  127



>ref|XP_002461536.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
 gb|EER98057.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
Length=244

 Score = 52.0 bits (123),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            LWD  +FSGP PERINGRLAM+GF +A+ 
Sbjct  132  LWDALAFSGPAPERINGRLAMVGFVSALA  160


 Score = 37.7 bits (86),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 29/41 (71%), Gaps = 1/41 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
             +E + GG L +Q  +G G+TWF  + A+L++AS++PL +G
Sbjct  160  AVEASRGGGLLSQAGSGSGLTWFAATAAVLSVASLVPLLKG  200



>gb|ABR15761.1| early light-inducible protein [Spirogyra varians]
Length=183

 Score = 47.4 bits (111),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAM  489
            DVFSFSGP PE INGRLAM+GF  A+
Sbjct  76   DVFSFSGPAPETINGRLAMLGFTTAL  101


 Score = 42.0 bits (97),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +E A G  L +Q+S  G  WF+ S +L + AS+IP+FQGVT
Sbjct  103  VEKATGAPLTSQLSGVGFEWFVFSASLFSAASLIPMFQGVT  143



>dbj|BAJ86949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score = 52.0 bits (123),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAAL  107


 Score = 36.6 bits (83),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q+ +G G+ WFL + A+ ++AS++PL QG
Sbjct  109  VEAARGGGLLDQVGSGAGLGWFLTTAAVFSVASLVPLVQG  148



>gb|ACI87755.1| putative early light-induced protein [Cupressus sempervirens]
Length=121

 Score = 45.4 bits (106),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  491  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            G+E+A+G DL +Q+++GG+ WF+ +  LLT AS++PL +G++
Sbjct  40   GVEVASGRDLLSQVNSGGLPWFVLTAGLLTAASLVPLSKGIS  81


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PE INGR AM+GF +A+G
Sbjct  14   DLFAFSGPVPEIINGRAAMLGFVSAIG  40



>gb|ACI87803.1| putative early light-induced protein [Cupressus sempervirens]
Length=129

 Score = 49.7 bits (117),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  470  LGSRRRWGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  610
            LGS     +E+A+G DL +Q+++GGV+WFL +  LLT ASV PL QG
Sbjct  48   LGSVSAIAVEVASGKDLVSQVNSGGVSWFLITAGLLTAASVAPLVQG  94


 Score = 38.5 bits (88),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +1

Query  412  DVFSFSGPGPERINGRLAMIGFAAAMG  492
            D+F+FSGP PE INGR AM+G  +A+ 
Sbjct  29   DLFAFSGPAPEIINGRAAMLGSVSAIA  55



>gb|EMS57269.1| hypothetical protein TRIUR3_20794 [Triticum urartu]
Length=186

 Score = 52.8 bits (125),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +1

Query  226  PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaaksstN  405
            P+S+ P L R  + L+R+ +E D   E      + S+++      P    PK   K++ +
Sbjct  16   PASWSPALPRRRALLIRAQTEPD--IESTKETTSASTSSPTPTPTPSPVVPKPKPKANPS  73

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAM  489
            +WD  +FSGP PERINGRLAM+GF AA+
Sbjct  74   VWDALAFSGPAPERINGRLAMVGFVAAL  101


 Score = 35.4 bits (80),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG
Sbjct  103  VEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQG  142



>ref|NP_001152703.1| early light-induced protein [Zea mays]
 gb|ACG49056.1| early light-induced protein [Zea mays]
Length=192

 Score = 51.6 bits (122),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  79   GLWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.8 bits (81),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>ref|NP_001152683.1| early light-induced protein [Zea mays]
 gb|ACG48904.1| early light-induced protein [Zea mays]
Length=192

 Score = 51.6 bits (122),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAM  489
            LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.8 bits (81),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>ref|NP_001152927.1| early light-induced protein [Zea mays]
 gb|ACG25950.1| early light-induced protein [Zea mays]
Length=192

 Score = 51.6 bits (122),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  79   GLWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.8 bits (81),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>dbj|BAJ90110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91617.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score = 51.6 bits (122),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  77   SVWDALAFSGPAPERINGRLAMVGFVAAL  105


 Score = 35.8 bits (81),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL +  LL++AS++PL QG
Sbjct  107  VEAARGGGLLDQAGSGAGLGWFLVTAGLLSVASLVPLLQG  146



>gb|ACG24515.1| early light-induced protein [Zea mays]
Length=192

 Score = 51.6 bits (122),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  79   GLWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.8 bits (81),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>dbj|BAJ89047.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 51.2 bits (121),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAAL  108


 Score = 35.8 bits (81),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL +  + +LAS++PL QG
Sbjct  110  VEAARGGGLLDQAGSGAGLGWFLATAGVFSLASLVPLLQG  149



>gb|EMT24337.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=189

 Score = 51.2 bits (121),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  76   SVWDALAFSGPAPERINGRLAMVGFVAAL  104


 Score = 35.8 bits (81),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG
Sbjct  106  VEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQG  145



>ref|XP_004955632.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=181

 Score = 51.2 bits (121),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  68   GLWDALAFSGPAPERINGRLAMVGFVSAL  96


 Score = 35.8 bits (81),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  98   VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLKG  137



>dbj|BAJ90265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score = 52.0 bits (123),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAAL  107


 Score = 35.0 bits (79),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNGG-VTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q+ +G  + WFL + A+ ++AS++PL QG
Sbjct  109  VEAARGGGLLDQVGSGARLGWFLTTAAVFSVASLVPLLQG  148



>ref|NP_001152179.1| early light-induced protein [Zea mays]
 gb|ACG46269.1| early light-induced protein [Zea mays]
Length=192

 Score = 51.2 bits (121),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAM  489
            LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.8 bits (81),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>tpg|DAA42559.1| TPA: early light-induced protein [Zea mays]
Length=192

 Score = 51.2 bits (121),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAM  489
            LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSAL  107


 Score = 35.4 bits (80),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  109  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRG  148



>gb|EMS65479.1| hypothetical protein TRIUR3_00475 [Triticum urartu]
Length=168

 Score = 51.2 bits (121),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  55   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  89


 Score = 35.4 bits (80),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+S+G G  WF  S A+L++AS++PL QG
Sbjct  85   VEAGRGDGLLSQLSSGTGQAWFAYSVAVLSVASLVPLLQG  124



>ref|XP_004955631.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Setaria italica]
Length=200

 Score = 51.2 bits (121),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWD  +FSGP PERINGRLAM+GF +A+
Sbjct  87   GLWDALAFSGPAPERINGRLAMVGFVSAL  115


 Score = 35.4 bits (80),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L +Q  +G G+ WF  + A+L++AS++PL +G
Sbjct  117  VEASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLKG  156



>ref|XP_006379855.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 ref|XP_006379856.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57652.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57653.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
Length=90

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = +2

Query  494  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVT  616
            +EL+ G DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+
Sbjct  10   VELSKGQDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVS  50



>sp|P14895.1|ELI5_HORVU RecName: Full=High molecular mass early light-inducible protein 
HV58, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33728.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=231

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAAL  145


 Score = 33.9 bits (76),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (5%)
 Frame = +2

Query  494  MELANGGDLFAQIS--NGGVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q+   + G+ WFL +  + ++AS++PL QG
Sbjct  147  VEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQG  187



>gb|EMS45625.1| hypothetical protein TRIUR3_10356 [Triticum urartu]
Length=167

 Score = 50.8 bits (120),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  56   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  90


 Score = 34.7 bits (78),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  S A+LT+AS++PL QG
Sbjct  86   VEAGRGDGLLSQLGSGTGQAWFAYSVAVLTVASLVPLLQG  125



>gb|EMS45333.1| hypothetical protein TRIUR3_35028 [Triticum urartu]
Length=232

 Score = 50.8 bits (120),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  119  SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  153


 Score = 34.3 bits (77),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  S A+LT+AS++PL QG
Sbjct  149  VEAGRGDGLLSQLGSGTGQAWFAYSVAVLTVASLVPLLQG  188



>ref|NP_001059030.1| Os07g0178800 [Oryza sativa Japonica Group]
 dbj|BAF20944.1| Os07g0178800 [Oryza sativa Japonica Group]
Length=192

 Score = 52.8 bits (125),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWDV +FSGP PERINGRLAM+GF +A+
Sbjct  79   GLWDVLAFSGPAPERINGRLAMVGFVSAL  107


 Score = 32.0 bits (71),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L  Q  +G G+ WF  +  +L+ AS++PL +G
Sbjct  109  VEASRGGGLLEQAGSGDGLAWFAATATVLSAASLVPLLRG  148



>ref|XP_004955634.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=178

 Score = 51.6 bits (122),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +1

Query  406  LWDVFSFSGPGPERINGRLAMIGFAAAMG  492
            LWD  +FSGP PERINGRLAM+GF +A+ 
Sbjct  66   LWDALAFSGPAPERINGRLAMVGFVSALA  94


 Score = 33.1 bits (74),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 1/41 (2%)
 Frame = +2

Query  491  GMELANGGDLFAQISN-GGVTWFLGSTALLTLASVIPLFQG  610
             +E A G  L AQ  N  G+TWF  +  +L+ AS+ PL QG
Sbjct  94   AVEAARGDGLLAQAGNSAGLTWFAYTAIVLSAASLAPLLQG  134



>dbj|BAD30330.1| putative low molecular mass early light-induced protein,chloroplast 
precursor (ELIP) [Oryza sativa Japonica Group]
 gb|EAZ38893.1| hypothetical protein OsJ_23312 [Oryza sativa Japonica Group]
Length=187

 Score = 52.4 bits (124),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
             LWDV +FSGP PERINGRLAM+GF +A+
Sbjct  74   GLWDVLAFSGPAPERINGRLAMVGFVSAL  102


 Score = 32.0 bits (71),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E + GG L  Q  +G G+ WF  +  +L+ AS++PL +G
Sbjct  104  VEASRGGGLLEQAGSGDGLAWFAATATVLSAASLVPLLRG  143



>gb|EMT23518.1| hypothetical protein F775_14184 [Aegilops tauschii]
Length=230

 Score = 51.2 bits (121),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAAL  145


 Score = 33.1 bits (74),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL +  + ++AS++PL QG
Sbjct  147  VEAARGGGLLDQAGSGVGLGWFLVTAGVFSVASLVPLLQG  186


 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQRRRPLCSD  531
            ++WD  +FSGP PERINGRLAM+GF AA+   A +  +P   D
Sbjct  78   SVWDALAFSGPAPERINGRLAMVGFVAALTVEAAREGQPSVWD  120



>gb|EMS68027.1| hypothetical protein TRIUR3_23641 [Triticum urartu]
Length=188

 Score = 51.2 bits (121),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAM  489
            ++WD  +FSGP PERINGRLAM+GF AA+
Sbjct  75   SVWDALAFSGPAPERINGRLAMVGFVAAL  103


 Score = 33.1 bits (74),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E A GG L  Q  +G G+ WFL +  + ++AS++PL QG
Sbjct  105  VEAARGGGLLDQAGSGAGLGWFLVTAGVFSVASLVPLLQG  144



>dbj|BAJ84888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 50.8 bits (120),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAG  504
            ++WD  +FSGP PERINGRLAM+GF  A+   AG
Sbjct  59   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAG  92


 Score = 33.1 bits (74),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  S A+L++AS++PL QG
Sbjct  89   VEAGRGDGLLSQLGSGTGQAWFAYSVAVLSVASLVPLLQG  128



>gb|EMS65481.1| hypothetical protein TRIUR3_00477 [Triticum urartu]
Length=170

 Score = 50.8 bits (120),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  57   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  91


 Score = 33.5 bits (75),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  S A+L++AS++PL QG
Sbjct  87   VEAGRGDGLLSQLGSGTGQAWFAYSVAVLSVASLVPLLQG  126



>sp|P14896.1|ELI6_HORVU RecName: Full=Low molecular mass early light-inducible protein 
HV60, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33726.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
 dbj|BAK04255.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 50.8 bits (120),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  54   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGR  88


 Score = 33.1 bits (74),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  84   VEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQG  123



>dbj|BAJ86624.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91978.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score = 50.4 bits (119),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAG  504
            ++WD  +F+GP PERINGRLAM+GF  A+   AG
Sbjct  60   SIWDALAFAGPAPERINGRLAMVGFVTALAVEAG  93


 Score = 33.5 bits (75),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  S A+L++AS++PL QG
Sbjct  90   VEAGRGDGLLSQLGSGTGQAWFAYSVAVLSVASLVPLLQG  129



>gb|EMS51739.1| hypothetical protein TRIUR3_09306 [Triticum urartu]
Length=200

 Score = 51.2 bits (121),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  87   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  121


 Score = 32.3 bits (72),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  117  VEAGRGDGLLSQLGSGTGQAWFAYTVAVLSVASLVPLLQG  156



>dbj|BAJ88670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 50.8 bits (120),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGR  93


 Score = 32.7 bits (73),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  89   VEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQG  128



>dbj|BAJ98694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 50.8 bits (120),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGR  93


 Score = 32.7 bits (73),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  89   VEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQG  128



>gb|EMT08136.1| Low molecular mass early light-inducible protein HV90, chloroplastic 
[Aegilops tauschii]
Length=168

 Score = 50.8 bits (120),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  55   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGR  89


 Score = 32.3 bits (72),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  + +Q+ +G G  WF  S A+L++AS++PL QG
Sbjct  85   VEAGRGDGILSQLGSGTGQAWFAYSVAVLSVASLVPLLQG  124



>dbj|BAJ91644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score = 50.4 bits (119),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  403  NLWDVFSFSGPGPERINGRLAMIGFAAAMGNGAGQ  507
            ++WD  +FSGP PERINGRLAM+GF  A+   AG+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGR  93


 Score = 32.7 bits (73),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +2

Query  494  MELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQG  610
            +E   G  L +Q+ +G G  WF  + A+L++AS++PL QG
Sbjct  89   VEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQG  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090