BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF029L02

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57281.1|  protein kinase family protein                        69.7    4e-11   Ipomoea nil [qian niu]



>dbj|BAO57281.1| protein kinase family protein [Ipomoea nil]
Length=401

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  305  MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPG  403
            MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPG
Sbjct  1    MDLRTSVDGGEVPKGDYSGHPEGELGSKLKGPG  33



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175